BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780341|ref|YP_003064754.1| proline/glycine betaine ABC
transporter, permease protein [Candidatus Liberibacter asiaticus str.
psy62]
         (281 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|307331451|ref|ZP_07610568.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Streptomyces violaceusniger Tu 4113]
 gi|306882894|gb|EFN13963.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Streptomyces violaceusniger Tu 4113]
          Length = 872

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 112/268 (41%), Positives = 163/268 (60%), Gaps = 1/268 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           LGD++      L  N  W  + +S ++    + +  VL    PL+F  +++LL   + R 
Sbjct: 6   LGDWINSGVNWLRDNLSWLFDFISSVVQGMYDGLNTVLSGPEPLLFAGILALLAWWL-RG 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           +  AV   +G  LI     W E   TL+LVLV+  I++   VPLG+ A+      ++IR 
Sbjct: 65  LLPAVLAFLGFALIDSIELWGEAMNTLALVLVAGVITIVFAVPLGIWASRNRAVSAVIRP 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIP +  FGLG+VPG+VAT++FS+P  VR+T LGI      L EAA 
Sbjct: 125 VLDFMQTMPAFVYLIPGIFFFGLGVVPGVVATVIFSMPPGVRMTELGIRQVDAELVEAAD 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG  P +   +V+ P A+P I+A + Q IML+LSMVV+  +VG+ GLG  V +A+++VD
Sbjct: 185 AFGTHPRRTLLRVQFPLALPTIMAGVNQVIMLALSMVVIAGMVGAEGLGSTVFQAISSVD 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPR 278
           +  GFE G+ +VILA+ LDR+ S  + R
Sbjct: 245 VAMGFEGGIAVVILAMYLDRMTSALNQR 272


>gi|302546698|ref|ZP_07299040.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces hygroscopicus ATCC 53653]
 gi|302464316|gb|EFL27409.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces himastatinicus ATCC 53653]
          Length = 873

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 112/271 (41%), Positives = 162/271 (59%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            + LGD++      L  N  W  + +S ++    + V  VL    PL+   ++++L   +
Sbjct: 3   RLELGDWINSGVNWLRDNLSWLFDFISSVVQGMYDGVNSVLSAPEPLLLAGILAVLAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  AV    G  LI     W E   TL+LVLV+  I++   VPLG+ A+      + 
Sbjct: 63  -RGLLPAVLAFAGFALIDSIELWGEAMNTLALVLVAGAITIVFAVPLGIWASRNRGVSAS 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           IR  LD MQT+P FVYLIP +  FGLG+VPG+VAT++FS+P  VR+T LGI      L E
Sbjct: 122 IRPVLDFMQTMPAFVYLIPGIFFFGLGVVPGVVATVIFSMPPGVRMTELGIRQVDAELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG  P +   +V+LP A+P I+A + Q IML+LSMVV+  +VG+ GLG  V +A++
Sbjct: 182 AADAFGTHPRRTLLRVQLPLALPTIMAGINQVIMLALSMVVIAGMVGAEGLGSTVFQAIS 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           +VD+  GFE G+ +VILA+ LDR+ S  + R
Sbjct: 242 SVDVAMGFEGGIAVVILAMYLDRMTSALNQR 272


>gi|332974746|gb|EGK11662.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Desmospora sp. 8437]
          Length = 569

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 124/275 (45%), Positives = 175/275 (63%), Gaps = 2/275 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL  ++      L  N      I++ ++   V     VL   PP++   V+++LV + 
Sbjct: 6   KIPLDQWVDRVVDWLQVNLAPLFAIITALIEPMVGFFQSVLTAAPPVITALVLAVLVYLA 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R  +IA+ T +G LLI   GYW  + ET++LVL +T +S+ IG+PLG+L A      S+
Sbjct: 66  SR-FSIALLTFLGCLLIDNLGYWDASVETIALVLTATLLSIVIGLPLGILTARNRSSQSL 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPA+  F LG VPGI+A+I+FS+P ++RLT LGI      L E
Sbjct: 125 ITPVLDFMQTMPAFVYLIPAVFFFALGAVPGIIASIIFSMPPTIRLTSLGIRQVSADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A P I+A + QTIMLSLSMVV+ +++G+ GLG  VL+A+ 
Sbjct: 185 AADAFGSTSTQKLFKVQLPLAKPTIMAGINQTIMLSLSMVVIASMIGAGGLGTVVLQAIT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP-RDRI 281
            +++GRGFE GLCIVI+AI+LDR+       R ++
Sbjct: 245 RLEVGRGFEGGLCIVIIAIVLDRVTQSLGQGRQKV 279


>gi|125539527|gb|EAY85922.1| hypothetical protein OsI_07285 [Oryza sativa Indica Group]
          Length = 541

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +A +P   ++ +    L  +       +   +   ++    +L  +P  + + V 
Sbjct: 239 LDPFHKAWVPFDSWVTQGIDWLVLHFRPLFQGIRVPVDVILSGFQQLLLGMPAPIAILVF 298

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +     +   T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A 
Sbjct: 299 SLVAWQIAGL-GMGAATLLSLVAIGAIGAWSQAMVTLALVLTALFFCILIGLPLGIWLAR 357

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 +IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 358 SKHAAKVIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 417

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 418 VPEDLIEAAESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 477

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 478 MVLRGIGRLDMGLAAIGGVGIVILAIILDRLTQSLGRDRR 517


>gi|253689683|ref|YP_003018873.1| binding-protein-dependent transport systems inner membrane
           component [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|251756261|gb|ACT14337.1| binding-protein-dependent transport systems inner membrane
           component [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 422

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPL  ++      +  +       +   +   ++     L  +P  + + V 
Sbjct: 121 LDPFKDTLIPLDSWVTHGIDWVVLHFRPVFQGVRVPVDFILSGFQQFLLGMPAPIAILVF 180

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   +  S+ + V T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 181 SLLAWQMS-SLGMGVATLLSLIAIGAIGAWSQAMITLALVLTALFFCVLIGLPMGIWLAR 239

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R    IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 240 SERAAKFIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 299

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 300 VPADLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 359

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 360 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 399


>gi|227113615|ref|ZP_03827271.1| glycine betaine transporter membrane protein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 417

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPL  ++      +  +       +   +   ++    +L  +P  + + V 
Sbjct: 116 LDPFKDTLIPLDSWVTHGIDWVVLHFRPVFQGVRVPVDFILSGFQQLLLGMPAPIAILVF 175

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   +  S  + V T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 176 SLLAWQMS-SFGMGVATLLSLIAIGAIGAWSQAMITLALVLTALFFCVLIGLPMGIWLAR 234

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R    IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 235 SERAAKFIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 294

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 295 VPADLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 354

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 355 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 394


>gi|332704984|ref|ZP_08425069.1| ABC-type proline/glycine betaine transport system, permease
           component [Lyngbya majuscula 3L]
 gi|332356161|gb|EGJ35616.1| ABC-type proline/glycine betaine transport system, permease
           component [Lyngbya majuscula 3L]
          Length = 678

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 101/277 (36%), Positives = 167/277 (60%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P     +PL +++      L  N   F   +S  +   +  +  +   +PPL+F+ ++
Sbjct: 27  LNPFELYTLPLDEWITAVVNFLVDNFRPFFQAISLPITWTLEGIQSLFLSIPPLIFLIIL 86

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+V  +     IA+ +   L LI   G W++   TL+LV+ +    + IG+ LG+  A 
Sbjct: 87  ALIVWQIAGG-KIAIYSLFALTLIGFFGAWEQAMTTLALVVTAVVFCVLIGISLGIACAS 145

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R    +R  LD+MQT+P+FVYL+P ++LFG+G VPG++AT+VF++P  +RLT LGI  
Sbjct: 146 SDRVEKFLRPLLDAMQTLPSFVYLVPVVMLFGIGAVPGVIATLVFAVPPLIRLTNLGIRQ 205

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
               + EAA AFG+TP Q+  +V++P A+P I+A + Q I+L+LSM VVT+++G  GLG 
Sbjct: 206 VSTEVVEAAIAFGSTPRQMLWEVQIPLAMPTILAGVNQAILLALSMSVVTSMIGVGGLGQ 265

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            VL+ L  V++G     GL IV++A++LDR+  +   
Sbjct: 266 MVLQGLGRVNVGLAAVGGLSIVLIAVMLDRITQVVSQ 302


>gi|113477530|ref|YP_723591.1| glycine betaine ABC transporter substrate-binding protein
           [Trichodesmium erythraeum IMS101]
 gi|110168578|gb|ABG53118.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Trichodesmium erythraeum IMS101]
          Length = 662

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 107/277 (38%), Positives = 164/277 (59%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P     +PL +++      L  N  +    +S  +   + +V      +PPL+F+ + 
Sbjct: 23  LNPFESYTLPLEEWVNNLVDFLVDNFRFIFQAISLPISGTLRIVELTFLAIPPLIFLIIT 82

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LLV  +     IA+ + + L +I   G W+++  +LSL+L +    M IG+PLG+  A 
Sbjct: 83  GLLVWQLAGR-KIAIYSFISLCIIGFCGAWEQSMVSLSLILTAVIFCMLIGIPLGIACAL 141

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF  I+R  LD MQT+PTFVYL+P ++LFG+G V GI+AT VF++P  +RLT LGI  
Sbjct: 142 SDRFNKILRPLLDGMQTLPTFVYLVPVVMLFGIGEVSGIIATFVFAVPPLIRLTNLGIRQ 201

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P   EAA AFG+T  QV  +V++P A+P I+A   Q I+L+LSM VVT+++G  GLG 
Sbjct: 202 VSPEAVEAALAFGSTRQQVLLEVQIPLALPTILAGTNQAILLALSMSVVTSMIGVEGLGQ 261

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            VL+ L  +++G     GL IV++AI+LDR+      
Sbjct: 262 MVLQGLGRLNVGLAAIGGLGIVLIAIMLDRITQGVSQ 298


>gi|197284311|ref|YP_002150183.1| glycine betaine transporter membrane protein [Proteus mirabilis
           HI4320]
 gi|194681798|emb|CAR41030.1| glycine betaine/L-proline ABC transporter, permease protein
           [Proteus mirabilis HI4320]
          Length = 409

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 109/281 (38%), Positives = 157/281 (55%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  +       +   +   +      L  +P  V + + 
Sbjct: 106 MDPFNHTLIPLDSWVTDGIDWIVLHFRPIFQGIRVPVDLVLGGFENFLTSMPAPVAIILF 165

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +   + + +   + L+LI   G W E   TL+LVL S    + IG+PLG+  A 
Sbjct: 166 SLIAWQLSGKV-MGISAFISLILIGAIGAWSEAMITLALVLTSLLFCLIIGLPLGIWLAH 224

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 225 SDRASKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 284

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 285 VPEDLIEAAQSFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 344

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            VLR +  +D+G     G  IVILAIILDRL        R+
Sbjct: 345 MVLRGIGRLDMGLAAVGGAGIVILAIILDRLTQSLGQNSRL 385


>gi|257867410|ref|ZP_05647063.1| glycine betaine/L-proline ABC transporter [Enterococcus
           casseliflavus EC30]
 gi|257873741|ref|ZP_05653394.1| glycine betaine/L-proline ABC transporter [Enterococcus
           casseliflavus EC10]
 gi|257877492|ref|ZP_05657145.1| glycine betaine/L-proline ABC transporter [Enterococcus
           casseliflavus EC20]
 gi|257801466|gb|EEV30396.1| glycine betaine/L-proline ABC transporter [Enterococcus
           casseliflavus EC30]
 gi|257807905|gb|EEV36727.1| glycine betaine/L-proline ABC transporter [Enterococcus
           casseliflavus EC10]
 gi|257811658|gb|EEV40478.1| glycine betaine/L-proline ABC transporter [Enterococcus
           casseliflavus EC20]
          Length = 574

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 112/278 (40%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +Q  IP+ D+++ F   LT       + L       ++ +  VL ++PPL+ + ++
Sbjct: 1   MDNFLQHTIPVADWVENFTDWLTGTFSGLFSALQSFGQFIMDAITNVLLFVPPLLMIVLL 60

Query: 61  SLLVLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +     V R    +   T +GLL I  QG W +   T++LVL+S+ +S+ IG+PLG+L A
Sbjct: 61  TAAAFFVSRKKFGLPAFTFVGLLFIYNQGLWTDLMNTVTLVLLSSLVSIIIGIPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SI+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSEKAQSIVTPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EA+ +FG T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG
Sbjct: 181 QISRELVEASDSFGGTGWQKLIKLELPLAKSTILAGVNQTTMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF SG+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVSGVSLVILAIIMDRFTQNLNR 278


>gi|227358548|ref|ZP_03842873.1| glycine betaine/L-proline ABC superfamily ATP binding cassette
           transporter, permease protein [Proteus mirabilis ATCC
           29906]
 gi|227161259|gb|EEI46333.1| glycine betaine/L-proline ABC superfamily ATP binding cassette
           transporter, permease protein [Proteus mirabilis ATCC
           29906]
          Length = 409

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 109/281 (38%), Positives = 157/281 (55%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  +       +   +   +      L  +P  V + + 
Sbjct: 106 MDPFNHTLIPLDSWVTDGIDWIVLHFRPIFQGIRVPVDLVLGGFENFLTSMPAPVAIILF 165

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +   + + +   + L+LI   G W E   TL+LVL S    + IG+PLG+  A 
Sbjct: 166 SLIAWQLSGKV-MGISAFISLILIGAIGAWSEAMITLALVLTSLLFCLIIGLPLGIWLAH 224

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 225 SDRASKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 284

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 285 VPEDLIEAAQSFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 344

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            VLR +  +D+G     G  IVILAIILDRL        R+
Sbjct: 345 MVLRGIGRLDMGLAAVGGAGIVILAIILDRLTQSLGQNSRL 385


>gi|261822715|ref|YP_003260821.1| glycine/betaine ABC transporter [Pectobacterium wasabiae WPP163]
 gi|261606728|gb|ACX89214.1| binding-protein-dependent transport systems inner membrane
           component [Pectobacterium wasabiae WPP163]
          Length = 400

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPL  ++      +  +       +   +   +      L  +P  + + V 
Sbjct: 99  LDPFKDTLIPLDSWVTHGIDWVVLHFRPIFQGIRVPVDFILGGFQQFLLGMPAPIAILVF 158

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +  S+ + V T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 159 SLIAWQMS-SLGMGVATLLSLIAIGAIGAWSQAMITLALVLTALFFCVLIGLPMGIWLAR 217

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 218 SERAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 277

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 278 VPADLVEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 337

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 338 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 377


>gi|325568907|ref|ZP_08145200.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Enterococcus
           casseliflavus ATCC 12755]
 gi|325157945|gb|EGC70101.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Enterococcus
           casseliflavus ATCC 12755]
          Length = 574

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 112/278 (40%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +Q  IP+ D+++ F   LT       + L       ++ +  VL ++PPL+ + ++
Sbjct: 1   MDNFLQHTIPVADWVENFTDWLTGTFSGLFSALQSFGQFIMDAITNVLLFVPPLLMIVLL 60

Query: 61  SLLVLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +     V R    +   T +GLL I  QG W +   T++LVL+S+ +S+ IG+PLG+L A
Sbjct: 61  TAAAFFVSRKKFGLPAFTFVGLLFIYNQGLWTDLMNTVTLVLLSSLVSIIIGIPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SI+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSEKAQSIVTPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EA+ +FG T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG
Sbjct: 181 QISRELVEASDSFGGTGWQKLIKLELPLAKSTILAGVNQTTMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF SG+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVSGVSLVILAIIMDRFTQNLNR 278


>gi|24379499|ref|NP_721454.1| putative ABC transporter, proline/glycine betaine permease protein
           [Streptococcus mutans UA159]
 gi|290580500|ref|YP_003484892.1| putative proline/glycine betaine ABC transporter permease
           [Streptococcus mutans NN2025]
 gi|24377438|gb|AAN58760.1|AE014944_10 putative ABC transporter, proline/glycine betaine permease protein
           [Streptococcus mutans UA159]
 gi|254997399|dbj|BAH88000.1| putative ABC transporter, proline/glycine betaine permease protein
           [Streptococcus mutans NN2025]
          Length = 576

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 117/281 (41%), Positives = 171/281 (60%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I+Q  +P+ D++++    LT       N++  +    ++ +   L ++ PL+ + +V
Sbjct: 1   MNLILQGKLPVADWIEDLTNWLTHTFSGLFNLIQSVGNFIMDGITNTLLFVNPLLLIVLV 60

Query: 61  SLLVLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +L    + R   T+   T +GLL I  Q  W +   T +LVLVS+FIS+ IG+PLG+  A
Sbjct: 61  TLAAFFLARKKWTLPTFTLLGLLFIYNQSLWDDLVNTFTLVLVSSFISIVIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  II   LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR T L I 
Sbjct: 121 KNNTVKQIINPILDFMQTMPAFVYLIPAVAFFGIGIVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EAA AFG+T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG
Sbjct: 181 EIPTELIEAADAFGSTSRQKLFKVELPLAKNTIMAGINQTIMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
             VL AL   DIG GF +GL +VILAI++DR     + R +
Sbjct: 241 RGVLSALQHADIGSGFVNGLALVILAIVIDRFSQTANQRTK 281


>gi|50122424|ref|YP_051591.1| glycine betaine transporter membrane protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49612950|emb|CAG76401.1| glycine betaine/L-proline transport system permease protein
           [Pectobacterium atrosepticum SCRI1043]
          Length = 393

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPL  ++      +  +       +   +   +      L  +P  + + V 
Sbjct: 92  LDPFKDTLIPLDSWVTHGIDWVVLHFRPIFQGIRVPVDFILGGFQQFLLGMPAPIAILVF 151

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +  S+ + V T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 152 SLIAWQMS-SLGMGVATLLSLIAIGAIGAWSQAMITLALVLTALFFCVLIGLPMGIWLAR 210

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R    IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 211 SERAAKFIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 270

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 271 VPADLVEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 330

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 331 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 370


>gi|271501794|ref|YP_003334820.1| binding-protein-dependent transporter inner membrane component
           [Dickeya dadantii Ech586]
 gi|270345349|gb|ACZ78114.1| binding-protein-dependent transport systems inner membrane
           component [Dickeya dadantii Ech586]
          Length = 400

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P   A IPL  ++ E    L  +       +   +   +     +L  +P  + + V 
Sbjct: 97  MDPFQHAWIPLDRWVTEGIDWLVLHFRPLFQGIRVPVDVILTGFQQLLTSVPAPIAILVF 156

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   +  S  + V T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A 
Sbjct: 157 SLLAWQIA-SFGMGVATLLSLIAIGAIGAWSQAMVTLALVLTALFFCIIIGLPLGIWLAN 215

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 216 SNRAVRIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTLLGIRQ 275

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 276 VPADLVEAAQSFGASPRQMLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 335

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 336 MVLRGIGRLDMGLASIGGVGIVILAIILDRLTQSLGQDAR 375


>gi|76788447|ref|YP_330414.1| glycine betaine/proline ABC transporter permease/substrate-binding
           protein [Streptococcus agalactiae A909]
 gi|77406685|ref|ZP_00783726.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae H36B]
 gi|77412028|ref|ZP_00788356.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae CJB111]
 gi|76563504|gb|ABA46088.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptococcus agalactiae A909]
 gi|77161934|gb|EAO72917.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae CJB111]
 gi|77174704|gb|EAO77532.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae H36B]
          Length = 575

 Score =  181 bits (459), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 110/279 (39%), Positives = 171/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+  +++     +T+      + +  I    ++ +   L ++ PL+F+ ++
Sbjct: 1   MENLLQHKLPVAPFVESATNWITKTFSGLFDFIQTIGNALMDWMTKTLLFINPLLFIVLI 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
            + +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IGVPLG+  A
Sbjct: 61  TAAVFFLAKKKWQLPTFTFIGLLFIYNQGLWEQLINTFNLVLVASLISIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A++VF++P +VR T L I 
Sbjct: 121 KSDKVKQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVVFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EIPLELIEASDSFGSTAKQKLFKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+    + +
Sbjct: 241 REVLSALQHADIGTGFVSGLSLVILAIVLDRVSQFFNSK 279


>gi|83644216|ref|YP_432651.1| glycine betaine transporter membrane protein [Hahella chejuensis
           KCTC 2396]
 gi|83632259|gb|ABC28226.1| ABC-type proline/glycine betaine transport system, permease
           component [Hahella chejuensis KCTC 2396]
          Length = 369

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P   A IPL  ++++    +  +       + + +   ++ +   LQ +P  + +   
Sbjct: 64  LNPFQDAVIPLDSWVEQGLDWVVNHFRPVFQAVRWPIDITLSSIEAGLQAIPATIVILFF 123

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +     +AVG+ + L L+   G W E   TL+LVL S    + IG+P G+  A 
Sbjct: 124 ALLAWQLSGR-KLAVGSLISLTLVGLIGAWNEAMVTLALVLTSVLFCLLIGLPTGIWLAR 182

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  S +R  LD+MQT P FVYL+P ++LFG+G VPG+  TI+F++P  +RLT LGI  
Sbjct: 183 SDRAASAVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVAVTIIFALPPLIRLTSLGIRQ 242

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 243 VPEDLVEAARSFGASPRQLLFKVQLPLATPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 302

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IV+LAI+LDR+        R
Sbjct: 303 MVLRGIGRLDMGLATVGGVGIVLLAIMLDRMTQALGKDAR 342


>gi|227329900|ref|ZP_03833924.1| glycine betaine transporter membrane protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 415

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPL  ++      +  +       +   +   +      L  +P  + + V 
Sbjct: 114 LDPFKDTLIPLDSWVTHGIDWVVLHFRPIFQGVRVPVDFILGGFQQFLLGMPAPIAILVF 173

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +  S+ + V T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 174 SLIAWQMS-SLGMGVATLLSLIAIGAIGAWSQAMITLALVLTALFFCVLIGLPVGIWLAR 232

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R    IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 233 SERAAKFIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 292

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 293 VPADLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 352

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 353 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 392


