HHsearch alignment for GI: 254780341 and conserved domain: PRK10352

>PRK10352 nickel transporter permease NikB; Provisional.
Probab=99.75  E-value=1.2e-16  Score=118.68  Aligned_cols=193  Identities=21%  Similarity=0.161  Sum_probs=154.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CHHHHHCCCHHHHHHHHCCCCCHHHHHHHHCC----------CCHH
Q ss_conf             44999999999999997887666776421012--11232023503454420120210110000002----------1017
Q gi|254780341|r   89 YWQETTETLSLVLVSTFISMFIGVPLGVLAAW--YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFG----------LGMV  156 (281)
Q Consensus        89 ~W~~~~~Tl~~~~~~~~ia~~igiplGi~~~~--~~~~~~~~~p~l~~~~~iP~~v~l~p~i~~fG----------~g~~  156 (281)
T Consensus        94 I~~~lp~Tl~L~~~a~~l~~~igi~lGi~aa~~~~~~~D~~~~~~~~~~~siP~F~la~lli~~fa~~l~~~P~~g~~~~  173 (314)
T PRK10352         94 MLNFLPATLELAGAALVLILLTSVPLGIWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGW  173 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCH
T ss_conf             88763788999999999999998599999872079721013105899878731999999999999996476787677833


Q ss_pred             H----HHHHHHHHHHHHHHHHHHHHHHC-CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8----89999998878999995887412-998999999960788201012236886267999999999999999999999
Q gi|254780341|r  157 P----GIVATIVFSIPTSVRLTRLGIIS-TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTA  231 (281)
Q Consensus       157 ~----~i~a~~i~~~~pi~~~t~~gl~~-v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~~l~~vvia~  231 (281)
T Consensus       174 ~~liLP~l~l~l~~~a~~~r~~R~~~~e~l~~dyv~~ArakGls~~~i~~rh~lrnal~P~it~~~~~~~~ll~GavivE  253 (314)
T PRK10352        174 QHIILPAVSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLSDRQVERRHILRNASLPMITAVGMHIGELIGGTMIIE  253 (314)
T ss_pred             HHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHHHHCCHHHEE
T ss_conf             65411199999999999999999999998632999999986989313608652874298899999999999847761001


Q ss_pred             H-HCCCCHHHHHHHHHHHHCHHHHHHHHHHHHHH----HHHHHHHHHHHHHHCCC
Q ss_conf             9-70588049999999740789899999999999----99999999987421059
Q gi|254780341|r  232 L-VGSNGLGVPVLRALNTVDIGRGFESGLCIVIL----AIILDRLFSIPDPRDRI  281 (281)
Q Consensus       232 ~-ig~~GLG~~i~~a~~~~~~~~~~~~~l~Iv~l----ai~lDri~~~~~~r~~~  281 (281)
T Consensus       254 ~iF~~pGlG~ll~~Ai~~rD~p~v~g~~l~~~~~~v~~nli~Dily~~lDPRiR~  308 (314)
T PRK10352        254 NIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNAALDPRIRR  308 (314)
T ss_pred             HHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             8754767599999999813889999999999999999999999999964863157