BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 174 bits (441), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT 60 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT Sbjct: 1 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT 60 Query: 61 INQVLVLNVPTANSLQNWFLLSTNLSEC 88 INQVLVLNVPTANSLQNWFLLSTNLSEC Sbjct: 61 INQVLVLNVPTANSLQNWFLLSTNLSEC 88 >gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 34.7 bits (78), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 51 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100 >gi|254780815|ref|YP_003065228.1| hypothetical protein CLIBASIA_03530 [Candidatus Liberibacter asiaticus str. psy62] Length = 232 Score = 26.2 bits (56), Expect = 0.12, Method: Compositional matrix adjust. Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 22 ANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQV--LVLNVPTANSLQNWF 79 A+I + +++I + + S+ +I + G + + V N+P +N NW Sbjct: 167 ASIEENTVYITIRIVGQFISASYDKDNLLISSDPEIFGKVIDIWTFVRNIPPSNP--NWV 224 Query: 80 LLSTNLSE 87 L+ST L E Sbjct: 225 LISTKLGE 232 >gi|254780465|ref|YP_003064878.1| threonine synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 469 Score = 22.7 bits (47), Expect = 1.1, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Query: 37 SEINNMSW-KILTTMIG--CSSAMLGTINQVLVLNVPTAN 73 S IN+++W +I+ ++ SS LG+ N+ + +VPT N Sbjct: 217 SGINSINWARIMAQIVYYFVSSIALGSPNRNISFSVPTGN 256 >gi|254780670|ref|YP_003065083.1| phosphopyruvate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 21.6 bits (44), Expect = 2.6, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 37 SEINNMSWKILTTMIGCSSAMLG 59 SE + WKILT IG + ++G Sbjct: 287 SEDDWHGWKILTNKIGSNCQLVG 309 >gi|254780427|ref|YP_003064840.1| hypothetical protein CLIBASIA_01560 [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 21.2 bits (43), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 52 GCSSAMLGTI 61 GCSS MLG I Sbjct: 95 GCSSLMLGDI 104 >gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 21.2 bits (43), Expect = 3.4, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 13/27 (48%) Query: 44 WKILTTMIGCSSAMLGTINQVLVLNVP 70 WK LT C G+I+ V NVP Sbjct: 521 WKDLTEGFACVVQEGGSISARRVANVP 547 >gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Score = 20.4 bits (41), Expect = 5.3, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 23/43 (53%) Query: 22 ANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQV 64 A I DM + +Q+ + + + + LT+ I S +L INQ+ Sbjct: 161 AEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQM 203 >gi|254781049|ref|YP_003065462.1| succinyl-CoA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 20/35 (57%) Query: 19 VEIANIRADMSGTSMKIQSEINNMSWKILTTMIGC 53 ++I +R S +I+++ +N+S+ L IGC Sbjct: 237 LDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGC 271 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 20.0 bits (40), Expect = 7.8, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 16/29 (55%) Query: 23 NIRADMSGTSMKIQSEINNMSWKILTTMI 51 N+RA + I+ EI + +KI+ ++ Sbjct: 742 NVRASSQARVLAIKDEIKILYYKIIYDLL 770 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.124 0.344 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,517 Number of Sequences: 1233 Number of extensions: 1289 Number of successful extensions: 16 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of query: 88 length of database: 328,796 effective HSP length: 56 effective length of query: 32 effective length of database: 259,748 effective search space: 8311936 effective search space used: 8311936 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)