>gi|69245959|ref|ZP_00603731.1| Binding-protein-dependent transport systems inner membrane
           component:Substrate-binding region of ABC-type glycine
           betaine transport system [Enterococcus faecium DO]
 gi|293563167|ref|ZP_06677625.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium E1162]
 gi|294623125|ref|ZP_06702011.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           U0317]
 gi|314939370|ref|ZP_07846611.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium
           TX0133a04]
 gi|314941573|ref|ZP_07848458.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0133C]
 gi|314949600|ref|ZP_07852924.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0082]
 gi|314953707|ref|ZP_07856582.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0133A]
 gi|314992163|ref|ZP_07857607.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0133B]
 gi|314997654|ref|ZP_07862584.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium
           TX0133a01]
 gi|68195489|gb|EAN09933.1| Binding-protein-dependent transport systems inner membrane
           component:Substrate-binding region of ABC-type glycine
           betaine transport system [Enterococcus faecium DO]
 gi|281335146|gb|ADA62230.1| Glycine betaine ABC transport system, permease protein OpuAB /
           Glycine betaine ABC transport system, glycine
           betaine-binding protein OpuAC [Enterococcus faecium]
 gi|291597494|gb|EFF28659.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           U0317]
 gi|291604858|gb|EFF34334.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium E1162]
 gi|313588289|gb|EFR67134.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium
           TX0133a01]
 gi|313593266|gb|EFR72111.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0133B]
 gi|313594291|gb|EFR73136.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0133A]
 gi|313599632|gb|EFR78475.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0133C]
 gi|313641355|gb|EFS05935.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium
           TX0133a04]
 gi|313644024|gb|EFS08604.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecium TX0082]
          Length = 575

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TVAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|289567008|ref|ZP_06447409.1| ABC transporter, glycine-betaine/proline permease [Enterococcus
           faecium D344SRF]
 gi|294615264|ref|ZP_06695141.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           E1636]
 gi|294617327|ref|ZP_06696966.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           E1679]
 gi|289161209|gb|EFD09108.1| ABC transporter, glycine-betaine/proline permease [Enterococcus
           faecium D344SRF]
 gi|291591861|gb|EFF23493.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           E1636]
 gi|291596400|gb|EFF27654.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           E1679]
          Length = 575

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TVAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|293553996|ref|ZP_06674598.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           E1039]
 gi|291601853|gb|EFF32103.1| glycine betaine/L-proline ABC transporter,
           substrate-binding/permease protein [Enterococcus faecium
           E1039]
          Length = 574

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TIAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|251788501|ref|YP_003003222.1| glycine betaine transporter membrane protein [Dickeya zeae Ech1591]
 gi|247537122|gb|ACT05743.1| binding-protein-dependent transport systems inner membrane
           component [Dickeya zeae Ech1591]
          Length = 400

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ E    L  +       +   +   +     +L  LP  V +   
Sbjct: 97  MDPFRHTLVPLDRWVTEAIDWLVLHFRPLFQGIRVPVDVILTGFQQLLTSLPAPVAILAF 156

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   V  S  + V T + L++I   G W +   TL+LVL + F  + +G+PLG+  A 
Sbjct: 157 SLLAWQVS-SFGMGVATLLSLVIIGAIGAWSQAMVTLALVLTALFFCIILGLPLGIWLAH 215

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 216 SDRAARVVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIRQ 275

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 276 VPADLVEAAQSFGASPRQMLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 335

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 336 MVLRGIGRLDMGLASVGGVSIVILAIILDRLTQSLGRDAR 375


>gi|227552551|ref|ZP_03982600.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecium TX1330]
 gi|257896894|ref|ZP_05676547.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           Com12]
 gi|293378476|ref|ZP_06624639.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecium PC4.1]
 gi|227178300|gb|EEI59272.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecium TX1330]
 gi|257833459|gb|EEV59880.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           Com12]
 gi|292642805|gb|EFF60952.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecium PC4.1]
          Length = 574

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 168/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    +  +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMTGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TIAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|258614687|ref|ZP_05712457.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium DO]
          Length = 560

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TVAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|293570838|ref|ZP_06681885.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium E980]
 gi|291609106|gb|EFF38381.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium E980]
          Length = 575

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TIAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|293568393|ref|ZP_06679714.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium E1071]
 gi|291588914|gb|EFF20741.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecium E1071]
          Length = 575

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TVAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|257888218|ref|ZP_05667871.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,141,733]
 gi|257824272|gb|EEV51204.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,141,733]
          Length = 575

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 168/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    +  +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMTGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TIAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|257870168|ref|ZP_05649821.1| glycine betaine/L-proline ABC transporter [Enterococcus gallinarum
           EG2]
 gi|257804332|gb|EEV33154.1| glycine betaine/L-proline ABC transporter [Enterococcus gallinarum
           EG2]
          Length = 575

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 110/278 (39%), Positives = 168/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +Q  IP+ D+++ F   LT       + L       ++ +   L ++PPL  + ++
Sbjct: 1   MGNFLQQTIPVADWVESFTDWLTGTFSGLFSALQSFGQFVMDGMTNTLLFVPPLFMILLL 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    V  +   +   T +GLL I  QG W +   T++LVL+S+ +S+ IG+PLG+L A
Sbjct: 61  TIAAFFVSSKKWGLTAFTFVGLLFIYNQGLWTDLMNTVTLVLLSSLVSIIIGIPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +  SI+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSEKAQSIVTPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EA+ +FG T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG
Sbjct: 181 QISRELVEASDSFGGTGWQKLVKLELPLAKSTILAGVNQTTMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF SG+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVSGVSLVILAIIMDRFTQNLNK 278


>gi|319745717|gb|EFV98014.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Streptococcus agalactiae ATCC 13813]
          Length = 575

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 171/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+  +++     +T+      + +  I    ++ +   L ++ PL+F+ ++
Sbjct: 1   MENLLQHKLPVAPFVESTTNWITKTFSGLFDFIQTIGNALMDWMTKTLLFINPLLFIVLI 60

Query: 61  SLLVLM-VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++ V    K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IGVPLG+  A
Sbjct: 61  TIAVFFLAKKKWQLPTFTFIGLLFIYNQGLWEQLINTFNLVLVASLISIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A++VF++P +VR T L I 
Sbjct: 121 KSDKVKQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVVFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EIPLELIEASDSFGSTAKQKLFKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+    + +
Sbjct: 241 REVLSALQHADIGTGFVSGLSLVILAIVLDRVSQFFNSK 279


>gi|257899649|ref|ZP_05679302.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           Com15]
 gi|257837561|gb|EEV62635.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           Com15]
          Length = 575

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 106/278 (38%), Positives = 168/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ ++   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++
Sbjct: 1   MNNLLNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLL 60

Query: 61  SLLVLMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A
Sbjct: 61  TIAAFFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   II+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSKAQIIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG
Sbjct: 181 QVPKELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 RGVLSALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 278


>gi|77409771|ref|ZP_00786425.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae COH1]
 gi|77171620|gb|EAO74835.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae COH1]
          Length = 575

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 171/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+  +++     +T+      + +  I    ++ +   L ++ PL+F+ ++
Sbjct: 1   MENLLQHKLPVAPFVESTTNWITKTFSGLFDFIQTIGNALMDWMTKTLLFINPLLFIVLI 60

Query: 61  SLLVLM-VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++ V    K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IGVPLG+  A
Sbjct: 61  TIAVFFLAKKKWQLPTFTFIGLLFIYNQGLWEQLINTFNLVLVASLISIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A++VF++P +VR T L I 
Sbjct: 121 KSDKVKQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVVFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EIPLELIEASDSFGSTAKQKLFKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+    + +
Sbjct: 241 REVLSALQHADIGTGFVSGLSLVILAIVLDRVSQFFNSK 279


>gi|22537935|ref|NP_688786.1| amino acid ABC transporter permease [Streptococcus agalactiae
           2603V/R]
 gi|76798898|ref|ZP_00781104.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae 18RS21]
 gi|22534834|gb|AAN00659.1|AE014273_6 amino acid ABC transporter, permease protein [Streptococcus
           agalactiae 2603V/R]
 gi|76585744|gb|EAO62296.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae 18RS21]
          Length = 575

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 171/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+  +++     +T+      + +  I    ++ +   L ++ PL+F+ ++
Sbjct: 1   MENLLQHKLPVAPFVESTTNWITKTFSGLFDFIQTIGNALMDWMTKTLLFINPLLFIVLI 60

Query: 61  SLLVLM-VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++ V    K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IGVPLG+  A
Sbjct: 61  TIAVFFLAKKKWQLPTFTFIGLLFIYNQGLWEQLINTFNLVLVASLISIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A++VF++P +VR T L I 
Sbjct: 121 KSDKVKQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVVFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EIPLELIEASDSFGSTVKQKLFKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+    + +
Sbjct: 241 REVLSALQHADIGTGFVSGLSLVILAIVLDRVSQFFNSK 279


>gi|307132314|ref|YP_003884330.1| glycine betaine ABC transporter membrane protein [Dickeya dadantii
           3937]
 gi|306529843|gb|ADM99773.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Dickeya dadantii 3937]
          Length = 406

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 115/280 (41%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ E    L  +       +   +   +     +L  LP  V + V 
Sbjct: 103 MDPFRHTLVPLDRWVTEGIDWLVLHFRPLFQGIRVPVDMILTSFQQLLTGLPAPVAILVF 162

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   V  S  + V T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A 
Sbjct: 163 SLLAWQVS-SFGMGVATLLSLVAIGAIGAWSQAMVTLALVLTALFFCVIIGLPLGIWLAH 221

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYLIP ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 222 SDRAARIVRPLLDAMQTTPAFVYLIPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 281

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 282 VPADLVEAAQSFGASPRQMLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 341

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 342 MVLRGIGRLDMGLASIGGVGIVILAIILDRLTQSLGRDAR 381


>gi|28898501|ref|NP_798106.1| glycine betaine/L-proline transport system permease [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153836267|ref|ZP_01988934.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus AQ3810]
 gi|260365056|ref|ZP_05777627.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus K5030]
 gi|260879548|ref|ZP_05891903.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus AN-5034]
 gi|260894977|ref|ZP_05903473.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus Peru-466]
 gi|260901013|ref|ZP_05909408.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus AQ4037]
 gi|28806719|dbj|BAC59990.1| glycine betaine/L-proline transport system permease [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149750542|gb|EDM61287.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus AQ3810]
 gi|308086053|gb|EFO35748.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus Peru-466]
 gi|308093320|gb|EFO43015.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus AN-5034]
 gi|308110813|gb|EFO48353.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus AQ4037]
 gi|308111687|gb|EFO49227.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio parahaemolyticus K5030]
          Length = 361

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 103/276 (37%), Positives = 157/276 (56%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+P   A +PL ++++     L ++G      +   +   ++     L   P  + V ++
Sbjct: 48  MNPFQDAVLPLDNWVESGLNWLVEHGRPVFQAIRVPIDFILSSFETALVSTPSPIMVLIL 107

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      +  + + T + L+ I   G W +   TL+LVL S F  + IG+P+G+  A 
Sbjct: 108 FLLAWQFS-NFKLGLSTLVSLVFIGLIGAWSQAMTTLALVLTSVFFCLLIGLPMGIWLAR 166

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 167 SQTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 226

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 227 VPEELIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 286

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+     
Sbjct: 287 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQELG 322


>gi|328468887|gb|EGF39847.1| glycine betaine/L-proline transport system permease [Vibrio
           parahaemolyticus 10329]
          Length = 361

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 103/276 (37%), Positives = 157/276 (56%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+P   A +PL ++++     L ++G      +   +   ++     L   P  + V ++
Sbjct: 48  MNPFQDAVLPLDNWVESGLNWLVEHGRPVFQAIRVPIDFILSSFETTLVSTPSPIMVLIL 107

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      +  + + T + L+ I   G W +   TL+LVL S F  + IG+P+G+  A 
Sbjct: 108 FLLAWQFS-NFKLGLSTLVSLVFIGLIGAWSQAMTTLALVLTSVFFCLLIGLPMGIWLAR 166

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 167 SQTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 226

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 227 VPEELIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 286

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+     
Sbjct: 287 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQELG 322


>gi|269966457|ref|ZP_06180541.1| glycine betaine/L-proline transport system permease [Vibrio
           alginolyticus 40B]
 gi|269828914|gb|EEZ83164.1| glycine betaine/L-proline transport system permease [Vibrio
           alginolyticus 40B]
          Length = 361

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 102/276 (36%), Positives = 156/276 (56%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+P   A +PL  +++     L ++G      +   +   +      L   P  + V ++
Sbjct: 48  MNPFQDAVLPLDSWVESGLNWLVEHGRPVFQAIRVPIDFILTSFETALVSTPAPIMVLIL 107

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      ++ +   T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 108 FLLAWQFS-NVKLGFSTLVSLVFIGLIGAWSQAMTTLALVLTAVFFCLLIGLPMGIWLAR 166

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 167 SQTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 226

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 227 VPEELIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 286

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 287 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 322


>gi|242238345|ref|YP_002986526.1| glycine betaine transporter membrane protein [Dickeya dadantii
           Ech703]
 gi|242130402|gb|ACS84704.1| binding-protein-dependent transport systems inner membrane
           component [Dickeya dadantii Ech703]
          Length = 392

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     +PL  ++ +    L  +       +   +   +N    +L  +P  V + + 
Sbjct: 91  LDPFHHTLVPLDRWVTDGIDWLVLHFRPLFQGIRMPVDMILNAFQQLLTGMPAPVAILLF 150

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   +  S  + V T + L++I   G W +   TLSLVL + F  + IG+PLGV  + 
Sbjct: 151 SLLAWQIA-SAGMGVATLLALIVIGAIGAWSQAMITLSLVLTALFFCLIIGLPLGVWLSH 209

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 210 SQRAARVVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIRQ 269

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 270 VPADLVEAAESFGASPRQMLFKVKLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 329

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IV+LAIILDR+        R
Sbjct: 330 MVLRGIGRLDMGLASIGGVGIVVLAIILDRITQSLGRDAR 369


>gi|91223853|ref|ZP_01259117.1| glycine betaine/L-proline transport system permease [Vibrio
           alginolyticus 12G01]
 gi|91191345|gb|EAS77610.1| glycine betaine/L-proline transport system permease [Vibrio
           alginolyticus 12G01]
          Length = 361

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 102/276 (36%), Positives = 156/276 (56%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+P   A +PL  +++     L ++G      +   +   +      L   P  + V ++
Sbjct: 48  MNPFQDAVLPLDSWVESGLNWLVEHGRPVFQAIRVPIDFILTSFETALVSTPAPIMVLIL 107

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      ++ +   T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 108 FLLAWQFS-NVKLGFSTLVSLVFIGLIGAWSQAMTTLALVLTAVFFCLLIGLPMGIWLAR 166

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 167 SQTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 226

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 227 VPEELIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 286

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 287 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 322


>gi|268590427|ref|ZP_06124648.1| glycine betaine/L-proline transport system permease protein ProW
           [Providencia rettgeri DSM 1131]
 gi|291314341|gb|EFE54794.1| glycine betaine/L-proline transport system permease protein ProW
           [Providencia rettgeri DSM 1131]
          Length = 391

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 156/280 (55%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++      +  N       +   +   ++     L  LP  V + + 
Sbjct: 88  MDPFQHTLIPLDSWVTHAIDWVVLNFRPVFQGIRAPIDFILSGFEQFLTSLPAPVAIIIF 147

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +     + V T + ++ I   G W E   TLSLVL S    + IG+PLG+  A 
Sbjct: 148 ALLTWQLAGRA-MGVATFISMIAIGAIGAWSEAMVTLSLVLTSLLFCIVIGLPLGIWLAR 206

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 207 SDRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIKQ 266

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 267 VPADLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 326

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDR         R
Sbjct: 327 MVLRGIGRLDMGLASVGGVGIVILAIILDRFTQSLGQDTR 366


>gi|254228316|ref|ZP_04921743.1| ABC transporter, permease protein [Vibrio sp. Ex25]
 gi|262394381|ref|YP_003286235.1| L-proline glycine betaine ABC transport system permease proW
           [Vibrio sp. Ex25]
 gi|151939122|gb|EDN57953.1| ABC transporter, permease protein [Vibrio sp. Ex25]
 gi|262337975|gb|ACY51770.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio sp. Ex25]
          Length = 363

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 102/276 (36%), Positives = 156/276 (56%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+P   A +PL  +++     L ++G      +   +   +      L   P  + V ++
Sbjct: 50  MNPFQDAVLPLDSWVESGLNWLVEHGRPVFQAIRVPIDFILTSFETALVSTPAPIMVLIL 109

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      ++ +   T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 110 FLLAWQFS-NVKLGFSTLVSLVFIGLIGAWSQAMTTLALVLTAVFFCLLIGLPMGIWLAR 168

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 169 SQTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 228

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 229 VPEELIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 288

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 289 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 324


>gi|33321797|gb|AAQ06631.1| osmoprotectant transport protein OusBW [Erwinia chrysanthemi]
          Length = 406

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ E    L  +       +   +   +     +L  LP  V + V 
Sbjct: 103 MDPFRHTLVPLDRWVTEGIDWLVLHFRPLFQGIRVPVDMILTSFQQLLTGLPAPVAILVF 162

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   V  S  + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 163 SLLAWQVS-SFGMGVATLLSLVAIGAIGAWSQAMVTLALVLTALSFCVIIGLPLGIWLAH 221

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYLIP ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 222 SDRAARIVRPLLDAMQTTPAFVYLIPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQ 281

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 282 VPADLVEAAQSFGASPRQMLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 341

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 342 MVLRGIGRLDMGLASIGGVGIVILAIILDRLTQSLGRDAR 381


>gi|22125122|ref|NP_668545.1| glycine betaine transporter membrane protein [Yersinia pestis KIM
           10]
 gi|45442233|ref|NP_993772.1| glycine betaine transporter membrane protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51597275|ref|YP_071466.1| glycine betaine transporter membrane protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808368|ref|YP_652284.1| glycine betaine transporter membrane protein [Yersinia pestis
           Antiqua]
 gi|108811295|ref|YP_647062.1| glycine betaine transporter membrane protein [Yersinia pestis
           Nepal516]
 gi|149365459|ref|ZP_01887494.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis CA88-4125]
 gi|153949330|ref|YP_001400041.1| glycine betaine transporter membrane protein [Yersinia
           pseudotuberculosis IP 31758]
 gi|165925220|ref|ZP_02221052.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939926|ref|ZP_02228464.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166008318|ref|ZP_02229216.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212363|ref|ZP_02238398.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167398795|ref|ZP_02304319.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167421456|ref|ZP_02313209.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423494|ref|ZP_02315247.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167468718|ref|ZP_02333422.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis FV-1]
 gi|170023360|ref|YP_001719865.1| glycine betaine transporter membrane protein [Yersinia
           pseudotuberculosis YPIII]
 gi|186896379|ref|YP_001873491.1| glycine betaine transporter membrane protein [Yersinia
           pseudotuberculosis PB1/+]
 gi|218929723|ref|YP_002347598.1| glycine betaine transporter membrane protein [Yersinia pestis CO92]
 gi|229838199|ref|ZP_04458358.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229895455|ref|ZP_04510627.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis Pestoides A]
 gi|229898689|ref|ZP_04513834.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229901540|ref|ZP_04516662.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis Nepal516]
 gi|270489727|ref|ZP_06206801.1| ABC transporter, permease protein [Yersinia pestis KIM D27]
 gi|294504445|ref|YP_003568507.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis Z176003]
 gi|21957980|gb|AAM84796.1|AE013725_9 permease of high-affinity ABC transport system for glycine betaine
           and proline [Yersinia pestis KIM 10]
 gi|45437097|gb|AAS62649.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis biovar Microtus str. 91001]
 gi|51590557|emb|CAH22198.1| ABC glycine/betaine/L-proline transporter, permease subunit proW
           [Yersinia pseudotuberculosis IP 32953]
 gi|108774943|gb|ABG17462.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis Nepal516]
 gi|108780281|gb|ABG14339.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis Antiqua]
 gi|115348334|emb|CAL21267.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis CO92]
 gi|149291872|gb|EDM41946.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis CA88-4125]
 gi|152960825|gb|ABS48286.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pseudotuberculosis IP 31758]
 gi|165912145|gb|EDR30784.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165922827|gb|EDR39978.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165992700|gb|EDR45001.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206294|gb|EDR50774.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166960945|gb|EDR56966.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167051299|gb|EDR62707.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167057664|gb|EDR67410.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169749894|gb|ACA67412.1| binding-protein-dependent transport systems inner membrane
           component [Yersinia pseudotuberculosis YPIII]
 gi|186699405|gb|ACC90034.1| binding-protein-dependent transport systems inner membrane
           component [Yersinia pseudotuberculosis PB1/+]
 gi|229681469|gb|EEO77563.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis Nepal516]
 gi|229688237|gb|EEO80308.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229694565|gb|EEO84612.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229701610|gb|EEO89637.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis Pestoides A]
 gi|262362564|gb|ACY59285.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis D106004]
 gi|262366431|gb|ACY62988.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis D182038]
 gi|270338231|gb|EFA49008.1| ABC transporter, permease protein [Yersinia pestis KIM D27]
 gi|294354904|gb|ADE65245.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis Z176003]
 gi|320016145|gb|ADV99716.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 388

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 86  MDPFQNTWIPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQTLLLGMPAPVAILVF 145

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++++   T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 146 ALIAWQFS-TLSMGAATLISLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 204

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 205 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 264

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 265 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 324

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 325 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 364


>gi|162419458|ref|YP_001607863.1| glycine betaine transporter membrane protein [Yersinia pestis
           Angola]
 gi|162352273|gb|ABX86221.1| glycine betaine/L-proline ABC transporter, permease protein
           [Yersinia pestis Angola]
          Length = 388

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 86  MDPFQNTWIPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQALLLGMPAPVAILVF 145

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++++   T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 146 ALIAWQFS-TLSMGAATLISLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 204

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 205 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 264

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 265 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 324

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 325 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 364


>gi|183598093|ref|ZP_02959586.1| hypothetical protein PROSTU_01456 [Providencia stuartii ATCC 25827]
 gi|188020250|gb|EDU58290.1| hypothetical protein PROSTU_01456 [Providencia stuartii ATCC 25827]
          Length = 392

