HHsearch alignment for GI: 254780341 and conserved domain: COG0581

>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism].
Probab=99.88  E-value=8.4e-20  Score=137.69  Aligned_cols=139  Identities=31%  Similarity=0.512  Sum_probs=121.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---HHHHHCCCHHHHHHHHCCCCCHHHHHH----HHC--CCCHHH
Q ss_conf             48449999999999999978876667764210121---123202350345442012021011000----000--210178
Q gi|254780341|r   87 QGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY---PRFYSIIRLFLDSMQTIPTFVYLIPAL----VLF--GLGMVP  157 (281)
Q Consensus        87 ~g~W~~~~~Tl~~~~~~~~ia~~igiplGi~~~~~---~~~~~~~~p~l~~~~~iP~~v~l~p~i----~~f--G~g~~~  157 (281)
T Consensus        67 gGi~~Ai~GTl~~~~~~~li~~PiGv~aaIYL~EYa~~~~~t~~ir~~i~~La~vPSIV~GLFg~~~fV~~~g~~~S~la  146 (292)
T COG0581          67 GGIGPAIVGTLYLILLAILIGVPLGIGAGIYLAEYAKKSRLTKVIRFAIDILASVPSIVYGLFGLGFFVVTLGFGFSALA  146 (292)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             73699999999999999999998999999999997478729999999999880684499999999999999777617999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999998878999995887412998999999960788201012236886267999999999999999
Q gi|254780341|r  158 GIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLS  225 (281)
Q Consensus       158 ~i~a~~i~~~~pi~~~t~~gl~~v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~~l~  225 (281)
T Consensus       147 GaLaLall~LP~iirtteeaL~~VP~~~ReAs~aLGasKwqtI~~vvlP~A~pGIiTGviLaiaR~~G  214 (292)
T COG0581         147 GALALALLMLPVVIRTTEEALRAVPDSLREAAYALGATKWQTIFKVVLPAALPGIITGVILAIARAAG  214 (292)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999888999999999980899999999974984878978888971475899999999999987