HHsearch alignment for GI: 254780341 and conserved domain: PRK10999

>PRK10999 malF maltose transporter membrane protein; Provisional.
Probab=99.38  E-value=9.2e-11  Score=83.27  Aligned_cols=149  Identities=21%  Similarity=0.313  Sum_probs=104.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCHHHHHCCCHHHHHHHHCCCCCHHHHHH---------------HHCC
Q ss_conf             4499999999999999788766677642101-21123202350345442012021011000---------------0002
Q gi|254780341|r   89 YWQETTETLSLVLVSTFISMFIGVPLGVLAA-WYPRFYSIIRLFLDSMQTIPTFVYLIPAL---------------VLFG  152 (281)
Q Consensus        89 ~W~~~~~Tl~~~~~~~~ia~~igiplGi~~~-~~~~~~~~~~p~l~~~~~iP~~v~l~p~i---------------~~fG  152 (281)
T Consensus       283 f~~v~~WT~~fa~~sv~~~~~lGl~lAllln~~~~rgr~~~R~l~ilP~avP~~is~lvw~~mfn~~~G~iN~~L~~l~g  362 (520)
T PRK10999        283 FIAIFVWTVVFSLLTVVFTVAVGMVLACLVQWEALKGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFG  362 (520)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCC
T ss_conf             56667667899999999999999999998287566607689999999989999999999998428886579999998059


Q ss_pred             CC------HHHH----HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10------1788----9999998878999995887412998999999960788201012236886267999999999999
Q gi|254780341|r  153 LG------MVPG----IVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIML  222 (281)
Q Consensus       153 ~g------~~~~----i~a~~i~~~~pi~~~t~~gl~~v~~~~~eaa~~~Gas~~q~l~~V~lP~a~P~i~~Gi~~~~~~  222 (281)
T Consensus       363 ~~~~Wl~dp~~A~~~viiv~~W~g~p~~~i~~la~Lq~IP~~lyEAA~iDGA~~~~~f~~ITlPll~~~~~~lli~~~i~  442 (520)
T PRK10999        363 IKPAWFSDPTTARTMILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAF  442 (520)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99863479699999999999995172999999998715998999999852965650451467202358899999999999


Q ss_pred             HHHHHHHHHHHCCCC
Q ss_conf             999999999970588
Q gi|254780341|r  223 SLSMVVVTALVGSNG  237 (281)
Q Consensus       223 ~l~~vvia~~ig~~G  237 (281)
T Consensus       443 ~fn~F~~I~llT~GG  457 (520)
T PRK10999        443 NFNNFVLIQLLTNGG  457 (520)
T ss_pred             HHHCHHHHHHHCCCC
T ss_conf             962525776434899