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  +       +   +   ++    +L  LP  + + + 
Sbjct: 89  MDPFQHTLIPLDSWVTQAIDWIVLHFRPVFQGIRIPIDFILSGFEQLLTSLPSPIAIILF 148

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + + T + +++I   G W E   TLSLVL S    + IG+PLG+  A 
Sbjct: 149 ALIAWQLAGRV-MGIATFVSMIVIGAIGAWSEAMVTLSLVLTSLLFCLIIGLPLGIWLAR 207

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             +  SI+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 208 SDKAASIVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIKQ 267

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 268 VPADLIEAAESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 327

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAI+LDRL        R
Sbjct: 328 MVLRGIGRLDMGLASVGGVGIVILAIVLDRLTQSLGKNSR 367


>gi|25011877|ref|NP_736272.1| hypothetical protein gbs1838 [Streptococcus agalactiae NEM316]
 gi|77413910|ref|ZP_00790086.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae 515]
 gi|24413418|emb|CAD47497.1| Unknown [Streptococcus agalactiae NEM316]
 gi|77160043|gb|EAO71178.1| amino acid ABC transporter, permease protein [Streptococcus
           agalactiae 515]
          Length = 575

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 110/279 (39%), Positives = 170/279 (60%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+  +++     +T+      + +  I    ++ +   L ++ PL+F+ ++
Sbjct: 1   MENLLQHKLPVAPFVESTTNWITKTFSGLFDFIQTIGNALMDWMTKTLLFINPLLFIVLI 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
              +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IGVPLG+  A
Sbjct: 61  TVAVFFLAKKKWQLPTFTFIGLLFIYNQGLWEQLINTFNLVLVASLISIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A++VF++P +VR T L I 
Sbjct: 121 KSDKVKQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVVFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EIPLELIEASDSFGSTAKQKLFKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+    + +
Sbjct: 241 REVLSALQHADIGTGFVSGLSLVILAIVLDRVSQFFNSK 279


>gi|145598908|ref|YP_001162984.1| glycine betaine transporter membrane protein [Yersinia pestis
           Pestoides F]
 gi|145210604|gb|ABP40011.1| glycine betaine/L-proline transport system permease [Yersinia
           pestis Pestoides F]
          Length = 384

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 82  MDPFQNTWIPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQTLLLGMPAPVAILVF 141

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++++   T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 142 ALIAWQFS-TLSMGAATLISLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 200

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 201 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 260

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 261 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 320

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 321 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 360


>gi|300718020|ref|YP_003742823.1| glycine betaine/L-proline transport system permease [Erwinia
           billingiae Eb661]
 gi|299063856|emb|CAX60976.1| glycine betaine/L-proline transport system permease protein
           [Erwinia billingiae Eb661]
          Length = 412

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + + 
Sbjct: 112 LDPFHKTLIPLDSWVTTGIDWIVSHFRPVFQGIRVPVDYILSAFQQLLLGMPAPVAIVIF 171

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+ + + T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 172 ALIAWQMS-SLGMGIATLVSLIAIGAIGAWSQAMVTLALVLTALLFCILIGLPLGIWLAR 230

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 231 SDRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 290

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 291 VPADLIEAGESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 350

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 351 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSVGRDSR 390


>gi|310764905|gb|ADP09855.1| glycine betaine transporter membrane protein [Erwinia sp. Ejp617]
          Length = 387

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++      +  +       +   +   +N    +L  +P  V + V 
Sbjct: 87  LDPFHKTLIPLDSWVTTAIDWIVSHFRPLFQGIRLPVDYILNAFQQLLLGMPAPVAIIVF 146

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S ++ V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 147 ALIAWQLS-SFSMGVATLVSLVAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 205

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 206 SQRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 265

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 266 VPADLVEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 325

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 326 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSVGKDKR 365


>gi|229544994|ref|ZP_04433719.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecalis TX1322]
 gi|229309886|gb|EEN75873.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecalis TX1322]
          Length = 569

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|291618547|ref|YP_003521289.1| ProW [Pantoea ananatis LMG 20103]
 gi|291153577|gb|ADD78161.1| ProW [Pantoea ananatis LMG 20103]
          Length = 388

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   ++    +L  +P  V + + 
Sbjct: 87  MDPFHKTWIPLDHWVTEGIDWVVNHFRPVFQSIRVPVDYILSAFQQLLLGMPAPVAIALF 146

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S  + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 147 ALIAWQIA-SPAMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCIIIGLPMGIWLAR 205

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 206 SERAARIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 265

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 266 VPADLIEASESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 325

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 326 MVLRGIGRLDMGLASVGGVGIVILAIILDRLTQSVARDKR 365


>gi|123441275|ref|YP_001005262.1| glycine betaine transporter membrane protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122088236|emb|CAL11025.1| glycine betaine/L-proline transport system permease [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 393

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 91  MDPFHNTWVPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 150

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 151 ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 209

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 210 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 269

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 270 VPADLIEAAESFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 329

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 330 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 369


>gi|315149978|gb|EFT93994.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0012]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|315148611|gb|EFT92627.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX4244]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|29377126|ref|NP_816280.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecalis V583]
 gi|227554134|ref|ZP_03984181.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter protein [Enterococcus faecalis
           HH22]
 gi|229549238|ref|ZP_04437963.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecalis ATCC 29200]
 gi|255971952|ref|ZP_05422538.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           T1]
 gi|255975006|ref|ZP_05425592.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           T2]
 gi|256616850|ref|ZP_05473696.1| OpuABC [Enterococcus faecalis ATCC 4200]
 gi|256763274|ref|ZP_05503854.1| OpuABC [Enterococcus faecalis T3]
 gi|256957876|ref|ZP_05562047.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis DS5]
 gi|256961126|ref|ZP_05565297.1| OpuABC [Enterococcus faecalis Merz96]
 gi|257079813|ref|ZP_05574174.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis JH1]
 gi|257081841|ref|ZP_05576202.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           E1Sol]
 gi|257087618|ref|ZP_05581979.1| ABC transporter permease [Enterococcus faecalis D6]
 gi|257090777|ref|ZP_05585138.1| ABC glycine betaine/L-proline transporter [Enterococcus faecalis
           CH188]
 gi|257420040|ref|ZP_05597034.1| ABC betaine transporter permease and substrate binding protein
           [Enterococcus faecalis T11]
 gi|257421781|ref|ZP_05598771.1| ABC glycine betaine/L-proline transporter [Enterococcus faecalis
           X98]
 gi|293384072|ref|ZP_06629966.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Enterococcus faecalis R712]
 gi|293386886|ref|ZP_06631456.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Enterococcus faecalis S613]
 gi|294781364|ref|ZP_06746706.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecalis PC1.1]
 gi|300860960|ref|ZP_07107047.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecalis TUSoD Ef11]
 gi|307270648|ref|ZP_07551939.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX4248]
 gi|307276884|ref|ZP_07557995.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX2134]
 gi|307285514|ref|ZP_07565653.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0860]
 gi|307287539|ref|ZP_07567582.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0109]
 gi|312902408|ref|ZP_07761614.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0635]
 gi|312907977|ref|ZP_07766960.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis DAPTO
           512]
 gi|312953668|ref|ZP_07772505.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0102]
 gi|312978495|ref|ZP_07790233.1| ABC transporter, quaternary amine uptake transporter (QAT) family,
           substrate-binding protein [Enterococcus faecalis DAPTO
           516]
 gi|29344592|gb|AAO82350.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Enterococcus
           faecalis V583]
 gi|227176760|gb|EEI57732.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter protein [Enterococcus faecalis
           HH22]
 gi|229305475|gb|EEN71471.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecalis ATCC 29200]
 gi|255962970|gb|EET95446.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           T1]
 gi|255967878|gb|EET98500.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           T2]
 gi|256596377|gb|EEU15553.1| OpuABC [Enterococcus faecalis ATCC 4200]
 gi|256684525|gb|EEU24220.1| OpuABC [Enterococcus faecalis T3]
 gi|256948372|gb|EEU65004.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis DS5]
 gi|256951622|gb|EEU68254.1| OpuABC [Enterococcus faecalis Merz96]
 gi|256987843|gb|EEU75145.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis JH1]
 gi|256989871|gb|EEU77173.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           E1Sol]
 gi|256995648|gb|EEU82950.1| ABC transporter permease [Enterococcus faecalis D6]
 gi|256999589|gb|EEU86109.1| ABC glycine betaine/L-proline transporter [Enterococcus faecalis
           CH188]
 gi|257161868|gb|EEU91828.1| ABC betaine transporter permease and substrate binding protein
           [Enterococcus faecalis T11]
 gi|257163605|gb|EEU93565.1| ABC glycine betaine/L-proline transporter [Enterococcus faecalis
           X98]
 gi|291078552|gb|EFE15916.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Enterococcus faecalis R712]
 gi|291083720|gb|EFE20683.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Enterococcus faecalis S613]
 gi|294451491|gb|EFG19951.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecalis PC1.1]
 gi|295113609|emb|CBL32246.1| ABC-type proline/glycine betaine transport system, permease
           component [Enterococcus sp. 7L76]
 gi|300849999|gb|EFK77749.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecalis TUSoD Ef11]
 gi|306501277|gb|EFM70580.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0109]
 gi|306502738|gb|EFM72003.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0860]
 gi|306506521|gb|EFM75680.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX2134]
 gi|306512958|gb|EFM81599.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX4248]
 gi|310626068|gb|EFQ09351.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis DAPTO
           512]
 gi|310628506|gb|EFQ11789.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0102]
 gi|310634078|gb|EFQ17361.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0635]
 gi|311288644|gb|EFQ67200.1| ABC transporter, quaternary amine uptake transporter (QAT) family,
           substrate-binding protein [Enterococcus faecalis DAPTO
           516]
 gi|315025224|gb|EFT37156.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX2137]
 gi|315032769|gb|EFT44701.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0017]
 gi|315035772|gb|EFT47704.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0027]
 gi|315143732|gb|EFT87748.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX2141]
 gi|315151935|gb|EFT95951.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0031]
 gi|315155518|gb|EFT99534.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0043]
 gi|315159185|gb|EFU03202.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0312]
 gi|315162244|gb|EFU06261.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0645]
 gi|315164936|gb|EFU08953.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX1302]
 gi|315168629|gb|EFU12646.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX1341]
 gi|315170114|gb|EFU14131.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX1342]
 gi|315173750|gb|EFU17767.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX1346]
 gi|315576241|gb|EFU88432.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis
           TX0309B]
 gi|315579182|gb|EFU91373.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0630]
 gi|315582957|gb|EFU95148.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis
           TX0309A]
 gi|323481572|gb|ADX81011.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis 62]
 gi|327535867|gb|AEA94701.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter [Enterococcus faecalis OG1RF]
 gi|329577362|gb|EGG58818.1| ABC transporter, substrate-binding protein, QAT family
           [Enterococcus faecalis TX1467]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|318606880|emb|CBY28378.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 393

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 91  MDPFHNTWVPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 150

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 151 ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 209

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 210 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 269

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 270 VPADLIEAAESFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 329

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 330 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 369


>gi|312900011|ref|ZP_07759329.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0470]
 gi|311293007|gb|EFQ71563.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0470]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|257416825|ref|ZP_05593819.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis AR01/DG]
 gi|257158653|gb|EEU88613.1| betaine ABC transporter permease and substrate binding protein
           [Enterococcus faecalis ARO1/DG]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|257084383|ref|ZP_05578744.1| amino acid ABC transporter, permease [Enterococcus faecalis Fly1]
 gi|256992413|gb|EEU79715.1| amino acid ABC transporter, permease [Enterococcus faecalis Fly1]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|256853947|ref|ZP_05559312.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           T8]
 gi|307290350|ref|ZP_07570265.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0411]
 gi|256710890|gb|EEU25933.1| glycine betaine/L-proline ABC transporter [Enterococcus faecalis
           T8]
 gi|306498543|gb|EFM68045.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0411]
 gi|315030307|gb|EFT42239.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX4000]
          Length = 569

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|259907586|ref|YP_002647942.1| glycine betaine transporter membrane protein [Erwinia pyrifoliae
           Ep1/96]
 gi|224963208|emb|CAX54692.1| Glycine betaine/L-proline transport system permease protein
           [Erwinia pyrifoliae Ep1/96]
 gi|283477428|emb|CAY73344.1| Glycine betaine/L-proline ABC transport system,inner membrane
           component [Erwinia pyrifoliae DSM 12163]
          Length = 387

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 87  LDPFHKTLIPLDSWVTTAIDWVVTHFRPLFQGIRLPIDYILSAFQQLLLGMPAPVAIIVF 146

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+++ V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 147 ALIAWQLS-SLSMGVATLVSLVAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 205

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 206 SQRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 265

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 266 VPADLVEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 325

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 326 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSVGRDKR 365


>gi|222153813|ref|YP_002562990.1| glycine-betaine binding permease [Streptococcus uberis 0140J]
 gi|222114626|emb|CAR43642.1| putative glycine-betaine binding permease protein [Streptococcus
           uberis 0140J]
          Length = 575

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 118/276 (42%), Positives = 166/276 (60%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +Q  +P+   ++     LT       N++  +    ++ V   L ++ PL+F+ +V
Sbjct: 1   MDNFLQTKLPVAKLVESITEWLTGTFSGLFNVIQLVGSYMMDWVTNALLFINPLLFILLV 60

Query: 61  SLLVLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++ V  + R    + V T +GLL I  QG W     T +LVLV++FIS+ IG+PLG+  A
Sbjct: 61  TVAVYFLARKKWPLPVFTFLGLLFIYNQGLWVHLINTFTLVLVASFISIIIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  II   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSSTVRHIINPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EA+ AFG+TP Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EISKELIEASDAFGSTPKQKLLKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
             VL AL   DIG GF SGL +VILAI+LDR     
Sbjct: 241 REVLSALQHADIGTGFVSGLALVILAIVLDRTTQSI 276


>gi|88801194|ref|ZP_01116736.1| ABC-type proline/glycine betaine transport system, permease
           component [Reinekea sp. MED297]
 gi|88776068|gb|EAR07301.1| ABC-type proline/glycine betaine transport system, permease
           component [Reinekea sp. MED297]
          Length = 357

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 163/279 (58%), Gaps = 1/279 (0%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
            P     IPL D+++ F   +  N   F +++   +   +  V      +PPL+ V ++ 
Sbjct: 57  DPFADTLIPLQDWVETFVSWVVGNFRPFFSLIKAPIDATLQAVDVAFNAVPPLMMVALLG 116

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
           LL   +     + + T +G+ ++   G W+E+  TLSLV+ S    M IG+P G+  A  
Sbjct: 117 LLAWQLSGR-KVGIWTVVGMFVLGAVGAWEESMTTLSLVVTSVLFCMVIGIPTGIGMARS 175

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI   
Sbjct: 176 DRAARIMRPVLDTMQTTPAFVYLVPVVMLFGIGNVPGVVVTIIFAVPPVIRLTNLGIRQV 235

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EAA +FGA   Q+  KV+LP A+P I+A + QT+ML LSMVV+ +++   GLG+ 
Sbjct: 236 PEDLIEAANSFGADSKQMLFKVQLPLAMPTIMAGVNQTLMLGLSMVVIASMISVGGLGLM 295

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           VLR +  +DIG     G+ IVILAIILDR+        R
Sbjct: 296 VLRGIGRLDIGLATVGGIGIVILAIILDRMTQSLGQDAR 334


>gi|256963755|ref|ZP_05567926.1| OpuABC [Enterococcus faecalis HIP11704]
 gi|307271702|ref|ZP_07552973.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0855]
 gi|256954251|gb|EEU70883.1| OpuABC [Enterococcus faecalis HIP11704]
 gi|306511580|gb|EFM80579.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Enterococcus faecalis TX0855]
          Length = 569

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSIMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|182439684|ref|YP_001827403.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178468200|dbj|BAG22720.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 873

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG+++      L  +  W  + +S ++    + +  VL    PL+F  +V+++   +
Sbjct: 3   RLPLGEWVDSAVDWLQTHLAWLFDAISSVVSGMFDGIAAVLSAPAPLIFAGIVAVIAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  A+ T +G  LI     W E  +TL+LVLV+T +++ I VPLG+ A+      +I
Sbjct: 63  -RGLPAALLTFVGFALIDSVELWDEAMDTLTLVLVATLVTLVIAVPLGIWASRSRTVSAI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
            R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 TRPVLDFMQTMPAMVYLIPGVIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG T   +  +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTSRNILLRVQLPLALPTIMAGINQVIMLGLSMVVIAGMVGGGGLGGSVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VD+G GFE+G+ IVILA+ LDR+     
Sbjct: 242 NVDVGLGFEAGISIVILAMYLDRMTGALG 270


>gi|329115943|ref|ZP_08244660.1| ABC transporter, substrate-binding protein, QAT family
           [Streptococcus parauberis NCFD 2020]
 gi|326906348|gb|EGE53262.1| ABC transporter, substrate-binding protein, QAT family
           [Streptococcus parauberis NCFD 2020]
          Length = 575

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 112/274 (40%), Positives = 168/274 (61%), Gaps = 1/274 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+   +++    LT       +++  +    ++ +   + ++P L+F+ +V
Sbjct: 1   MENLLQTKLPVAQLVEKLTEWLTNTFSGLFDLMQKVGSYLMDWMTNTMLFIPALLFILLV 60

Query: 61  SLLVLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++ V  + +    +   T +GLL I  QG W+E   T +LV+V++ IS+ IGVPLG+  A
Sbjct: 61  TIAVFFLSKKKWPLPAFTFLGLLFIYNQGLWEELINTFTLVVVASLISIVIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                 +I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KNSTVRNIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EAA +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 EISTELVEAADSFGSTSKQKLFKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
             VL AL   DIG GF SGL +VILAIILDR   
Sbjct: 241 RKVLSALQHADIGTGFVSGLALVILAIILDRTTQ 274


>gi|326780348|ref|ZP_08239613.1| ABC-type glycine betaine transport, periplasmic subunit
           [Streptomyces cf. griseus XylebKG-1]
 gi|326660681|gb|EGE45527.1| ABC-type glycine betaine transport, periplasmic subunit
           [Streptomyces cf. griseus XylebKG-1]
          Length = 873

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 163/269 (60%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG+++      L  +  W  + +S ++    + +  VL    PL+F  +V+++   +
Sbjct: 3   RLPLGEWVDSAVDWLQTHLAWLFDAISSVVSGMFDGIAAVLSAPAPLIFAGIVAVIAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  A+ T +G  LI     W E  +TL+LVLV+T +++ I VPLG+ A+      +I
Sbjct: 63  -RGLPAALLTFVGFALIDSVELWDEAMDTLTLVLVATLVTLVIAVPLGIWASRSRTVSAI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
            R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 TRPVLDFMQTMPAMVYLIPGVIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG T      +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTSRNTLLRVQLPLALPTIMAGINQVIMLGLSMVVIAGMVGGGGLGGSVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VD+G GFE+G+ IVILA+ LDR+     
Sbjct: 242 NVDVGLGFEAGISIVILAMYLDRMTGALG 270


>gi|292489182|ref|YP_003532069.1| glycine betaine/L-proline ABC transporter inner membrane protein
           [Erwinia amylovora CFBP1430]
 gi|292900299|ref|YP_003539668.1| glycine betaine/L-proline ABC transporter permease [Erwinia
           amylovora ATCC 49946]
 gi|291200147|emb|CBJ47273.1| glycine betaine/L-proline ABC transporter, permease protein
           [Erwinia amylovora ATCC 49946]
 gi|291554616|emb|CBA22278.1| Glycine betaine/L-proline ABC transport system, inner membrane
           component [Erwinia amylovora CFBP1430]
 gi|312173341|emb|CBX81596.1| Glycine betaine/L-proline ABC transport system, inner membrane
           component [Erwinia amylovora ATCC BAA-2158]
          Length = 387

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 87  LDPFHKTLIPLDSWVTTAIDWIVSHFRPLFQGIRLPVDYILSAFQQLLLGMPAPVAITVF 146

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+++ V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 147 ALIAWQLS-SVSMGVATLVSLVAIGAIGAWSQAMVTLALVLTALLFCIIIGLPLGIWLAR 205

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 206 SQRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 265

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 266 VPADLVEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 325

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 326 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSVGKDKR 365


>gi|322831482|ref|YP_004211509.1| binding-protein-dependent transport systems inner membrane
           component [Rahnella sp. Y9602]
 gi|321166683|gb|ADW72382.1| binding-protein-dependent transport systems inner membrane
           component [Rahnella sp. Y9602]
          Length = 399

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 113/280 (40%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPL  ++ E    L  N       +   +   ++     L+ LP  + + V 
Sbjct: 97  LDPFHSTLIPLDRWVTEGIDWLVGNFRPVFQGIRVPVDFVLSGFQHGLESLPAPIAILVF 156

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +     +   T + L+LI   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 157 ALLAWQMAG-FGMGAATLVSLVLIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 215

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 216 SQRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGINQ 275

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FG++P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 276 VPEDLIEAAKSFGSSPRQLLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 335

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G  IVILAIILDRL        R
Sbjct: 336 MVLRGIGRLDMGLASVGGAGIVILAIILDRLTQSMGRDSR 375


>gi|167462264|ref|ZP_02327353.1| putative ABC transporter, proline/glycine betaine permease protein
           [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322383435|ref|ZP_08057217.1| ABC transporter proline/glycine betaine permease-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152288|gb|EFX45112.1| ABC transporter proline/glycine betaine permease-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 575

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 120/273 (43%), Positives = 174/273 (63%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG +++     L         ++  ++   V+   ++LQ +P  V + V+SL++L V
Sbjct: 5   KLPLGSWVEGLEAWLESTLGGLFEVIRTVIGGMVDGCQWLLQSVPWFVMIAVLSLIILAV 64

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   +A+ T +GLLL+   GYW  T  TLS VL S  IS+ +GVP+G+L A       +
Sbjct: 65  AR-WRMALFTFIGLLLVFNLGYWDHTMMTLSQVLTSAVISIVLGVPIGILCARRNGVQKV 123

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F LG+VPG++A++VF+IP ++RLT LGI   P  L E
Sbjct: 124 VTPLLDFMQTMPAFVYLLPAVSFFSLGVVPGVIASVVFAIPPTIRLTNLGIRQVPMDLVE 183

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+TP Q   K++LP A+P I+A + QTIMLSLSMVV+++++G+ GLG  V RA+ 
Sbjct: 184 AADAFGSTPMQKLVKLQLPLAVPSIMAGINQTIMLSLSMVVISSMIGAQGLGSDVYRAVT 243

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
              IG GFE+G+ +VILAIILDR       R +
Sbjct: 244 QNKIGSGFEAGVAVVILAIILDRFTQNVVNRRK 276


>gi|86147801|ref|ZP_01066108.1| glycine betaine/L-proline transport system permease [Vibrio sp.
           MED222]
 gi|85834439|gb|EAQ52590.1| glycine betaine/L-proline transport system permease [Vibrio sp.
           MED222]
          Length = 364

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 101/276 (36%), Positives = 159/276 (57%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P  +A +P+  +++     L ++G      +   +   ++     L   P    + ++
Sbjct: 51  LNPFAEAVLPVDTWVESGLNWLVEHGRPLFQAIRVPIDFILSSFETALVSTPAPFMLIIL 110

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+      ++ + + TA+ L  I   G W E   TLSLV+ S F  + IG+P+G+  A 
Sbjct: 111 FLVAWQFS-NLKLGLATAVSLTFIGLIGAWSEAMTTLSLVMTSVFFCLLIGLPMGIWLAR 169

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 170 SNTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 229

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA+  Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 230 VPEELIEAGHSFGASKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 289

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 290 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 325


>gi|327394926|dbj|BAK12348.1| glycine betaine/L-proline transport system permease protein proW
           [Pantoea ananatis AJ13355]
          Length = 383

 Score =  175 bits (444), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   ++    +L  +P  V + + 
Sbjct: 82  MDPFHKTWIPLDHWVTEGIDWVVNHFRPVFQSIRVPVDYILSAFQQLLLGMPAPVAIALF 141

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S  + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 142 ALIAWQIA-SPAMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCIIIGLPMGIWLAR 200

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 201 SERAARIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 260

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 261 VPADLIEASESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 320

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 321 MVLRGIGRLDMGLASVGGVGIVILAIILDRLTQSVARDKR 360


>gi|297195393|ref|ZP_06912791.1| glycine betaine ABC transport system permease [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197719237|gb|EDY63145.1| glycine betaine ABC transport system permease [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 874

 Score =  175 bits (443), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 111/271 (40%), Positives = 162/271 (59%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            I LGD++      L ++  W  + +S ++    + +   L    PL+F  +++++   +
Sbjct: 3   RIHLGDWVDSGVDWLQRHLSWLFDAISSLVTGMYDGIDAALSAPAPLLFAGILAVVAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   V    G  LI     W++   TLSLVLV+T +++ I VPLG+ A+      +I
Sbjct: 63  -RGLLAGVLAFAGFALIDSIELWEDAMSTLSLVLVATLVTLVIAVPLGIWASRSRTVSTI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTMPAMVYLIPGIIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDEELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTPRSTLLRVQLPLALPTIMAGINQVIMLGLSMVVIAGMVGGGGLGGAVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VDIG GFE+G+ IVILA+ LDR+      +
Sbjct: 242 NVDIGLGFEAGVSIVILAMYLDRMTGALGRQ 272


>gi|239986557|ref|ZP_04707221.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces roseosporus NRRL 11379]
          Length = 873

 Score =  175 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG+++      L  +  W  + +S I+    + +  VL    PL+F  +V+++   +
Sbjct: 3   RLPLGEWVDSAVDWLQTHLVWLFDAISSIVSGMFDGIAAVLSAPAPLLFAGIVAVIAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  A+ T +G  LI     W E  +TL+LVLV+T +++ I VPLG+ A+      ++
Sbjct: 63  -RGLPAALLTFVGFALIDSVELWDEAMDTLTLVLVATLVTLVIAVPLGIWASRSKTVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTMPAMVYLIPGVIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG T      +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTSRNTLLRVQLPLALPTIMAGINQVIMLGLSMVVIAGMVGGGGLGGSVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VD+G GFE+G+ IVILA+ LDR+     
Sbjct: 242 NVDVGLGFEAGISIVILAMYLDRMTGALG 270


>gi|304398693|ref|ZP_07380565.1| binding-protein-dependent transport systems inner membrane
           component [Pantoea sp. aB]
 gi|304353904|gb|EFM18279.1| binding-protein-dependent transport systems inner membrane
           component [Pantoea sp. aB]
          Length = 363

 Score =  175 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 62  MDPFHKTWIPLDHWVTTGIDWVVNHFRPLFQGIRVPVDYILSAFQQLLLGMPAPVAILVF 121

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  +  + + T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 122 ALIAWQIA-TPAMGIATLVSLIAIGAIGAWSQAMVTLALVLTALMFCILIGLPLGIWLAR 180

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 181 SERAARIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 240

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 241 VPADLIEASESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 300

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 301 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSFGRDSR 340


>gi|317049234|ref|YP_004116882.1| binding-protein-dependent transporter inner membrane component
           [Pantoea sp. At-9b]
 gi|316950851|gb|ADU70326.1| binding-protein-dependent transport systems inner membrane
           component [Pantoea sp. At-9b]
          Length = 371

 Score =  175 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 69  MDPFHKTLIPLDSWVTHGIDWVVNHFRPVFQGIRVPVDYILSAFQQLLLGMPAPVALVVF 128

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S  + + T + L+LI   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 129 ALIAWQIA-SPAMGIATLISLVLIGAIGAWSQAMVTLALVLTALLFCIIIGLPLGIWLAR 187

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 188 SERAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 247

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 248 VPADLIEASESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 307

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 308 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSVGRDSR 347


>gi|227519676|ref|ZP_03949725.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecalis TX0104]
 gi|227072900|gb|EEI10863.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus faecalis TX0104]
          Length = 569

 Score =  175 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+  +++ F   LT       + L  I    ++ +  +L  +PPLV + ++++   
Sbjct: 3   KYQLPVASWVESFTDWLTSTFAGLFSFLQTIGQSVMDNITALLTAVPPLVLIVLLTIAAF 62

Query: 66  MVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            +  + I +++ T +GL+ I  Q  W +   T++LVL+S+ IS+ IGVPLG+L A   + 
Sbjct: 63  FISNKKIGLSLFTFIGLMFIYNQNLWNDLMSTVTLVLLSSVISIIIGVPLGILMAKSEKA 122

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            SII   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P  
Sbjct: 123 KSIITPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPNE 182

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  VL 
Sbjct: 183 LVEAADSYGSTGWQKLFKLELPLAKNTIMAGVNQTTMLALSMVVIASMIGAPGLGRGVLS 242

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           AL    +G GF +G+ +VILAII+DR     
Sbjct: 243 ALQRAQVGNGFVNGVALVILAIIIDRFTQHL 273


>gi|291443497|ref|ZP_06582887.1| LOW QUALITY PROTEIN: glycine betaine transport system permease
           protein [Streptomyces roseosporus NRRL 15998]
 gi|291346444|gb|EFE73348.1| LOW QUALITY PROTEIN: glycine betaine transport system permease
           protein [Streptomyces roseosporus NRRL 15998]
          Length = 866

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG+++      L  +  W  + +S I+    + +  VL    PL+F  +V+++   +
Sbjct: 3   RLPLGEWVDSAVDWLQTHLVWLFDAISSIVSGMFDGIAAVLSAPAPLLFAGIVAVIAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  A+ T +G  LI     W E  +TL+LVLV+T +++ I VPLG+ A+      ++
Sbjct: 63  -RGLPAALLTFVGFALIDSVELWDEAMDTLTLVLVATLVTLVIAVPLGIWASRSKTVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTMPAMVYLIPGVIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG T      +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTSRNTLLRVQLPLALPTIMAGINQVIMLGLSMVVIAGMVGGGGLGGSVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VD+G GFE+G+ IVILA+ LDR+     
Sbjct: 242 NVDVGLGFEAGISIVILAMYLDRMTGALG 270


>gi|239940068|ref|ZP_04692005.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces roseosporus NRRL 15998]
          Length = 867

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG+++      L  +  W  + +S I+    + +  VL    PL+F  +V+++   +
Sbjct: 3   RLPLGEWVDSAVDWLQTHLVWLFDAISSIVSGMFDGIAAVLSAPAPLLFAGIVAVIAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  A+ T +G  LI     W E  +TL+LVLV+T +++ I VPLG+ A+      ++
Sbjct: 63  -RGLPAALLTFVGFALIDSVELWDEAMDTLTLVLVATLVTLVIAVPLGIWASRSKTVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTMPAMVYLIPGVIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG T      +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTSRNTLLRVQLPLALPTIMAGINQVIMLGLSMVVIAGMVGGGGLGGSVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VD+G GFE+G+ IVILA+ LDR+     
Sbjct: 242 NVDVGLGFEAGISIVILAMYLDRMTGALG 270


>gi|310640756|ref|YP_003945514.1| glycine betaine abc transporter permease protein [Paenibacillus
           polymyxa SC2]
 gi|309245706|gb|ADO55273.1| Glycine betaine ABC transporter permease protein [Paenibacillus
           polymyxa SC2]
          Length = 864

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 107/270 (39%), Positives = 169/270 (62%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+ +++Q     +  +     N++S ++   V     +     PLVF+ ++ ++  M+
Sbjct: 4   KLPIAEWIQSIVDWMGIHLAGLFNVISSVIEAVVGFFSGLFMLPHPLVFIVIIGIIAFMI 63

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   + + T +G LLI   GYW ET  TL LV+ S  +S+ IG+P+G+  A+      I
Sbjct: 64  GRVQ-LTLFTVIGFLLIDNLGYWSETMNTLGLVITSALVSIVIGIPIGIWCAYSKSASRI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYL+PA+  F LG+VPG++A+++F+IP ++R+T LGI+     L E
Sbjct: 123 ITPLLDFMQTMPAFVYLLPAVTFFSLGVVPGVIASVIFAIPPTIRMTNLGIMQVSDELVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFG+T  Q   KV+LP A+P ++A + QTIMLSLSMVV+ +++G+ G+G  V RA+ 
Sbjct: 183 ASDAFGSTSAQKLFKVQLPLALPTLMAGINQTIMLSLSMVVIASMIGAEGIGAVVYRAVT 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            + IG+GFE+GL +V+LAI+LDR       
Sbjct: 243 QLQIGKGFEAGLAVVVLAIVLDRFTQNLFK 272


>gi|84394016|ref|ZP_00992754.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio splendidus 12B01]
 gi|84375353|gb|EAP92262.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio splendidus 12B01]
          Length = 364

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 102/276 (36%), Positives = 160/276 (57%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P  +A +P+  +++     L ++G      +   +   ++     L   P    + ++
Sbjct: 51  LNPFAEAVLPVDTWVESGLNWLVEHGRPLFQAIRVPIDFILSSFETALVSTPAPFMLIIL 110

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+      ++ + V TA+ L +I   G W E   TLSLV+ S F  + IG+P+G+  A 
Sbjct: 111 FLVAWQFS-NLKLGVATAVSLTMIGLIGAWSEAMTTLSLVMTSVFFCLLIGLPMGIWLAR 169

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 170 SNTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 229

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA+  Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 230 VPEDLIEAGHSFGASKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 289

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 290 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 325


>gi|299529137|ref|ZP_07042585.1| glycine betaine/L-proline transportsystem permease protein proW
           [Comamonas testosteroni S44]
 gi|298722893|gb|EFI63802.1| glycine betaine/L-proline transportsystem permease protein proW
           [Comamonas testosteroni S44]
          Length = 414

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 162/277 (58%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    +P+ D +      +  +   F   +   +   +N V  VLQ +P    V +++LL
Sbjct: 100 ITTEGLPVQDSINNGLTWVVDHFRPFFQAVRTPIDATLNGVTDVLQTIPMPALVLLIALL 159

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+G+A+ LL++   G W E   TL+LVL S F  + IG+P+G+L A   R
Sbjct: 160 AWQFAGR-KLAIGSAVSLLIVALLGIWSEAMVTLALVLTSLFFCIVIGLPVGILLASSDR 218

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
                R  LD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  +RLT LGI    P
Sbjct: 219 AQRWTRPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLIRLTNLGIRQVRP 278

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 279 DLIEASRAYGASPAQLLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 338

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI+LDR+        R
Sbjct: 339 RGIGRLDMGLATVGGLGIVLLAIVLDRITQAMGEPKR 375


>gi|120610182|ref|YP_969860.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax citrulli AAC00-1]
 gi|120588646|gb|ABM32086.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax citrulli AAC00-1]
          Length = 451

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +S +    +P+  ++ +      ++       +   +   +  V  VL  LP L  V VV
Sbjct: 118 LSQLWDGSLPVEHWINQGLTWTVEHFRPAFQAVRAPVDATLAGVQSVLTGLPTLGMVAVV 177

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL         +A+G  + LLL+   G WQE   TLSLVL S    + +G+PLG+L A 
Sbjct: 178 GLLAWQFAGRA-LALGAVVSLLLVAMLGIWQEAMVTLSLVLTSLAFCLVLGLPLGILLAS 236

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT P FVYL+P ++LFG+G VPG+V TIVF++P  VRLT LG+  
Sbjct: 237 SDRAQRLLRPALDAMQTTPAFVYLVPVVMLFGIGNVPGVVVTIVFALPPLVRLTNLGLRQ 296

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P L EAA A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG 
Sbjct: 297 VRPDLVEAARAYGASPLQMLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQ 356

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IV+LAI LDRL        R
Sbjct: 357 MVLRGIGRLDMGLATVGGLGIVLLAITLDRLTQAMGQPRR 396


>gi|264677530|ref|YP_003277436.1| glycine betaine/L-proline transportsystem permease protein proW
           [Comamonas testosteroni CNB-2]
 gi|262208042|gb|ACY32140.1| glycine betaine/L-proline transportsystem permease protein proW
           [Comamonas testosteroni CNB-2]
          Length = 414

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 162/277 (58%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    +P+ D +      +  +   F   +   +   +N V  VLQ +P    V +++LL
Sbjct: 100 ITTEGLPVQDSINNGLTWVVDHFRPFFQAVRTPIDATLNGVTDVLQTIPMPALVLLIALL 159

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+G+A+ LL++   G W E   TL+LVL S F  + IG+P+G+L A   R
Sbjct: 160 AWQFAGR-KLAIGSAVSLLIVALLGIWSEAMVTLALVLTSLFFCIVIGLPVGILLASSDR 218

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
                R  LD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  +RLT LGI    P
Sbjct: 219 AQRWTRPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLIRLTNLGIRQVRP 278

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 279 DLIEASRAYGASPAQLLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 338

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI+LDR+        R
Sbjct: 339 RGIGRLDMGLATVGGLGIVLLAIVLDRITQAMGEPKR 375


>gi|218709173|ref|YP_002416794.1| glycine betaine/L-proline transport system permease ProW [Vibrio
           splendidus LGP32]
 gi|218322192|emb|CAV18306.1| Glycine betaine/L-proline transport system permease protein proW
           [Vibrio splendidus LGP32]
          Length = 364

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 100/276 (36%), Positives = 158/276 (57%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P  +A +P+  +++     L ++G      +   +   ++     L   P    + ++
Sbjct: 51  LNPFAEAVLPVDTWVESGLNWLVEHGRPLFQAIRVPIDFILSSFETALVSTPAPFMLIIL 110

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+      ++ + + TA+ L  I   G W     TLSLV+ S F  + IG+P+G+  A 
Sbjct: 111 FLVAWQFS-NLKLGLATAISLTFIGLIGAWSGAMTTLSLVMTSVFFCLLIGLPMGIWLAR 169

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  +R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 170 SNTAAKFVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 229

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA+  Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 230 VPEDLIEAGHSFGASKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 289

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 290 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 325


>gi|188533081|ref|YP_001906878.1| glycine betaine transporter membrane protein [Erwinia tasmaniensis
           Et1/99]
 gi|188028123|emb|CAO95980.1| Glycine betaine/L-proline transport system permease protein
           [Erwinia tasmaniensis Et1/99]
          Length = 387

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 87  LDPFHKTLIPLDSWVTTAIDWVVTHFRPLFQGVRLPVDYILSTFQQLLLGMPAPVAIIVF 146

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S ++ V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 147 ALIAWQLS-SFSMGVATLVSLVAIGAIGAWSQAMVTLALVLTALLFCIIIGLPLGIWLAR 205

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 206 SQRAAKIIRPMLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 265

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 266 VPADLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 325

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL       +R
Sbjct: 326 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSLGRDNR 365


>gi|313890394|ref|ZP_07824025.1| ABC transporter, substrate-binding protein, QAT family
           [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121237|gb|EFR44345.1| ABC transporter, substrate-binding protein, QAT family
           [Streptococcus pseudoporcinus SPIN 20026]
          Length = 575

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 170/280 (60%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I++  +P+   +++    LT       N L  I    ++ +  VL ++ PL+F+ +V
Sbjct: 1   MGNILETKLPVAKLVEKLTEWLTHTFSGVFNFLQTIGSYIMDWITNVLLFINPLLFIVLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
            + +  + K+   +A  T +GLL I  QG W+    T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAAVFFLAKKKWPLATFTFLGLLFIYNQGLWEHLINTFTLVLVASLISIIIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG  A+++F++P +VR T LGI 
Sbjct: 121 KSTTVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGAFASVIFALPPTVRFTNLGIS 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
           +    L EA+ AFG+TP Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 NISTELVEASDAFGSTPRQKLLKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
             VL AL   D+G GF SGL +VILAIILDR     + + 
Sbjct: 241 REVLSALQHADVGTGFVSGLALVILAIILDRTTQSINSKQ 280


>gi|257885408|ref|ZP_05665061.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,501]
 gi|257821264|gb|EEV48394.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,501]
          Length = 571

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 106/274 (38%), Positives = 166/274 (60%), Gaps = 1/274 (0%)

Query: 5   IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLV 64
           +   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++++  
Sbjct: 1   MNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLLTVAA 60

Query: 65  LMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A   +
Sbjct: 61  FFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMAKSSK 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
             SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P 
Sbjct: 121 AQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPK 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG  VL
Sbjct: 181 ELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLGRGVL 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 SALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 274


>gi|257880362|ref|ZP_05660015.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,230,933]
 gi|257882213|ref|ZP_05661866.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,502]
 gi|257891020|ref|ZP_05670673.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,410]
 gi|257894273|ref|ZP_05673926.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,408]
 gi|260562336|ref|ZP_05832850.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           C68]
 gi|257814590|gb|EEV43348.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,230,933]
 gi|257817871|gb|EEV45199.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,502]
 gi|257827380|gb|EEV54006.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,410]
 gi|257830652|gb|EEV57259.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           1,231,408]
 gi|260073260|gb|EEW61601.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium
           C68]
          Length = 571

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 106/274 (38%), Positives = 166/274 (60%), Gaps = 1/274 (0%)

Query: 5   IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLV 64
           +   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++++  
Sbjct: 1   MNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLLTVAA 60

Query: 65  LMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A   +
Sbjct: 61  FFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMAKSSK 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
             SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P 
Sbjct: 121 AQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPK 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG  VL
Sbjct: 181 ELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLGRGVL 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 SALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 274


>gi|197334765|ref|YP_002155547.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio fischeri MJ11]
 gi|197316255|gb|ACH65702.1| glycine betaine/L-proline transport system permease protein ProW
           [Vibrio fischeri MJ11]
          Length = 360

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 103/276 (37%), Positives = 159/276 (57%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P  +A +P+  +++     L ++G      +   +   ++     L   P    + ++
Sbjct: 48  LNPFEEAVLPVDTWVESGLNWLVEHGRPLFQAIRVPIDFILSSFETALVSTPAPFMLLIL 107

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      ++ + V TA+ LL I   G W +   TL+LV+ S F  + IG+P+G+  A 
Sbjct: 108 FLLAWQFS-NLKLGVSTAISLLFIGLIGAWSQAMTTLALVMTSVFFCLLIGLPMGIWLAR 166

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 167 SRTAAKFIRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 226

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 227 VPTDLIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 286

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  +  
Sbjct: 287 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQVLG 322


>gi|59711393|ref|YP_204169.1| glycine betaine transporter subunit [Vibrio fischeri ES114]
 gi|59479494|gb|AAW85281.1| glycine betaine transporter subunit [Vibrio fischeri ES114]
          Length = 360

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 104/276 (37%), Positives = 159/276 (57%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P  +A +P+  +++     L ++G      +   +   ++     L   P    + ++
Sbjct: 48  LNPFEEAVLPVDTWVESGLNWLVEHGRPLFQAIRVPIDFILSSFETALVSTPAPFMLLIL 107

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL      ++ + V TA+ LL I   G W +   TL+LV+ S F  + IG+P+G+  A 
Sbjct: 108 FLLAWQFS-NLKLGVSTAISLLFIGLIGAWSQAMTTLALVMTSVFFCLLIGLPMGIWLAR 166

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                  IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 167 SRTAAKFIRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGIQQ 226

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  +FGA   Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 227 VPTDLIEAGHSFGANKKQMLYRIQLPLALPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 286

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     GL IVILAI+LDR+  I  
Sbjct: 287 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQILG 322


>gi|261209289|ref|ZP_05923681.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium TC
           6]
 gi|260076835|gb|EEW64570.1| glycine betaine/L-proline ABC transporter [Enterococcus faecium TC
           6]
          Length = 571

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 106/274 (38%), Positives = 166/274 (60%), Gaps = 1/274 (0%)

Query: 5   IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLV 64
           +   +P+ ++++      T       + L  I    ++ +  +L  +P  +F+ ++++  
Sbjct: 1   MNYQLPVANWVENITEWFTTTFSGLFSFLQTIGQAVMSGITNLLLVIPAPLFILLLTVAA 60

Query: 65  LMVKR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             + +    + + T +GL  I  QG W +   T++LVL+S+ IS+ IGVPLG+L A   +
Sbjct: 61  FFISKKRPGLTLFTLIGLWFIYNQGLWNDLMNTVTLVLLSSVISIIIGVPLGILMAKSSK 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
             SII+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI   P 
Sbjct: 121 AQSIIKPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIRQVPK 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ +FG+T  Q   K+ELP A   I+A + QT MLSLSMVV+ +++G+ GLG  VL
Sbjct: 181 ELVEASDSFGSTSRQKLFKLELPLAKSTIMAGINQTTMLSLSMVVIASMIGAPGLGRGVL 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            AL    +G GF +G+ +VILAII+DR     + 
Sbjct: 241 SALQRAQVGNGFVNGVALVILAIIIDRFTQHLNQ 274


>gi|332162774|ref|YP_004299351.1| glycine betaine transporter membrane protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667004|gb|ADZ43648.1| glycine betaine transporter membrane protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330861135|emb|CBX71398.1| glycine betaine/L-proline transport system permease protein proW
           [Yersinia enterocolitica W22703]
          Length = 376

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 74  MDPFHNTWVPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 133

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 134 ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 192

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 193 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 252

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 253 VPADLIEAAESFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 312

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 313 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 352


>gi|326316351|ref|YP_004234023.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323373187|gb|ADX45456.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 453

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 113/280 (40%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +S +    +P+  ++ +      ++       +   +   +  V  VL  LP L  + VV
Sbjct: 120 LSQLWDGSLPVEHWINQGLTWTVEHFRPAFQAVRAPVDATLAGVQSVLTGLPTLGMIAVV 179

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL         +A+G  + LLL+   G WQE   TLSLVL S    + +G+PLG+L A 
Sbjct: 180 GLLAWQFAGRA-LALGAVVSLLLVAMLGIWQEAMVTLSLVLTSLAFCLLLGLPLGILLAS 238

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT P FVYL+P ++LFG+G VPG+V TIVF++P  VRLT LG+  
Sbjct: 239 SDRAQRLLRPALDAMQTTPAFVYLVPVVMLFGIGNVPGVVVTIVFALPPLVRLTNLGLRQ 298

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P L EAA A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG 
Sbjct: 299 VRPDLVEAARAYGASPLQMLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQ 358

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IV+LAI LDRL        R
Sbjct: 359 MVLRGIGRLDMGLATVGGLGIVLLAITLDRLTQAMGQPRR 398


>gi|94987791|ref|YP_595892.1| glycine betaine transport system permease protein [Streptococcus
           pyogenes MGAS9429]
 gi|94541299|gb|ABF31348.1| glycine betaine-binding protein [Streptococcus pyogenes MGAS9429]
          Length = 578

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|50913550|ref|YP_059522.1| glycine betaine transport system permease protein [Streptococcus
           pyogenes MGAS10394]
 gi|139473033|ref|YP_001127748.1| glycine-betaine binding permease protein [Streptococcus pyogenes
           str. Manfredo]
 gi|50902624|gb|AAT86339.1| Glycine betaine-binding protein [Streptococcus pyogenes MGAS10394]
 gi|134271279|emb|CAM29495.1| putative glycine-betaine binding permease protein [Streptococcus
           pyogenes str. Manfredo]
          Length = 575

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|332522360|ref|ZP_08398612.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332313624|gb|EGJ26609.1| ABC transporter, quaternary amine uptake transporter family,
           substrate-binding protein [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 575

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 171/280 (61%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I++  +P+   +++    LT       N L  I    ++ +  VL ++ PL+F+ +V
Sbjct: 1   MGNILETKLPVAKLVEKLTEWLTHTFSGLFNFLQTIGSYVMDWITSVLLFINPLLFIVLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
            + +  + K+   +A  T +GLL I  QG W+    T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAAVFFLAKKKWPLATFTFLGLLFIYNQGLWEHLINTFTLVLVASLISIIIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIS 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
           +    L EA+ AFG+TP Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 NISTELVEASDAFGSTPRQKLLKVELPLAKNTIMAGINQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
             VL AL   DIG GF SGL +VILAIILDR     + + 
Sbjct: 241 REVLSALQHADIGTGFVSGLALVILAIILDRTTQSINSKQ 280


>gi|241896021|ref|ZP_04783317.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Weissella paramesenteroides ATCC 33313]
 gi|241870752|gb|EER74503.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Weissella paramesenteroides ATCC 33313]
          Length = 575

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 102/271 (37%), Positives = 163/271 (60%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM- 66
            IPLG ++      LT +     + +       ++ +   L  +P  +F+  +++  ++ 
Sbjct: 10  KIPLGPWVDSGIDWLTAHLSGLFDAIQKGGNAVMDTMTGALSAIPVWLFIIGITIFAILM 69

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
             +   +   T +GL+++  QG W +   T +LV++S+ IS+ IGVPLG+  A       
Sbjct: 70  FGKKWGVPFFTFIGLIIVENQGLWSDLMSTFTLVIISSLISVIIGVPLGIWMAKNETVNK 129

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           II+  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR++ LGI   P  L 
Sbjct: 130 IIQPILDFMQTMPAFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMSNLGIRQVPTDLV 189

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T  Q   KVELP A   I + + QT+ML+LSMVV+ +++G+ GLG  VL A+
Sbjct: 190 EAADSFGSTGKQKLFKVELPLAQGTIFSGINQTLMLALSMVVIASMIGAPGLGRGVLSAV 249

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
              DIG+GF +G  +V+LAII+DR     + 
Sbjct: 250 QNADIGKGFVNGFSLVVLAIIIDRFTQKLNR 280


>gi|146312799|ref|YP_001177873.1| glycine betaine transporter membrane protein [Enterobacter sp. 638]
 gi|145319675|gb|ABP61822.1| binding-protein-dependent transport systems inner membrane
           component [Enterobacter sp. 638]
          Length = 355

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 55  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGIRVPVDYILNGFQQMLLGMPAPVAIMLF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      S  + + T + L+ I   G W +   TL+LVL + F  + IG+P+G+  A 
Sbjct: 115 ALIAWQFG-SAGMGIATLISLVAIGAIGAWSQAMVTLALVLTALFFCIIIGLPMGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 174 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 333


>gi|306828147|ref|ZP_07461410.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Streptococcus pyogenes ATCC 10782]
 gi|304429684|gb|EFM32730.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Streptococcus pyogenes ATCC 10782]
          Length = 575

 Score =  172 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|157371969|ref|YP_001479958.1| glycine betaine transporter membrane protein [Serratia
           proteamaculans 568]
 gi|157323733|gb|ABV42830.1| binding-protein-dependent transport systems inner membrane
           component [Serratia proteamaculans 568]
          Length = 374

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  +P   ++      L  +       +   +   ++    +L  +P  + + + 
Sbjct: 72  LDPFHKTWVPFDSWVTHGIDWLVLHFRPLFQGIRVPVDFILSGFQQLLLGMPAPIAILLF 131

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +  S+ +   T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A 
Sbjct: 132 SLIAWQLS-SLGMGAATLVSLIAIGAIGAWSQAMVTLALVLTALFFCIVIGLPLGIWLAR 190

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 +IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 191 SKHAGKVIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 250

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 251 VPEDLIEAAESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 310

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 311 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 350


>gi|145297975|ref|YP_001140816.1| glycine betaine/L-proline transport system permease protein
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850747|gb|ABO89068.1| glycine betaine/L-proline transport system permease protein
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 383

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 172/280 (61%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  QA +PL  +++     L +N      ++   +   +N +  +LQ +P  + + ++
Sbjct: 73  LDPFQQALVPLDVWVESGIGWLVENLRPVFQLIRAPVEVTLNAMTHLLQTVPSTLMMGML 132

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  +  +A+GT + L+ I   G W +   TLSLVL S F  + IG+P+G++ A 
Sbjct: 133 ALIAWQMV-NGRMALGTLLSLVGIGLIGAWSDAMVTLSLVLNSLFFCILIGLPVGIMLAR 191

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  +  R  LD+MQT P FVYLIP ++LFG+G VPG+V T++F++P  +RLT LGI  
Sbjct: 192 SERLSTWTRPLLDAMQTTPAFVYLIPIVMLFGIGNVPGVVVTVIFALPPMIRLTMLGIRQ 251

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 252 VPEDLVEAAHSFGASPSQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 311

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IV+LAI+LDRL      RDR
Sbjct: 312 MVLRGIGRLDMGLASIGGLGIVLLAIVLDRLTQAMGQRDR 351


>gi|332978589|gb|EGK15295.1| glycine/betaine ABC superfamily ATP binding cassette transporter,
           substrate-binding protein [Psychrobacter sp. 1501(2011)]
          Length = 662

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 100/267 (37%), Positives = 161/267 (60%), Gaps = 1/267 (0%)

Query: 15  LQEFFVCLTQNGEWFCNILSFI-LLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITI 73
           L      + QN       +S + L   +  +  +L+  PP + + +++LL     R I  
Sbjct: 376 LNNSLSYVVQNFGEVFRSISHVALTYLLLPIENLLKVTPPWLVLGLIALLGWFATRKIWF 435

Query: 74  AVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLD 133
           AV    GL LI   G W    +T++L++VS  ++M IG+P+G+L A       ++   LD
Sbjct: 436 AVACGAGLFLIGAFGLWPALVQTMALLIVSVLVTMVIGIPIGILMAGSNVLRKVVTPVLD 495

Query: 134 SMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFG 193
            MQT+P+FVYLIP L+LFG+G VP + AT++++ P  +RLT LGI   P  + EA  +FG
Sbjct: 496 VMQTMPSFVYLIPVLMLFGIGKVPALFATVIYASPPLIRLTMLGIKQVPHEMVEAGRSFG 555

Query: 194 ATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGR 253
           +T  Q+   ++LP A+P I+A + Q +M+SLSMVV+ +++G+ GLG  VL+++ T++IG+
Sbjct: 556 STHTQLLFWIKLPQALPNIMAGVNQAVMMSLSMVVLASMIGAPGLGEDVLQSIQTLNIGQ 615

Query: 254 GFESGLCIVILAIILDRLFSIPDPRDR 280
           G ++G  IVI+AII+DR+        R
Sbjct: 616 GLQAGTAIVIMAIIIDRITQAFGQGRR 642


>gi|293394761|ref|ZP_06639052.1| glycine betaine/L-proline ABC superfamily ATP binding cassette
           transporter, permease protein [Serratia odorifera DSM
           4582]
 gi|291422712|gb|EFE95950.1| glycine betaine/L-proline ABC superfamily ATP binding cassette
           transporter, permease protein [Serratia odorifera DSM
           4582]
          Length = 393

 Score =  171 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  +PL  ++      L  +       +   +   ++    +L  +P  + + V 
Sbjct: 91  LDPFHKTWLPLDSWVTHGIDWLVLHFRPLFQGIRVPVDFILSGFQQLLLGMPSPIAILVF 150

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +  S+ +   T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A 
Sbjct: 151 SLIAWQLS-SLGMGAATLVSLIAIGAIGAWSQAMVTLALVLTALFFCIIIGLPLGIWLAR 209

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 +IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 210 SRHAAKVIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 269

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FG++P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 270 VPADLIEAAESFGSSPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 329

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 330 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 369


>gi|329907288|ref|ZP_08274605.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Oxalobacteraceae bacterium IMCC9480]
 gi|327547038|gb|EGF31925.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Oxalobacteraceae bacterium IMCC9480]
          Length = 412

 Score =  171 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 112/277 (40%), Positives = 156/277 (56%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
                 P+  ++             F   +   +   +  V  +LQ +P L  V +  LL
Sbjct: 88  FFDGSTPVESWINHGLDWFVTQFRPFFQTVRAPIDGTLMWVQDLLQSIPSLAMVTIFGLL 147

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+GT + LL+++  G W E   TLSLVL S    + IG+PLGVL A   R
Sbjct: 148 AWQFAGR-GVAIGTVISLLVVVLLGIWPEAMVTLSLVLTSLAFCLVIGLPLGVLLASSDR 206

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
              + R  LD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  VRLT LGI    P
Sbjct: 207 AQRLTRPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLVRLTNLGIRQVRP 266

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA A+GA+P Q+  KV+LP A+P I+A + QT+MLSLSMVV+ +++   GLG  VL
Sbjct: 267 DLIEAARAYGASPAQMLFKVQLPLALPSIMAGVNQTLMLSLSMVVIASMIAVGGLGQMVL 326

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI LDR+        R
Sbjct: 327 RGIGRLDMGLATVGGLGIVLLAISLDRITKAAGQSSR 363


>gi|253990652|ref|YP_003042008.1| glycine betaine transporter membrane protein [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782102|emb|CAQ85266.1| glycine betaine/l-proline transport system permease protein prow
           [Photorhabdus asymbiotica]
          Length = 361

 Score =  171 bits (433), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 157/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++      +  N       +   +   +N     L  +P  V + + 
Sbjct: 59  MDPFQNTLIPLDSWVTHAIDWIVLNFRPAFQGIRIPIDFVLNGFEQCLTSMPAPVAIMLF 118

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   I + + +   L++I   G W E   TL+L L S    + IG+PLG+  + 
Sbjct: 119 ALIAWQLSG-IGMGIASLASLIVIGAIGAWSEAMVTLALALTSLLFCIIIGLPLGLWLSR 177

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG++ TI+F++P  VRLT LGI  
Sbjct: 178 SERAAKIIRPMLDAMQTTPAFVYLVPIVMLFGIGNVPGVIVTIIFALPPIVRLTILGIKQ 237

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 238 VPTDLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 297

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAI+LDRL        R
Sbjct: 298 MVLRGIGRLDMGLAAVGGVGIVILAILLDRLTQSLGRDSR 337


>gi|238796648|ref|ZP_04640154.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia mollaretii ATCC 43969]
 gi|238719379|gb|EEQ11189.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia mollaretii ATCC 43969]
          Length = 365

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 63  MDPFHTTWLPLDSWVTHGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 122

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 123 ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 181

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 182 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 241

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 242 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 301

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 302 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 341


>gi|295839824|ref|ZP_06826757.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces sp. SPB74]
 gi|295827665|gb|EDY44702.2| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces sp. SPB74]
          Length = 1148

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 107/271 (39%), Positives = 157/271 (57%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            + LGD++      L  N  W  + ++       + +  VL    PL+   ++++L   +
Sbjct: 3   RLHLGDWVDSIVDWLQNNLSWLFDFIATCAKGMYDGINAVLNGPEPLLLAGILAVLAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
              +T  V +  G  LI     W+    + SLV+V+T I++ +GVPLG+ AA   R  +I
Sbjct: 63  LG-LTAGVLSFAGFALIDSLELWEPAMNSFSLVVVATVIALIVGVPLGIWAARSQRASAI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD  QT+P  VYLIPA+  FG+G+  GIVATI+F    +VR+T LGI      L E
Sbjct: 122 VRPVLDFTQTMPAMVYLIPAIFFFGVGVPAGIVATIIFGFAPAVRMTELGIRQVDEELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP +    V+LP A+P I+A + Q IML+LSMVV+  ++G  GLG  V +A+ 
Sbjct: 182 AADAFGTTPRKTLFGVQLPLALPTIMAGINQVIMLNLSMVVIAGMIGGGGLGGSVYQAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VDIG G E+G+ IVILAI LDR+ ++   +
Sbjct: 242 NVDIGLGSEAGISIVILAIYLDRVVAVLGQQ 272


>gi|308067985|ref|YP_003869590.1| glycine/betaine-binding protein precursor [Paenibacillus polymyxa
           E681]
 gi|305857264|gb|ADM69052.1| Glycine betaine-binding protein precursor [Paenibacillus polymyxa
           E681]
          Length = 618

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 108/270 (40%), Positives = 169/270 (62%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+ +++Q     +  +     N++S I+   V     +     PLVF+ ++ ++  M+
Sbjct: 4   KLPIAEWIQAIVDWMGIHLAGLFNVISSIIEAVVGFFSGLFMLPHPLVFIVIIGIIAFMI 63

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   + + T +G LLI   GYW ET  TL LV+ S  +S+ IG+P+G+  A+      I
Sbjct: 64  GRVQ-LTLFTVIGFLLIDNLGYWSETMNTLGLVITSALVSIVIGIPIGIWCAYSKSASRI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYL+PA+  F LG+VPG++A+++F+IP ++R+T LGI+     L E
Sbjct: 123 ITPLLDFMQTMPAFVYLLPAVTFFSLGVVPGVIASVIFAIPPTIRMTNLGIMQVSGELIE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFG+T  Q   KV+LP A+P ++A + QTIMLSLSMVV+ +++G+ G+G  V RA+ 
Sbjct: 183 ASDAFGSTSAQKLFKVQLPLALPTLMAGINQTIMLSLSMVVIASMIGAEGIGAVVYRAVT 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            + IG+GFE+GL +V+LAI+LDR       
Sbjct: 243 QLQIGKGFEAGLAVVVLAIVLDRFTQNLFK 272


>gi|324994216|gb|EGC26130.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK678]
 gi|325697943|gb|EGD39827.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK160]
          Length = 574

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVESFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|126735115|ref|ZP_01750861.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseobacter sp. CCS2]
 gi|126715670|gb|EBA12535.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseobacter sp. CCS2]
          Length = 277

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 133/274 (48%), Positives = 183/274 (66%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MS +    IP+GD+ +     L +NG    + +S  L   ++ ++++LQ  P  V +   
Sbjct: 1   MSWLTDNKIPVGDWSENAVDWLKENGRPAFDAVSDGLDFMIDGIVWILQTPPEAVVIAAF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL  +++RS  + +     LL ++ QGYW ETT++L+LVL S  + M +GVP+G+  A 
Sbjct: 61  ILLTWVLQRSWKVCLLVFACLLFVLNQGYWDETTDSLALVLSSCVVCMGLGVPIGIFLAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+P FVYLIPA+V FGLGMVPG+ AT++F +P  +RLT LG+ +
Sbjct: 121 RPRAYQAVSPVLDLMQTLPAFVYLIPAIVFFGLGMVPGLFATVIFVLPAPIRLTYLGVSN 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGATP Q   KVELP+A+PQI+A L Q IMLSLSMVV++A VG+NGLG 
Sbjct: 181 TPTSLLEAAEAFGATPAQRLWKVELPYAVPQIMAGLNQVIMLSLSMVVISAYVGANGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSI 274
           PV++AL   D G GFESGL IV +AI+LDR+  +
Sbjct: 241 PVVQALGRNDPGLGFESGLVIVAVAIMLDRMLRV 274


>gi|94993560|ref|YP_601658.1| glycine betaine-binding protein / glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS10750]
 gi|94547068|gb|ABF37114.1| Glycine betaine-binding protein / Glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS10750]
          Length = 575

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|94989669|ref|YP_597769.1| glycine betaine-binding protein / glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS10270]
 gi|94543177|gb|ABF33225.1| Glycine betaine-binding protein / Glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS10270]
          Length = 575

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|71909972|ref|YP_281522.1| glycine betaine-binding protein/glycine betaine transporter
           permease [Streptococcus pyogenes MGAS5005]
 gi|71852754|gb|AAZ50777.1| glycine betaine-binding protein/glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS5005]
          Length = 575

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|332364733|gb|EGJ42502.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK1059]
          Length = 574

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|330718294|ref|ZP_08312894.1| OpuABC protein [Leuconostoc fallax KCTC 3537]
          Length = 569

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 114/278 (41%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
                IPLG ++++    LT N   F + +       ++ +   L  +P  + +  ++L+
Sbjct: 2   FNIPKIPLGPWVKDGVDWLTDNLNGFFSAIQHAGQTVMDGLTTGLTAIPIPIMIIGITLI 61

Query: 64  V-LMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
             L   +     +    GL+L+  QG W++   TL+LV++++ IS+ IGVPLG+LAA   
Sbjct: 62  AVLTANKKFGFPIFAFFGLVLVANQGLWEDLMNTLTLVVMASVISLIIGVPLGILAAKSD 121

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
           R  +II+  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI   P
Sbjct: 122 RARAIIQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTNLGIRQVP 181

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L EAA +FG+TP+Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GLG  V
Sbjct: 182 TDLVEAADSFGSTPWQKLIKLELPTAKNTILAGANQTIMLALSMVVTASMIGAPGLGRGV 241

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           L A+   D+G GF +GL +VILAII+DR         R
Sbjct: 242 LAAVQHADVGSGFVNGLGLVILAIIIDRFTQKLSSNSR 279


>gi|71902822|ref|YP_279625.1| glycine betaine transport system permease protein [Streptococcus
           pyogenes MGAS6180]
 gi|71801917|gb|AAX71270.1| glycine betaine-binding protein [Streptococcus pyogenes MGAS6180]
          Length = 575

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 112/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGVFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   D+G GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADVGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|327459433|gb|EGF05779.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK1]
          Length = 574

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKMGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|324990295|gb|EGC22233.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK353]
          Length = 574

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVESFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|19745348|ref|NP_606484.1| glycine-betaine binding permease protein [Streptococcus pyogenes
           MGAS8232]
 gi|19747452|gb|AAL96983.1| putative glycine-betaine binding permease protein [Streptococcus
           pyogenes MGAS8232]
          Length = 575

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KSATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|270265364|ref|ZP_06193625.1| transporter [Serratia odorifera 4Rx13]
 gi|270040768|gb|EFA13871.1| transporter [Serratia odorifera 4Rx13]
          Length = 375

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +A +P   ++ +    L  +       +   +   +     +L  +P  + + V 
Sbjct: 73  LDPFHKAWVPFDSWVTQGIDWLVLHFRPLFQGIRVPVDFILGGFQQLLLGMPAPIAILVF 132

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   +  S ++   T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A 
Sbjct: 133 SLIAWQIS-SFSMGAATLVSLIAIGAIGAWSQAMVTLALVLTALFFCIVIGLPLGIWLAR 191

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 192 SKHAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 251

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FG++P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 252 VPEDLIEAAESFGSSPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 311

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 312 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 351


>gi|238762666|ref|ZP_04623635.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia kristensenii ATCC 33638]
 gi|238698971|gb|EEP91719.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia kristensenii ATCC 33638]
          Length = 358

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 56  MDPFHNTWVPLDSWVTHGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 115

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 116 ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 174

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 175 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 234

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 235 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 294

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 295 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 334


>gi|325689416|gb|EGD31421.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK115]
          Length = 574

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|324992122|gb|EGC24044.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK405]
          Length = 574

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|325688426|gb|EGD30444.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK72]
          Length = 574

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVESFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|302518088|ref|ZP_07270430.1| glycine betaine ABC transport system permease [Streptomyces sp.
           SPB78]
 gi|302426983|gb|EFK98798.1| glycine betaine ABC transport system permease [Streptomyces sp.
           SPB78]
          Length = 1150

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 108/271 (39%), Positives = 158/271 (58%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            + LGD++      L  N  W  + ++       + V  VL    PL+   ++++L   +
Sbjct: 3   RLHLGDWVDSIVDWLQTNLSWLFDFIATCSKGMYDGVNAVLTAPEPLLLAGILAVLAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +T  V + +G  LI     W+    + +LV+V+T I++ IGVPLG+  A   R  ++
Sbjct: 63  -RGLTAGVLSFVGFALIDSLELWEPAMNSFALVIVATVIALVIGVPLGIWTARSQRASAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD  QT+P  VYLIPA+  FGLG+  GIVATI+F    +VR+T LGI      L E
Sbjct: 122 VRPLLDFTQTMPAMVYLIPAIFFFGLGVPAGIVATIIFGFAPAVRMTELGIRQVDEELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP +    V+LP A+P I+A + Q IML+LSMVV+  +VG+ GLG  V +A+ 
Sbjct: 182 AADAFGTTPRKTLLGVQLPLALPTIMAGVNQVIMLNLSMVVIAGMVGAGGLGGSVYQAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VDIG G E+G+ IV+LAI LDR+ +    +
Sbjct: 242 NVDIGLGSEAGVSIVVLAIFLDRVVAALGQQ 272


>gi|332364432|gb|EGJ42206.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK355]
          Length = 574

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVESFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|28895060|ref|NP_801410.1| glycine-betaine binding permease protein [Streptococcus pyogenes
           SSI-1]
 gi|28810305|dbj|BAC63243.1| putative glycine-betaine binding permease protein [Streptococcus
           pyogenes SSI-1]
          Length = 575

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|327459038|gb|EGF05386.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK1057]
          Length = 574

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|241896063|ref|ZP_04783359.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Weissella paramesenteroides ATCC 33313]
 gi|241870711|gb|EER74462.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Weissella paramesenteroides ATCC 33313]
          Length = 576

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 103/271 (38%), Positives = 163/271 (60%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM- 66
            IP G ++ +    LT++   F   +       ++ +   L  +P  +F+  V++   + 
Sbjct: 10  KIPFGPWVDDGVNWLTKHLSGFFGAIQNGGNAVMDTMTSALTGIPTWLFIVGVTIFAALM 69

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
             +     + T +GL+++  QG W     T +LV++S+ IS+ IGVPLG+  A       
Sbjct: 70  FGKKWGFPLFTFIGLIIVENQGLWTSMMNTFTLVIISSLISVIIGVPLGIWMAKNEVVNK 129

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+  LGI   P  L 
Sbjct: 130 IVQPILDFMQTMPAFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMANLGIRQVPNDLV 189

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T  Q   K+ELP A   I + + QT+ML+LSMVVV +++G+ GLG  VL A+
Sbjct: 190 EAADSFGSTGTQKLFKIELPLAKKTIFSGINQTLMLALSMVVVASMIGAPGLGRGVLAAV 249

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
              DIG+GF +G+ +VILAI++DRL    + 
Sbjct: 250 QDADIGKGFVNGISLVILAIVIDRLTQKINQ 280


>gi|238759169|ref|ZP_04620337.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia aldovae ATCC 35236]
 gi|238702585|gb|EEP95134.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia aldovae ATCC 35236]
          Length = 347

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 45  MDPFHNTWVPLDSWVTHGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 104

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 105 ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 163

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 164 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 223

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 224 VPEDLIEAAESFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 283

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 284 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 323


>gi|327472840|gb|EGF18267.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK408]
          Length = 574

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|283835587|ref|ZP_06355328.1| glycine betaine/L-proline transport system permease protein ProW
           [Citrobacter youngae ATCC 29220]
 gi|291068798|gb|EFE06907.1| glycine betaine/L-proline transport system permease protein ProW
           [Citrobacter youngae ATCC 29220]
          Length = 354

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|325693734|gb|EGD35653.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK150]
          Length = 574

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|225571297|ref|ZP_03780293.1| hypothetical protein CLOHYLEM_07395 [Clostridium hylemonae DSM
           15053]
 gi|225159773|gb|EEG72392.1| hypothetical protein CLOHYLEM_07395 [Clostridium hylemonae DSM
           15053]
          Length = 619

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 104/282 (36%), Positives = 168/282 (59%), Gaps = 3/282 (1%)

Query: 2   SPIIQAPI---PLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVC 58
                 P+   P  D +         +       +  +L   VN   ++L+++P  +F+ 
Sbjct: 329 DWFSGFPLVHKPNTDAIDGAVRSFAVSAAPVLEKIQSLLGGMVNGFKWLLEHIPWFLFLI 388

Query: 59  VVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLA 118
           +V L    V+R +   +  A+ L L+   G+W E   TLS+VL S  +++  G+P+G+L 
Sbjct: 389 LVFLAGWRVRRKLQSGILYAVILCLVGVVGFWDEMILTLSIVLASVVLALLFGLPVGILI 448

Query: 119 AWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGI 178
           +  PR   I+R  LD+MQT+P FVYLIPAL+LFGLG    ++AT++++I   +RLT LGI
Sbjct: 449 SNSPRANRIVRPILDTMQTMPVFVYLIPALLLFGLGNASAVIATVIYAIVPVIRLTSLGI 508

Query: 179 ISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGL 238
                 + EAA +FG+T +Q   KV++P AIP I+  + QT+M++++MVV  +++G+ GL
Sbjct: 509 RQVDTEVVEAARSFGSTRWQTLFKVQIPQAIPTIMTGVNQTLMMAMAMVVTCSMIGARGL 568

Query: 239 GVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           G+ VL A+N  +IGRG  +G C+VILA++LDRL      R++
Sbjct: 569 GMEVLNAVNRTEIGRGLVAGGCVVILAVVLDRLTQGWFGREK 610


>gi|15674389|ref|NP_268563.1| putative glycine-betaine binding permease [Streptococcus pyogenes
           M1 GAS]
 gi|13621479|gb|AAK33284.1| putative glycine-betaine binding permease protein [Streptococcus
           pyogenes M1 GAS]
          Length = 575

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|323128141|gb|ADX25438.1| Glycine betaine-binding protein / Glycine betaine transport system
           permease protein [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 575

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    +T+      ++L  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWITKTFSGLFDVLQAVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
            + +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAAMFFLAKKKWPLPTFTFLGLLFIYNQGLWEQLINTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|332358183|gb|EGJ36013.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK1056]
          Length = 574

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|209558734|ref|YP_002285206.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Streptococcus pyogenes NZ131]
 gi|209539935|gb|ACI60511.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Streptococcus pyogenes NZ131]
          Length = 575

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|328945845|gb|EGG39996.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK1087]
          Length = 574

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVESFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTLIGLLFVYNQGLWENLMSTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|239978546|ref|ZP_04701070.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces albus J1074]
 gi|291450442|ref|ZP_06589832.1| glycine betaine transport system permease [Streptomyces albus
           J1074]
 gi|291353391|gb|EFE80293.1| glycine betaine transport system permease [Streptomyces albus
           J1074]
          Length = 457

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 160/271 (59%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P G+++      L  N  W  + +S ++      +  VL    PL+   + +++   +
Sbjct: 3   RLPFGEWVDSGVDWLQNNLAWLFDAISAVVKGLDTGINAVLTAPEPLLLAGIFAVIAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   V + +G  LII    W +   TLSLVLV+T +++ + VPLG+ AA      ++
Sbjct: 63  -RGLLAGVLSFVGFGLIISMELWDDAMATLSLVLVATLVAIVLSVPLGIWAARSRTVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYL+PA++ FGLG  PGIVATI+F++P  VR+T LGI      L E
Sbjct: 122 LRPVLDFMQTMPGMVYLLPAVIFFGLGAAPGIVATIIFAMPPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+  I+A + Q IML LSMVV+  +VG+ GLG  V   ++
Sbjct: 182 AAEAFGTTPRNTLLRVQLPLALSTIMAGVNQVIMLGLSMVVIAGMVGAAGLGSSVYEGIS 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ++IG GFE+G+ IVILAI LDRL S    +
Sbjct: 242 QLNIGLGFEAGVSIVILAIYLDRLTSGLGQQ 272


>gi|322412777|gb|EFY03685.1| Glycine betaine-binding protein / Glycine betaine transport system
           permease protein [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 575

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 171/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    +T+      ++L  +    ++ +   L ++ PL F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWITKTFSGLFDVLQAVGSFLMDWMTKTLLFIHPLFFIVLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
            + +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAAMFFLAKKKWPLPTFTFLGLLFIYNQGLWEQLINTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|238790131|ref|ZP_04633908.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia frederiksenii ATCC 33641]
 gi|238721800|gb|EEQ13463.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia frederiksenii ATCC 33641]
          Length = 357

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  + + V 
Sbjct: 55  MDPFHTTWLPLDSWVTHGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPIAILVF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 115 ALIAWQFS-TLGMGVATLVSLVAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLAAVGGMGIVILAIILDRLTQSLGRDRR 333


>gi|327468560|gb|EGF14039.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK330]
          Length = 574

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|83593811|ref|YP_427563.1| binding-protein dependent transport system inner membrane protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83576725|gb|ABC23276.1| Binding-protein-dependent transport systems inner membrane
           component [Rhodospirillum rubrum ATCC 11170]
          Length = 357

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 105/275 (38%), Positives = 160/275 (58%), Gaps = 1/275 (0%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
            P  +  IPL D+  +    L  +       + + +   +  +   L  +PP V + +++
Sbjct: 39  DPFARPLIPLDDWTNQGLDWLVLSFRPLFQAIRWPIDAVLTALNGTLVGVPPPVMLAIIA 98

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
           LL   +     +A+G+ + + LI   G W E   TLSLVL S    + +G+P G+L A  
Sbjct: 99  LLAWQIAGR-KMAIGSLISMTLIGLIGAWSEAMLTLSLVLTSVMFCIALGLPSGILMARS 157

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R   + R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI   
Sbjct: 158 DRLAKLSRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPLIRLTNLGIRQV 217

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EAA +FGA+  Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG  
Sbjct: 218 PEDLVEAARSFGASKTQLLTKVQLPLALPTIMAGINQTLMLALSMVVIASMIAVGGLGQM 277

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           VLR +  +D+G     G+ IV+LAI++DRL     
Sbjct: 278 VLRGIGRLDMGLATVGGVAIVLLAILIDRLTQSMG 312


>gi|221068270|ref|ZP_03544375.1| binding-protein-dependent transport systems inner membrane
           component [Comamonas testosteroni KF-1]
 gi|220713293|gb|EED68661.1| binding-protein-dependent transport systems inner membrane
           component [Comamonas testosteroni KF-1]
          Length = 414

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 161/277 (58%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    +P+ D +      +  +   F   +   +   +N V  VLQ +P    V +++LL
Sbjct: 100 ITTEGLPVQDSINNGLTWVVDHFRPFFQAVRTPIDATLNGVTDVLQTIPMPALVLLIALL 159

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+G+A+ LL +   G W E   TL+LVL S F  + IG+P+G+L A    
Sbjct: 160 AWQFAGR-KLAIGSAVALLCVALLGIWSEAMVTLALVLTSLFFCIAIGLPVGILLASSDL 218

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
                R FLD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  +RLT LGI    P
Sbjct: 219 AQRWTRPFLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLIRLTNLGIRQVRP 278

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 279 DLIEASRAYGASPAQLLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 338

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI+LDR+        R
Sbjct: 339 RGIGRLDMGLATVGGLGIVLLAIVLDRITQAMGESKR 375


>gi|327490635|gb|EGF22416.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK1058]
          Length = 574

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTFLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|297161909|gb|ADI11621.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces bingchenggensis BCW-1]
          Length = 874

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 111/271 (40%), Positives = 164/271 (60%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            I LG +++     L  + +W  + +S ++    + V  VL    PL+   ++++L   +
Sbjct: 3   RIELGSWIRSGINFLRDHFQWLFDFISKVVQGMYDGVHDVLAAPNPLLLAGILAVLAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  AV    G  LI     W E  ETLSLVLV+  I++ + VPLG+ A+      ++
Sbjct: 63  -RGLVPAVLAFAGFALIDSIEQWDEAMETLSLVLVAGAITIVLAVPLGIWASRNRAVSAL 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIP +  FG+G+VPG++ATIVF++P  VR+T LGI      L E
Sbjct: 122 LRPVLDFMQTMPAFVYLIPGIFFFGVGVVPGVIATIVFAMPPGVRMTELGIRQVDAELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP +   +V+LP A+P I+A + Q IML+LSMVV+  +VG  GLG  V  A++
Sbjct: 182 AADAFGTTPRRTLLRVQLPLALPTIMAGVNQAIMLALSMVVIAGMVGGGGLGSSVFEAIS 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           +VD+  GFE G+ +VILA+ LDR+    + R
Sbjct: 242 SVDVALGFEGGIAVVILAMYLDRMTGALNQR 272


>gi|251783394|ref|YP_002997699.1| glycine betaine-binding protein/glycinebetaine transport system
           permease [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|242392026|dbj|BAH82485.1| glycine betaine-binding protein/glycinebetaine transport system
           permease protein [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 575

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    +T+      ++L  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWITKTFSGLFDVLQAVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
            + +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAAMFFLAKKKWPLPTFTFLGLLFIYNQGLWEQLINTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  ++   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQVVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|237729637|ref|ZP_04560118.1| glycine betaine transporter membrane protein [Citrobacter sp. 30_2]
 gi|226908243|gb|EEH94161.1| glycine betaine transporter membrane protein [Citrobacter sp. 30_2]
          Length = 354

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|323353440|ref|ZP_08087973.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           VMC66]
 gi|322121386|gb|EFX93149.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           VMC66]
          Length = 574

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 176/278 (63%), Gaps = 2/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+
Sbjct: 1   MD-ILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVI 59

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++   ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A
Sbjct: 60  TIFTYLISKRKLGLPLLTLLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMA 119

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 120 KSNRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 179

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG
Sbjct: 180 QIPTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLG 239

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 240 RGVLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|315181935|gb|ADT88848.1| glycine betaine/L-proline transport system permease [Vibrio
           furnissii NCTC 11218]
          Length = 368

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 104/280 (37%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P   A +P   +++     L  +G      +   +   ++     L   P  + + ++
Sbjct: 55  MHPFQDAILPFDSWVETALNWLVTHGRPLFQAIRVPIDFILSSFQTALVSTPAPIMLLIL 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+   +  S  + + + + L++I   G W +   TL+LV+ S F  + IG+PLG+  A 
Sbjct: 115 FLIAWQLAGS-RMGIASFLSLMVIGLIGAWDQAMVTLALVMTSVFFCLLIGMPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SDTAAKIVRPVLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIQQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+P Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 234 VPEELIEAGHAFGASPKQMLYRIQLPLAMPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IVILAI+LDR+        R
Sbjct: 294 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQTIGANSR 333


>gi|332363182|gb|EGJ40967.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, membrane protein [Streptococcus sanguinis
           SK49]
          Length = 574

 Score =  169 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDAFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A  
Sbjct: 62  FTYLISKRKLGLPLLTLLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|320539493|ref|ZP_08039162.1| putative glycine betaine transporter subunit [Serratia symbiotica
           str. Tucson]
 gi|320030618|gb|EFW12628.1| putative glycine betaine transporter subunit [Serratia symbiotica
           str. Tucson]
          Length = 349

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     +PLG ++ +    L  +       +   +   +N    +L  +P  + + + 
Sbjct: 47  LDPFHNTWLPLGSWVTQGIDWLVLHFRPLFQGIRVPVDYILNGFQHLLLGMPASIAIVLF 106

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+   V  S+ +   T + L+ I   G W +   TL+LVL +    + IG+PLG   + 
Sbjct: 107 SLIAWQVA-SVGMGALTLVSLIAIGAIGAWSQAMVTLALVLTALLFCIAIGLPLGTWLSR 165

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 +IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VR+T LGI  
Sbjct: 166 SKHAAKVIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRMTILGINQ 225

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+  + QT+ML+LSMVV+ +++   GLG 
Sbjct: 226 VPEELIEAAQSFGASPRQLLFKVQLPLAMPTIMVGVNQTLMLALSMVVIASMIAVGGLGQ 285

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 286 IVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 325


>gi|238755713|ref|ZP_04617047.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia ruckeri ATCC 29473]
 gi|238706080|gb|EEP98463.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia ruckeri ATCC 29473]
          Length = 360

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  + + V 
Sbjct: 58  MDPFHNTWVPLDSWVTHGIDWVVLHFRPVFQGIRVPVDFILSGFQHMLLGMPAPIAILVF 117

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 118 ALIAWQFS-TLGMGVATLVSLVAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 176

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 177 SNNAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 236

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 237 VPADLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 296

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 297 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 336


>gi|117619242|ref|YP_857864.1| glycine betaine/L-proline ABC transporter, permease protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560649|gb|ABK37597.1| glycine betaine/L-proline ABC transporter, permease protein
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 383

 Score =  169 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 169/280 (60%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  QA +PL  +++     L  N      ++   +  A+  +  +LQ +P  + + ++
Sbjct: 73  LDPFQQALVPLDSWVEGGIGWLVDNLRPVFQLIRAPVELALGGMTHLLQTVPSTLMIGLL 132

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  +  +A+GT   L+++   G W +   TLSLVL S F  + IG+P+G+L A 
Sbjct: 133 TLIAWQLV-NGRMALGTLFSLVVVGLIGAWSDAMVTLSLVLTSLFFCVLIGLPVGILLAR 191

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R     R  LD+MQT P FVYLIP ++LFG+G VPG+V T++F++P  +RLT LGI  
Sbjct: 192 SERLSRWTRPLLDAMQTTPAFVYLIPIVMLFGIGNVPGVVVTVIFALPPMIRLTMLGIRQ 251

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 252 VPADLVEAAHSFGASPSQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 311

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IV+LAI+LDRL       DR
Sbjct: 312 MVLRGIGRLDMGLASIGGLGIVLLAIVLDRLTQAMGQPDR 351


>gi|315641134|ref|ZP_07896213.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus italicus DSM 15952]
 gi|315483142|gb|EFU73659.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Enterococcus italicus DSM 15952]
          Length = 579

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 111/278 (39%), Positives = 169/278 (60%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MS  +Q  IP+ ++++     +T        ++       +N    VL  + PLV + VV
Sbjct: 1   MSNFLQQAIPVANWVERATNWVTNTFSGLFQVIQDSGSSVMNGFTDVLMMIHPLVLILVV 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           SL+  ++  +   + + + +GLL I  Q  W +   T++LV+VS+ +S+ IGVPLG+  A
Sbjct: 61  SLIAFIISGKKWGLVLFSLIGLLYIYNQNLWSDLMSTVTLVIVSSVVSIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              R   II+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSDRAEKIIQPILDFMQTMPGFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ +FG+T  Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG
Sbjct: 181 QIPKELVEASDSFGSTGKQRLFKLELPLAKSTILAGINQTTMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL    +G GF +GL +VILAI++DR   + + 
Sbjct: 241 RGVLSALQHAQVGNGFVNGLALVILAIVMDRFTQLINK 278


>gi|238794435|ref|ZP_04638045.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia intermedia ATCC 29909]
 gi|238726230|gb|EEQ17774.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia intermedia ATCC 29909]
          Length = 347

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  + + V 
Sbjct: 45  MDPFHNTWVPLDSWVTHGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPIAILVF 104

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+P+G+  A 
Sbjct: 105 ALIAWQFS-TLGMGVATLISLVAIGAIGAWSQAMVTLALVLTSLFFCILIGLPMGIWLAR 163

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 164 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 223

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 224 VPEDLIEAAESFGANPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 283

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 284 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 323


>gi|294628454|ref|ZP_06707014.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces sp. e14]
 gi|292831787|gb|EFF90136.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces sp. e14]
          Length = 871

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 103/269 (38%), Positives = 151/269 (56%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD++      L  +  W  +    +   A + +  VLQ   PL+   + ++L   +
Sbjct: 3   RIPLGDWVNSAVDWLLDHMAWLFDFFKTVFTGAYDGINTVLQAPEPLLLAGIFAVLAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     V T +G   I     W +   TLSLVLV+T I++ + VP+G+ AA   R  ++
Sbjct: 63  -RGSLAGVLTFVGFAFIDSMELWPDAMVTLSLVLVATLIALVVSVPVGIWAARSDRVGAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G   GIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTLPAMIYLIPAILFFGTGASAGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG  P     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V  A+ 
Sbjct: 182 AAEAFGTNPRDTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGDVNEAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            +++G G E+G+ IVILAI LDR+     
Sbjct: 242 QLNVGLGSEAGVAIVILAIYLDRMTGALG 270


>gi|118589797|ref|ZP_01547202.1| glycine betaine/l-proline transport system permease protein prow
           [Stappia aggregata IAM 12614]
 gi|118437883|gb|EAV44519.1| glycine betaine/l-proline transport system permease protein prow
           [Stappia aggregata IAM 12614]
          Length = 281

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 157/276 (56%), Positives = 205/276 (74%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  IP+G + +     LT N  W  + +S  LL  ++ +L+VLQ  PPLV V + 
Sbjct: 1   MEWLTEQKIPIGSWAKAGVDWLTDNAYWLFDGISAFLLTIIDGILWVLQAPPPLVMVAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L   V R+IT A   A+ LLLII QGYW+ETTETL+LV+ ST + M IGVP+GV+AA 
Sbjct: 61  VALAYFVHRTITFAALVAIALLLIINQGYWEETTETLALVMASTIVCMAIGVPIGVVAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           +PR Y+++R  LD MQT+PTFVYLIPAL+LFGLGMVPG++AT++FSIP  +RLT+LG+ S
Sbjct: 121 HPRVYAVLRPVLDLMQTLPTFVYLIPALILFGLGMVPGLIATVIFSIPAPIRLTQLGVSS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGAT  Q+  K+ELP+A+PQI+A LTQTIMLSLSMVV+ ALV ++GLGV
Sbjct: 181 TPTSLLEAGKAFGATNSQLLWKIELPYALPQIMAGLTQTIMLSLSMVVIAALVAADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           PVLRALNT ++  GFE+G+CIV++AI+LDR F  P 
Sbjct: 241 PVLRALNTANVALGFEAGVCIVLIAIVLDRFFRAPS 276


>gi|82778052|ref|YP_404401.1| glycine betaine transporter membrane protein [Shigella dysenteriae
           Sd197]
 gi|309786249|ref|ZP_07680877.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella dysenteriae 1617]
 gi|81242200|gb|ABB62910.1| high-affinity transport system for glycine betaine and proline
           [Shigella dysenteriae Sd197]
 gi|308925994|gb|EFP71473.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella dysenteriae 1617]
          Length = 354

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLSMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLPLVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTITFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|262281922|ref|ZP_06059691.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
 gi|262262376|gb|EEY81073.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA]
          Length = 574

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 115/276 (41%), Positives = 175/276 (63%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+++
Sbjct: 2   NILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQTIGNAIMNGMTDTLLFIPPLLFIAVITI 61

Query: 63  LVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
              ++  R + + + T +GLL +  QG W+    T++LV++S+ IS+ IG+PLG+  A  
Sbjct: 62  FTCLISKRKLGLPLLTLLGLLFVYNQGLWENLMNTVTLVIISSAISIVIGIPLGIWMAKS 121

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   
Sbjct: 122 NRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRQI 181

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG  
Sbjct: 182 PTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLGRG 241

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 242 VLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|125717254|ref|YP_001034387.1| glycine/betaine ABC transporter permease [Streptococcus sanguinis
           SK36]
 gi|125497171|gb|ABN43837.1| ABC transporter, glycine-betaine/proline permease protein, putative
           [Streptococcus sanguinis SK36]
          Length = 574

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 116/278 (41%), Positives = 175/278 (62%), Gaps = 2/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q PIP+  +++ F   +T       ++L  I    +N +   L ++PPL+F+ V+
Sbjct: 1   MD-ILQQPIPVSQWVEAFTNWVTDTFSGLFSVLQAIGNAIMNGMTDTLLFIPPLLFIAVI 59

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++   ++  R + + + T +GLL +  QG W+    T++LV+VS+ IS+ IG+PLG+  A
Sbjct: 60  TIFTYLISKRKLGLPLLTLLGLLFVYNQGLWENLMNTVTLVIVSSAISIIIGIPLGIWMA 119

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              R  ++I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 120 KSNRVEAVIKPLLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 179

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EA+ +FG T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG
Sbjct: 180 QISTELIEASDSFGGTGKQKLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLG 239

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL AL   DIG GF +G+ +VILAII+DRL    + 
Sbjct: 240 RGVLSALQHADIGSGFVNGVSLVILAIIIDRLTQKLNQ 277


>gi|260769404|ref|ZP_05878337.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio furnissii CIP 102972]
 gi|260614742|gb|EEX39928.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio furnissii CIP 102972]
          Length = 368

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 104/280 (37%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P   A +P   +++     L  +G      +   +   ++     L   P  + + ++
Sbjct: 55  MHPFQDAILPFDSWVETALNWLVTHGRPLFQAIRVPIDFILSSFQTALVSTPAPIMLLIL 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+   +  S  + + + + L++I   G W +   TL+LV+ S F  + IG+PLG+  A 
Sbjct: 115 FLIAWQLAGS-RMGIASFLSLMVIGLIGAWDQAMVTLALVMTSVFFCLLIGMPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SDTAAKIVRPILDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIQQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+P Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 234 VPEELIEAGHAFGASPKQMLYRIQLPLAMPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IVILAI+LDR+        R
Sbjct: 294 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQTIGANSR 333


>gi|301159375|emb|CBW18893.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|323131166|gb|ADX18596.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
          Length = 354

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V   + + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSG-VGMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|260869357|ref|YP_003235759.1| high-affinity transport system for glycine betaine and proline,
           membrane component [Escherichia coli O111:H- str. 11128]
 gi|257765713|dbj|BAI37208.1| high-affinity transport system for glycine betaine and proline,
           membrane component [Escherichia coli O111:H- str. 11128]
 gi|323180099|gb|EFZ65651.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 1180]
          Length = 354

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIDAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|85704303|ref|ZP_01035406.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseovarius sp. 217]
 gi|85671623|gb|EAQ26481.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseovarius sp. 217]
          Length = 278

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 143/278 (51%), Positives = 192/278 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G + + FF+ L  N   F + L+ ++   ++  L+VLQ   PLV + V 
Sbjct: 1   MDWLSDHKIPVGKWAEGFFLWLQDNAAGFFDALAALMEGLIDAFLWVLQTPHPLVIIGVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L   ++RS    +   +G L I+ QGYW+ETTE+L+LV+ S    M +GVPLG+ AA 
Sbjct: 61  VALTWALQRSWKTCLFVILGFLFILNQGYWEETTESLTLVISSCIFCMALGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +R  LD MQT+P FVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI +
Sbjct: 121 RPRLYDGMRPVLDLMQTLPPFVYLIPAIVFFGIGMVPGLIATVIFVVPAPIRLTHLGISN 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q   KVELP+A+PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPQPLLEAAQAFGATNSQTLWKVELPYALPQIMAGLNQTIMLSLSMVVIGALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PVLRA+NTV+I  GFESGL IV++AI+LDR+  +   +
Sbjct: 241 PVLRAINTVNIALGFESGLMIVVVAIVLDRMLRMEGRK 278


>gi|161615705|ref|YP_001589670.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161365069|gb|ABX68837.1| hypothetical protein SPAB_03490 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 354

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|312865610|ref|ZP_07725835.1| ABC transporter, substrate-binding protein, QAT family
           [Streptococcus downei F0415]
 gi|311098878|gb|EFQ57097.1| ABC transporter, substrate-binding protein, QAT family
           [Streptococcus downei F0415]
          Length = 575

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 110/268 (41%), Positives = 162/268 (60%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+ +Y+  F   LT+      ++L  I    +  +   L ++ P + + ++  L  ++
Sbjct: 11  KLPISNYMDSFVDWLTKTFSGLFSVLKIIGDGLMGFISSTLTFINPWILMLLIVALAYLI 70

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +  +  + TA+GLL I  Q  W +   T +LVL+S+ IS+ IG+PLG+  A       +
Sbjct: 71  SKKWSFTILTAIGLLYIYNQELWGDLINTFTLVLLSSLISILIGIPLGIWMAKNETAKKV 130

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR+T LGI   P  L E
Sbjct: 131 INPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRMTNLGIREIPTELVE 190

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFG+T  Q    VELP A   I+A + QTIMLSLSMVV  +++G+ GLG  VL AL 
Sbjct: 191 ASDAFGSTSQQKLFGVELPLAKNTIMAGINQTIMLSLSMVVTASMIGAPGLGNGVLSALQ 250

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIP 275
             +IG GF +GL +VILAII+DR     
Sbjct: 251 HAEIGNGFVNGLALVILAIIIDRFTQKL 278


>gi|260426263|ref|ZP_05780242.1| choline ABC transporter, permease protein [Citreicella sp. SE45]
 gi|260420755|gb|EEX14006.1| choline ABC transporter, permease protein [Citreicella sp. SE45]
          Length = 278

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 138/278 (49%), Positives = 192/278 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  IP+GD     F  +  NGE+  + +S  +   ++ +L++LQ  P L+ +   
Sbjct: 1   MEWLTEYKIPVGDAASAVFEWIRDNGEFVLDAMSTFMEGMIDGILWILQEPPELIVILAF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             +   ++R+   A+    G L I+ Q YW+ETTE+L+LVL S  + M IGVP+G+ AA 
Sbjct: 61  VAITYALQRNWKTALFVFAGFLFILNQDYWEETTESLTLVLSSCLVCMAIGVPIGIYAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P+ Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LG+ S
Sbjct: 121 RPKLYTYLRPILDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTYLGVSS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q   KVELP+A+PQI+A L QTIMLSLSMVVV ALVG++GLGV
Sbjct: 181 TPKPLLEAATAFGATSSQTLFKVELPYAVPQIMAGLNQTIMLSLSMVVVAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+RALN V+ G GFESG  IV++AI+LDR+ ++   +
Sbjct: 241 PVVRALNQVNTGLGFESGFVIVVVAIMLDRILNVGGRK 278


>gi|319794068|ref|YP_004155708.1| binding-protein-dependent transport systems inner membrane
           component [Variovorax paradoxus EPS]
 gi|315596531|gb|ADU37597.1| binding-protein-dependent transport systems inner membrane
           component [Variovorax paradoxus EPS]
          Length = 389

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 161/277 (58%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    +P+  ++ +    + ++   F   +   +   +N V  +L  LP L  + ++ L 
Sbjct: 74  LWDGTLPVESWINQGLGWVVEHFRPFFQTVRLPIDSTLNWVQGLLTGLPTLAMIALIGLF 133

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+GT + LLL+   G W E   TLSLVL S    M IG+PLGVL A   R
Sbjct: 134 AWQFAGRA-LAIGTTVALLLVAMLGIWPEAMVTLSLVLTSLVFCMVIGLPLGVLLASSDR 192

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
              ++R  LD+MQT P FVYL+P ++LFG+G VPG++ TI+F++   VRLT LG+    P
Sbjct: 193 AQRVMRPVLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIIFALAPLVRLTNLGLRQVRP 252

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA A+GA+P+Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 253 DLIEAARAYGASPWQMLVKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 312

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI LDRL        R
Sbjct: 313 RGIGRLDMGLATVGGLGIVLLAISLDRLTQAMGKSRR 349


>gi|82545240|ref|YP_409187.1| glycine betaine transporter membrane protein [Shigella boydii
           Sb227]
 gi|81246651|gb|ABB67359.1| ProW [Shigella boydii Sb227]
 gi|332092004|gb|EGI97082.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella boydii 3594-74]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPSIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|126667736|ref|ZP_01738704.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Marinobacter sp. ELB17]
 gi|126627839|gb|EAZ98468.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Marinobacter sp. ELB17]
          Length = 282

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 132/279 (47%), Positives = 180/279 (64%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MS I +  +P GD+++     L  N   F + +S  L   ++ +   L ++PP   + ++
Sbjct: 1   MSWITEHQLPFGDFVEGIVDFLVVNFSGFFDAVSDTLSSMIHGLTGALLWVPPGALILLL 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           ++   +  R   +   TA   LLI   GYW++T  TLSLVL +T + + IG+PLG+ AA 
Sbjct: 61  TVAAHLRHRRWGLTAFTAFSFLLIWNIGYWEDTMATLSLVLYATLLCVVIGIPLGIYAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               Y  ++  LD MQTIP FVYLIP L LFGLG+VPG+++T++F+I   VRLT LGI  
Sbjct: 121 SRWLYKFLQPVLDLMQTIPPFVYLIPTLTLFGLGVVPGVISTVIFAIAAPVRLTHLGISQ 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFG T  Q+  KVELP A+  I A +TQ IMLSLSMVV+ ALVG++GLGV
Sbjct: 181 VPKELVEAGKAFGCTNRQLLFKVELPAAMSSIGAGITQCIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTVDIG+GFE+GL IV+LAI +DR F   D ++
Sbjct: 241 PVVRALNTVDIGKGFEAGLAIVLLAIWMDRFFRQSDAKE 279


>gi|16766121|ref|NP_461736.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167992531|ref|ZP_02573629.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168262082|ref|ZP_02684055.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168464070|ref|ZP_02697987.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197264631|ref|ZP_03164705.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|198245962|ref|YP_002216786.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200386810|ref|ZP_03213422.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205353760|ref|YP_002227561.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207858079|ref|YP_002244730.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|20141693|sp|P17327|PROW_SALTY RecName: Full=Glycine betaine/L-proline transport system permease
           protein proW
 gi|16421359|gb|AAL21695.1| glycine/betaine/proline transport protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|195633315|gb|EDX51729.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197242886|gb|EDY25506.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197940478|gb|ACH77811.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199603908|gb|EDZ02453.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205273541|emb|CAR38527.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205329315|gb|EDZ16079.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205349121|gb|EDZ35752.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206709882|emb|CAR34235.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|261247951|emb|CBG25784.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267994926|gb|ACY89811.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|312913833|dbj|BAJ37807.1| glycine betaine ABC transporter permease protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321223607|gb|EFX48672.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|326624544|gb|EGE30889.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326628868|gb|EGE35211.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332989687|gb|AEF08670.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|320186469|gb|EFW61197.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Shigella flexneri CDC 796-83]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    VL  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQVLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPSIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|156932792|ref|YP_001436708.1| glycine betaine transporter membrane protein [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156531046|gb|ABU75872.1| hypothetical protein ESA_00588 [Cronobacter sakazakii ATCC BAA-894]
          Length = 356

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 56  MDPFHNTLIPLDRWVTEGIDWVVTHFRPLFQGIRVPVDYILNAFQQLLLGMPAPVAIILF 115

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+LI   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 116 ALIAWQISGV-GMGVATLVSLILIGAIGAWSQAMVTLALVLTALLFCVVIGLPLGIWLAR 174

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 175 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVVRLTILGINQ 234

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FG++P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 235 VPEDLIEAARSFGSSPRQMLFKVQLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 294

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 295 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDAR 334


>gi|56414768|ref|YP_151843.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363696|ref|YP_002143333.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|56129025|gb|AAV78531.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197095173|emb|CAR60723.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|323173039|gb|EFZ58670.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli LT-68]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPVIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|193071017|ref|ZP_03051945.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli E110019]
 gi|192955675|gb|EDV86150.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli E110019]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|320173466|gb|EFW48665.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Shigella dysenteriae CDC 74-1112]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTTLLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|157159068|ref|YP_001463988.1| glycine betaine transporter membrane protein [Escherichia coli
           E24377A]
 gi|187731166|ref|YP_001881570.1| glycine betaine transporter membrane protein [Shigella boydii CDC
           3083-94]
 gi|191167100|ref|ZP_03028921.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli B7A]
 gi|209920122|ref|YP_002294206.1| glycine betaine transporter membrane protein [Escherichia coli
           SE11]
 gi|218555226|ref|YP_002388139.1| glycine betaine transporter membrane protein [Escherichia coli
           IAI1]
 gi|218696275|ref|YP_002403942.1| glycine betaine transporter membrane protein [Escherichia coli
           55989]
 gi|260856789|ref|YP_003230680.1| high-affinity transport system for glycine betaine and proline,
           membrane component [Escherichia coli O26:H11 str. 11368]
 gi|293448996|ref|ZP_06663417.1| glycine betaine transporter membrane protein [Escherichia coli
           B088]
 gi|300815919|ref|ZP_07096143.1| ABC transporter, permease protein [Escherichia coli MS 107-1]
 gi|300916826|ref|ZP_07133530.1| ABC transporter, permease protein [Escherichia coli MS 115-1]
 gi|309795137|ref|ZP_07689556.1| ABC transporter, permease protein [Escherichia coli MS 145-7]
 gi|331678656|ref|ZP_08379330.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli H591]
 gi|157081098|gb|ABV20806.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli E24377A]
 gi|187428158|gb|ACD07432.1| glycine betaine/L-proline ABC transporter, permease protein
           [Shigella boydii CDC 3083-94]
 gi|190902882|gb|EDV62610.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli B7A]
 gi|209913381|dbj|BAG78455.1| glycine/betaine/proline ABC transporter permease component
           [Escherichia coli SE11]
 gi|218353007|emb|CAU98825.1| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli 55989]
 gi|218361994|emb|CAQ99600.1| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli IAI1]
 gi|257755438|dbj|BAI26940.1| high-affinity transport system for glycine betaine and proline,
           membrane component [Escherichia coli O26:H11 str. 11368]
 gi|291322086|gb|EFE61515.1| glycine betaine transporter membrane protein [Escherichia coli
           B088]
 gi|300415892|gb|EFJ99202.1| ABC transporter, permease protein [Escherichia coli MS 115-1]
 gi|300531848|gb|EFK52910.1| ABC transporter, permease protein [Escherichia coli MS 107-1]
 gi|308121108|gb|EFO58370.1| ABC transporter, permease protein [Escherichia coli MS 145-7]
 gi|320198430|gb|EFW73032.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Escherichia coli EC4100B]
 gi|323154889|gb|EFZ41081.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli EPECa14]
 gi|323183204|gb|EFZ68601.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 1357]
 gi|323946350|gb|EGB42379.1| inner membrane transport system [Escherichia coli H120]
 gi|324020307|gb|EGB89526.1| ABC transporter, permease protein [Escherichia coli MS 117-3]
 gi|324120037|gb|EGC13914.1| inner membrane transport system [Escherichia coli E1167]
 gi|331073486|gb|EGI44807.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli H591]
          Length = 354

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|62181314|ref|YP_217731.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|168244607|ref|ZP_02669539.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168822875|ref|ZP_02834875.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194449937|ref|YP_002046773.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197247835|ref|YP_002147710.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|204929493|ref|ZP_03220567.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|224584594|ref|YP_002638392.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238909581|ref|ZP_04653418.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|62128947|gb|AAX66650.1| ABC superfamily (membrane), glycine/betaine/proline transport
           protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194408241|gb|ACF68460.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|197211538|gb|ACH48935.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|204321212|gb|EDZ06412.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205336554|gb|EDZ23318.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205340771|gb|EDZ27535.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|224469121|gb|ACN46951.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|320087216|emb|CBY96982.1| Glycine betaine/L-proline transport system permease protein proW
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|322614366|gb|EFY11297.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322621569|gb|EFY18422.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322624430|gb|EFY21263.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626628|gb|EFY23433.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322633512|gb|EFY30254.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322638445|gb|EFY35143.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322639748|gb|EFY36432.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322643794|gb|EFY40344.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649480|gb|EFY45914.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655930|gb|EFY52230.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322661325|gb|EFY57550.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662523|gb|EFY58731.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666897|gb|EFY63072.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671267|gb|EFY67390.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322677726|gb|EFY73789.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322681447|gb|EFY77477.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322683846|gb|EFY79856.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322715800|gb|EFZ07371.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323193765|gb|EFZ78968.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323197447|gb|EFZ82584.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203262|gb|EFZ88291.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323205208|gb|EFZ90183.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323212779|gb|EFZ97590.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323218079|gb|EGA02791.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323221658|gb|EGA06071.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323225126|gb|EGA09377.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230842|gb|EGA14960.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323234807|gb|EGA18893.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238846|gb|EGA22896.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323241546|gb|EGA25577.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323248307|gb|EGA32243.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252927|gb|EGA36761.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323256951|gb|EGA40660.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323260574|gb|EGA44185.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323264368|gb|EGA47874.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323269502|gb|EGA52955.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 354

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|332638601|ref|ZP_08417464.1| ABC-type proline/glycine betaine transport system, permease
           component [Weissella cibaria KACC 11862]
          Length = 572

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 108/273 (39%), Positives = 165/273 (60%), Gaps = 1/273 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           ++   IP+  +++     LT N   F + +       +N +   L  +P    +  V++ 
Sbjct: 3   LLIGKIPVAGWVESAVNWLTSNLSGFFDAIQTGGNHLMNGMTNGLIAMPSWAVIIGVTIF 62

Query: 64  VLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
            ++   +    A  T +GLL I  Q  W +   TL+LV+VS+ +S+ IGVPLG+  A   
Sbjct: 63  AILSSGKKWGFAAFTFLGLLFIANQNLWSDLMNTLTLVVVSSLVSIVIGVPLGIWMAKKE 122

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
               I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR++ LGI   P
Sbjct: 123 TVAKIVQPVLDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMSNLGIRQVP 182

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L EAA ++G+TP Q   K+ELP A   I+A + QTIML+LSMVV+ +++G+ GLG  V
Sbjct: 183 KDLVEAADSYGSTPKQKLFKLELPLATGTILAGINQTIMLALSMVVIASMIGAPGLGRGV 242

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           L A+   DIG+GF +GL +VILAII+DR     
Sbjct: 243 LSAVQNADIGKGFVNGLALVILAIIIDRFTQKL 275


>gi|317491340|ref|ZP_07949776.1| inner membrane binding protein [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920887|gb|EFV42210.1| inner membrane binding protein [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 368

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +P   ++      L  +G      +   +   ++    +LQ +P  + + V 
Sbjct: 66  MDPFHHTWVPFDSWVTHGIDWLVSHGRPVFQGIRMPVDFVLSGFQNILQGMPAPIAILVF 125

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+         +   T +GL+ I   G W +   TL+LVL S F  M IG+PLG+  A 
Sbjct: 126 ALIAWQCAGL-GMGAATLIGLVAIGAIGAWSQAMVTLALVLTSLFFCMLIGLPLGIWLAR 184

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 +IR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 185 SKGAARVIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTSLGIQQ 244

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FG++P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 245 VPADLIEAAESFGSSPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 304

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 305 MVLRGIGRLDMGLASIGGVGIVILAIILDRLTQSVGRDRR 344


>gi|254472399|ref|ZP_05085799.1| choline ABC transporter, permease protein [Pseudovibrio sp. JE062]
 gi|211958682|gb|EEA93882.1| choline ABC transporter, permease protein [Pseudovibrio sp. JE062]
          Length = 281

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 148/278 (53%), Positives = 206/278 (74%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  +P+G + + +   LT N   F + +S  +   ++ VL++LQ   PL  V + 
Sbjct: 1   MEWLTEHKLPIGKWAKWYVDWLTDNASGFFDAISVAIEWLIDSVLWLLQAPHPLGIVVIA 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L  +V+RS+  +V  A+ LLLII QGYW ETTETL+L+L STFI M IG+P+GV +A 
Sbjct: 61  TGLAFVVRRSVMFSVFVALSLLLIINQGYWDETTETLALILSSTFICMLIGIPVGVYSAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           +P+F+S +R  LD MQTIPTFVYLIPAL+LFGLG+VPG+++T+VF++P S+RLT++G+ S
Sbjct: 121 HPKFFSWVRPVLDLMQTIPTFVYLIPALILFGLGVVPGLISTVVFALPASIRLTQIGVAS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGAT +Q   K+ELP+A+P I+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKHLLEAGEAFGATYWQKLFKIELPYALPNIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           P LRALNTV+I +GFE G+ IV++AI+LDR F   + +
Sbjct: 241 PTLRALNTVNIAKGFEVGIAIVLVAIVLDRFFKSSEDK 278


>gi|239815502|ref|YP_002944412.1| binding-protein-dependent transport systems inner membrane
           component [Variovorax paradoxus S110]
 gi|239802079|gb|ACS19146.1| binding-protein-dependent transport systems inner membrane
           component [Variovorax paradoxus S110]
          Length = 383

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 111/277 (40%), Positives = 160/277 (57%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    +P+  ++ +    + ++   F   L   +   +N V  +L  LP L  + ++ L 
Sbjct: 64  LWDGSLPVESWINQGLGWVVEHFRPFFQTLRLPIDSTLNWVQGLLTGLPTLAMIALIGLF 123

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+GT   LLL+   G W E   TLSLVL S    M IG+PLGVL A   R
Sbjct: 124 AWQFAGRA-LAIGTTAALLLVAMLGIWPEAMVTLSLVLTSLVFCMIIGLPLGVLLASSDR 182

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
              ++R  LD+MQT P FVYL+P ++LFG+G VPG++ TI+F++   VRLT LG+    P
Sbjct: 183 AQRLMRPVLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIIFALAPLVRLTNLGLRQVRP 242

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA A+GA+P+Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 243 DLIEAARAYGASPWQMLVKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 302

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI LDRL        R
Sbjct: 303 RGIGRLDMGLATVGGLGIVLLAISLDRLTQAMGKSRR 339


>gi|28870234|ref|NP_792853.1| glycine betaine/L-proline ABC transporter permease [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213970351|ref|ZP_03398480.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato T1]
 gi|301381134|ref|ZP_07229552.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302058923|ref|ZP_07250464.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302132547|ref|ZP_07258537.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28853480|gb|AAO56548.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213924822|gb|EEB58388.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato T1]
 gi|331015472|gb|EGH95528.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 321

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 158/279 (56%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     IPLG +++     +  N       + + + + +N +   L  +PP +F+   
Sbjct: 7   LDPFQSLTIPLGQWVEVVLNYMVHNFREVFRSIRWPVDQILNGIQGGLLSVPPTIFIIFA 66

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   V     + V   + L L+   G W +   TLSLVL S    + IGVPLGVL A 
Sbjct: 67  TLLGWQVGGK-KVGVMCFVTLTLLGLIGVWADAMTTLSLVLTSLVFCVVIGVPLGVLCAR 125

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT+P FVYL+P ++LFG+G VPG++ TI+FS+   VRLT LGI  
Sbjct: 126 SDRLERVLRPGLDAMQTLPAFVYLVPVVMLFGIGNVPGVLVTIIFSVAPLVRLTNLGIRQ 185

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P    EAA AFG T  Q+  KV+LP A P I+A L Q +MLSLSMVV+ +++   GLG+
Sbjct: 186 VPEDKVEAARAFGCTRRQMLFKVQLPLAAPTIMAGLNQALMLSLSMVVIASMISVGGLGL 245

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            VLR +  +D+G     G+ +V+LAI LDRL      R 
Sbjct: 246 MVLRGIGRLDMGLATVGGVGLVLLAIFLDRLTQAMGERS 284


>gi|149201736|ref|ZP_01878710.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseovarius sp. TM1035]
 gi|149144784|gb|EDM32813.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseovarius sp. TM1035]
          Length = 278

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 143/278 (51%), Positives = 194/278 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G + + FF+ L  N   F ++LS ++   ++  L+VLQ   P+V + V 
Sbjct: 1   MDWLSDHKIPVGKWAEGFFLWLQDNAAGFFDMLSVLMEGLIDAFLWVLQTPHPMVIIGVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L  +++RS    +   +G L I+ QGYW+ETTE+L+LV+ S    M +GVPLG+ AA 
Sbjct: 61  VALTWVLQRSWKTCLFVLLGFLFILNQGYWEETTESLTLVISSCVFCMALGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +R  LD MQT+P FVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI +
Sbjct: 121 RPRLYDGMRPVLDLMQTLPPFVYLIPAIVFFGIGMVPGLIATVIFVVPAPIRLTHLGISN 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q   KVELP+A+PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPQPLLEAAQAFGATNRQTLWKVELPYALPQIMAGLNQTIMLSLSMVVIGALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PVLRA+NTV+I  GFESGL IV++AI+LDR+  +   +
Sbjct: 241 PVLRAINTVNIALGFESGLMIVVVAIVLDRMLRMEGRK 278


>gi|238750477|ref|ZP_04611978.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia rohdei ATCC 43380]
 gi|238711408|gb|EEQ03625.1| Glycine betaine/L-proline transport system permease protein proW
           [Yersinia rohdei ATCC 43380]
          Length = 367

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 158/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 55  MDPFHTTWLPLDSWVTHGIDWIVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 115 ALIAWQFS-TLGMGVATLVSLVAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPEDLIEAAESFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 333


>gi|227432669|ref|ZP_03914642.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
 gi|227351551|gb|EEJ41804.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
          Length = 573

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 107/275 (38%), Positives = 170/275 (61%), Gaps = 2/275 (0%)

Query: 1   MSPIIQ-APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCV 59
           M+ ++    IPL D++      LT N   F + +       ++ +   L  +P  + +  
Sbjct: 3   MNNLVSIPKIPLEDWVSSAVSWLTTNLSGFFDAIQSGGQYIMDALTNGLTAVPMPLMIIG 62

Query: 60  VSLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLA 118
           ++++ ++   + I   + T +GLLLI  QG W +   T++LV++++ +S+ IG+PLG+L 
Sbjct: 63  ITVIAIVTTPKKIGFPLFTLLGLLLIANQGLWSDLMNTVTLVIMASIVSLIIGIPLGILT 122

Query: 119 AWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGI 178
           A   +   +++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI
Sbjct: 123 AKSQKTAVVVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTSLGI 182

Query: 179 ISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGL 238
              P  L EAA +FG+T +Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GL
Sbjct: 183 RQVPVDLVEAADSFGSTTWQKLFKLELPSAKNTILAGANQTIMLALSMVVTASMIGAPGL 242

Query: 239 GVPVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           G  VL A+   D+G GF +GL +VILAI++DR   
Sbjct: 243 GRGVLSAVQHADVGSGFVNGLGLVILAIVIDRFTQ 277


>gi|300906825|ref|ZP_07124506.1| ABC transporter, permease protein [Escherichia coli MS 84-1]
 gi|300401426|gb|EFJ84964.1| ABC transporter, permease protein [Escherichia coli MS 84-1]
          Length = 354

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|87121997|ref|ZP_01077882.1| glycine betaine/L-proline ABC transporter, permease protein
           [Marinomonas sp. MED121]
 gi|86162795|gb|EAQ64075.1| glycine betaine/L-proline ABC transporter, permease protein
           [Marinomonas sp. MED121]
          Length = 311

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 173/281 (61%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     +PLG++++     L QN   F   + + + + ++L+  +LQ +PPL+ + + 
Sbjct: 7   LDPFQFLSVPLGEWVETVLNYLVQNFRGFFRSIRWPIDQVLDLIETMLQSIPPLIGIILS 66

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   V     + +  A+ L ++   G W E+  TLSLVL + F  + IGVPLG+L+A 
Sbjct: 67  SLLGWQVAGK-KMGLFCAITLTILGLIGVWAESMTTLSLVLTALFFCVVIGVPLGILSAR 125

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT+P FVYL+P ++LFG+G VPG++ TI+F++P  VRLT LGI  
Sbjct: 126 SDRVERLVRPVLDAMQTLPAFVYLVPVVMLFGIGNVPGVLVTIIFALPPLVRLTNLGIRQ 185

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P    EAA AFG TP Q+  K++LP A P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 186 VPEDKIEAARAFGCTPKQMLLKIQLPLATPTIMAGINQTLMLSLSMVVIASMIAVGGLGQ 245

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            VLR +  +D+G     G+ +V+LAI LDRL      R RI
Sbjct: 246 MVLRGIGRLDMGLATVGGVGLVLLAIFLDRLTQAMGERARI 286


>gi|29833258|ref|NP_827892.1| glycine betaine ABC transport system permease protein [Streptomyces
           avermitilis MA-4680]
 gi|29610380|dbj|BAC74427.1| putative glycine betaine ABC transport system permease protein
           [Streptomyces avermitilis MA-4680]
          Length = 871

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 106/269 (39%), Positives = 158/269 (58%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP GD++ +    L  +  W  +    + L A + +  VLQ   PL+   +++++   +
Sbjct: 3   RIPFGDWVNDTVDWLLNHMSWLFDFFKTVFLGAFDGIDAVLQAPQPLLLAGILAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R  +  V T +G   I     W++   TLSLVLV+T I++ + VP+G+ AA   R  SI
Sbjct: 63  -RGTSAGVLTFVGFAFIDSLELWEDAMVTLSLVLVATVIALVVSVPVGIWAARSDRVSSI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G   GIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTLPAMIYLIPAILFFGTGAPAGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP  +  +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V  A+ 
Sbjct: 182 AADAFGTTPRNILLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGDVNEAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            +++G G E+G+ IVILAI LDR+ S   
Sbjct: 242 QLNVGLGSEAGVAIVILAIYLDRMTSALG 270


>gi|307947483|ref|ZP_07662816.1| choline ABC transporter, permease protein [Roseibium sp. TrichSKD4]
 gi|307769301|gb|EFO28529.1| choline ABC transporter, permease protein [Roseibium sp. TrichSKD4]
          Length = 282

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 147/273 (53%), Positives = 200/273 (73%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  +P+G + + F   LT N  WF + +++ L + ++ +L++LQ   PLV V   
Sbjct: 1   MDWLTEHKLPIGQWAKHFVDWLTDNAYWFFDAIAYGLERMIDAILWMLQTPHPLVIVVAT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   + R I   V     LLLII QGYW+ETTETL+LV+ ++ + M +GVP+GV AA 
Sbjct: 61  TALAYAIHRRIGFTVFVGAALLLIINQGYWEETTETLALVIGASVVCMAVGVPIGVAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P+ +S++R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLT+LG+ S
Sbjct: 121 RPKLFSVLRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTQLGVSS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGAT  Q+  K+ELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKQLLEAGEAFGATKSQLLWKIELPYALPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           P LRALNTV+I +GFE G+ IV++AI+LDR F 
Sbjct: 241 PTLRALNTVNIAKGFEVGVAIVLIAIVLDRFFR 273


>gi|157148217|ref|YP_001455536.1| glycine betaine transporter membrane protein [Citrobacter koseri
           ATCC BAA-895]
 gi|157085422|gb|ABV15100.1| hypothetical protein CKO_04028 [Citrobacter koseri ATCC BAA-895]
          Length = 354

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGIRVPVDYILNGFQQLLLGMPAPVAIIIF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGL-GMGVATLVSLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|161502140|ref|YP_001569252.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863487|gb|ABX20110.1| hypothetical protein SARI_00163 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 354

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + +   + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIAALISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|307314433|ref|ZP_07594038.1| binding-protein-dependent transport systems inner membrane
           component [Escherichia coli W]
 gi|306906001|gb|EFN36522.1| binding-protein-dependent transport systems inner membrane
           component [Escherichia coli W]
 gi|315061959|gb|ADT76286.1| glycine betaine transporter subunit [Escherichia coli W]
 gi|323377460|gb|ADX49728.1| binding-protein-dependent transport systems inner membrane
           component [Escherichia coli KO11]
          Length = 354

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + + T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGMATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|51244059|ref|YP_063943.1| glycine betaine/L-proline transport system permease protein (ProW)
           [Desulfotalea psychrophila LSv54]
 gi|50875096|emb|CAG34936.1| probable glycine betaine/L-proline transport system permease
           protein (ProW) [Desulfotalea psychrophila LSv54]
          Length = 280

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 119/279 (42%), Positives = 170/279 (60%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M       IPL  ++  F   L +   WF   + + + + ++     L  LPP++ + VV
Sbjct: 1   MLNFEDQVIPLDTWINTFVDWLVEGYRWFFQAIKWPIEQTLSGAENGLLALPPIIVIAVV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+   V     +A G+ + ++ I   G W+ET  TL++VL S    M  G+PLG+LA  
Sbjct: 61  CLIAWRVSGK-RLAFGSLLAMVFIGLLGLWEETMITLAMVLSSVVFCMIAGIPLGILAGR 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF + +R  LD+MQT P FVYL+P ++LF +G V G++ATIVF++P  VRLT LGI  
Sbjct: 120 SNRFNTFLRPVLDAMQTTPAFVYLVPIVMLFSIGNVAGVIATIVFALPPLVRLTSLGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P L EAA AFGAT +QV  KV++P A+P I+A + QTIM++LSMVV+ AL+G+ GLG 
Sbjct: 180 VHPELVEAALAFGATGWQVLFKVQIPLALPTIMAGINQTIMMALSMVVIAALIGAGGLGA 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+  LNT+DIG     GL IV++AIILDR+      + 
Sbjct: 240 PVVLGLNTLDIGGATVGGLGIVLMAIILDRITQAMGKKK 278


>gi|114705138|ref|ZP_01438046.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Fulvimarina pelagi HTCC2506]
 gi|114539923|gb|EAU43043.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Fulvimarina pelagi HTCC2506]
          Length = 280

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 139/279 (49%), Positives = 194/279 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G+  ++ F  L  NG WF + ++      ++ +L++LQ   PL+ V + 
Sbjct: 1   MNWLTDYKIPIGNIAEDVFDWLQSNGGWFFDGMADFGGWLIDSLLWLLQTPNPLIIVALF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            LL   ++RS  + +   +G L II QGYW+E TE+L+LVL +  + M IGVP+G+ AA 
Sbjct: 61  GLLSFWLQRSWKLTLFVVLGFLFIINQGYWEEMTESLTLVLSACIVCMAIGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P+ Y+ ++  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LG+ S
Sbjct: 121 RPKVYAFLQPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVLPAPIRLTYLGVSS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q   KVELP+A+PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKSLLEAADAFGATGSQKLWKVELPYALPQIMAGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALN V+   GFESG  IV++AIILDR+  +   + 
Sbjct: 241 PVVRALNQVNTALGFESGFIIVVVAIILDRVLRVGQRKK 279


>gi|16761591|ref|NP_457208.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29143071|ref|NP_806413.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|168233771|ref|ZP_02658829.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238725|ref|ZP_02663783.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194444232|ref|YP_002042055.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194472631|ref|ZP_03078615.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194733925|ref|YP_002115766.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|213163680|ref|ZP_03349390.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213424577|ref|ZP_03357366.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213581947|ref|ZP_03363773.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213618844|ref|ZP_03372670.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213650061|ref|ZP_03380114.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213859649|ref|ZP_03385353.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|289824479|ref|ZP_06544055.1| glycine betaine transporter membrane protein [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25306099|pir||AB0842 glycine betaine/L-proline transport system permease protein P
           STY2936 [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16503892|emb|CAD05921.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138704|gb|AAO70273.1| glycine betaine/L-proline transport system permease protein P
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|194402895|gb|ACF63117.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194458995|gb|EDX47834.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194709427|gb|ACF88648.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197288523|gb|EDY27900.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|205332211|gb|EDZ18975.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 354

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + +   + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIAALISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|85059883|ref|YP_455585.1| glycine betaine transporter membrane protein [Sodalis glossinidius
           str. 'morsitans']
 gi|84780403|dbj|BAE75180.1| glycine betaine/L-proline ABC transporter permease component
           [Sodalis glossinidius str. 'morsitans']
          Length = 349

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  Q  IPL  ++ E    +  +       +   +   ++    +L  LP  V + + 
Sbjct: 47  LDPFHQTLIPLDCWVTEGIDWVVLHFRPVFQGIRVPVDFILSGFQHLLLGLPAPVAMVIF 106

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +  ++++   T + L++I   G W +   TL+LVL S    + IG+PLG+  A 
Sbjct: 107 ALLAWQMS-TLSMGAATLVSLIIIGSIGAWSQAMVTLALVLTSLLFCVIIGLPLGIWLAR 165

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 166 SVRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 225

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FG +P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 226 VPADLVEAAESFGTSPSQMLFKVQLPLALPTIMAGINQTLMLALSMVVIASMIAVGGLGQ 285

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 286 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQSLGRDSR 325


>gi|297198469|ref|ZP_06915866.1| glycine betaine ABC transport system permease [Streptomyces sviceus
           ATCC 29083]
 gi|197717386|gb|EDY61420.1| glycine betaine ABC transport system permease [Streptomyces sviceus
           ATCC 29083]
          Length = 871

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 105/269 (39%), Positives = 154/269 (57%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD++ +    L  +  W  + L  +     + +  VLQ   PL+   +++++   +
Sbjct: 3   RIPLGDWVNDTVDWLLDHVSWLFDFLKTVFTGTYDGIDAVLQAPQPLLLAGILAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     + T  G   I     W++   TLSLVLV+T I++ I VP+G+ AA   R   I
Sbjct: 63  -RGTLAGLLTFAGFAFIDSLELWEDAMTTLSLVLVATIIALVIAVPVGIWAARSSRVSGI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G   GIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTLPAMIYLIPAILFFGTGASAGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V  A+ 
Sbjct: 182 AAEAFGTTPRDTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGDVNEAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            +++G G E+G+ IVILAI LDR+ S   
Sbjct: 242 QLNVGLGSEAGVAIVILAIYLDRMTSALG 270


>gi|152971536|ref|YP_001336645.1| glycine betaine transporter membrane protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150956385|gb|ABR78415.1| glycine/betaine/proline transport protein (ABC superfamily,
           membrane) [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 355

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 55  MDPFHKTLIPLDSWVTHAIDWIVLHFRPLFQGIRVPIDYILSAFQQLLLGMPAPVAIIVF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+ + V T + L+ I   G W +   TL+LVL +    M IG+PLG+  A 
Sbjct: 115 ALIAWQIS-SLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCMVIGLPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPADLIEASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDAR 333


>gi|261342126|ref|ZP_05969984.1| glycine betaine/L-proline transport system permease protein ProW
           [Enterobacter cancerogenus ATCC 35316]
 gi|288315457|gb|EFC54395.1| glycine betaine/L-proline transport system permease protein ProW
           [Enterobacter cancerogenus ATCC 35316]
          Length = 356

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  MDPFHKTLIPLDRWVTEGIDWVVTHFRPVFQGIRVPVDYILNGFQQMLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+      S  +   T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 SLIAWQFG-SAGMGAATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|328545184|ref|YP_004305293.1| glycine betaine/l-proline transporter permease prow [polymorphum
           gilvum SL003B-26A1]
 gi|326414926|gb|ADZ71989.1| Glycine betaine/l-proline transport system permease protein prow
           [Polymorphum gilvum SL003B-26A1]
          Length = 282

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 152/278 (54%), Positives = 201/278 (72%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  +P+G + +     LT N +W  + LS  L   +  +L+VLQ   PLV V + 
Sbjct: 1   MDWLTEHKLPVGPWAKAVVDWLTDNADWLFDGLSLGLETMIRAILWVLQAPHPLVVVVLA 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   ++RS++  +     LLLII QGYW+ETTETL+LV+ ++ + M +GVP+GV AA 
Sbjct: 61  TALAYGIRRSLSFPLFVLAALLLIINQGYWKETTETLALVVGASTVCMALGVPIGVAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y+++R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLG+ S
Sbjct: 121 RPRLYAVLRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGVAS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGAT  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPVQLLEAGHAFGATRSQLLWKVELPYALPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           P LRALNTV+I RGFE G+ IV++AI+LDR F     R
Sbjct: 241 PTLRALNTVNIARGFEVGVAIVLVAIVLDRFFRPGAER 278


>gi|116617483|ref|YP_817854.1| ABC-type proline/glycine betaine transport system, permease
           component [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116096330|gb|ABJ61481.1| ABC-type proline/glycine betaine transport system, permease
           component [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 571

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 107/275 (38%), Positives = 170/275 (61%), Gaps = 2/275 (0%)

Query: 1   MSPIIQ-APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCV 59
           M+ ++    IPL D++      LT N   F + +       ++ +   L  +P  + +  
Sbjct: 1   MNNLVSIPKIPLEDWVSSAVSWLTTNLSGFFDAIQSGGQYIMDALTNGLTAVPMALMIIG 60

Query: 60  VSLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLA 118
           ++++ ++   + I   + T +GLLLI  QG W +   T++LV++++ +S+ IG+PLG+L 
Sbjct: 61  ITVIAIVTTPKKIGFPLFTLLGLLLIANQGLWSDLMNTVTLVIMASIVSLIIGIPLGILT 120

Query: 119 AWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGI 178
           A   +   +++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI
Sbjct: 121 AKSQKTAVVVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTSLGI 180

Query: 179 ISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGL 238
              P  L EAA +FG+T +Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GL
Sbjct: 181 RQVPVDLVEAADSFGSTTWQKLFKLELPSAKNTILAGANQTIMLALSMVVTASMIGAPGL 240

Query: 239 GVPVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           G  VL A+   D+G GF +GL +VILAI++DR   
Sbjct: 241 GRGVLSAVQHADVGSGFVNGLGLVILAIVIDRFTQ 275


>gi|195977325|ref|YP_002122569.1| glycine betaine transport system permease protein OpuAB
           [Streptococcus equi subsp. zooepidemicus MGCS10565]
 gi|195974030|gb|ACG61556.1| glycine betaine transport system permease protein OpuAB
           [Streptococcus equi subsp. zooepidemicus MGCS10565]
          Length = 576

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 114/279 (40%), Positives = 174/279 (62%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+   +++    LT+    F ++L  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   MENLLQTTLPVAQLVEQLTEWLTKTFSGFFDLLQLVGNTLMDWITQTLLFINPLLFMLLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
              +  + ++   + + T +GLL +  QG W E   T +LVLV++ IS+ +G+PLG+  A
Sbjct: 61  TCAMFFLARKKWPLPIFTLLGLLFVYNQGLWAELINTFTLVLVASLISVLLGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                + +I   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KSKTVHQVINPMLDLMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+TP Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 HIPTELVEASDAFGSTPKQKLLKVELPLAKHTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIGRGF SGL +VILAIILDR+    + +
Sbjct: 241 REVLSALQHADIGRGFVSGLALVILAIILDRMTQHFNGK 279


>gi|37525249|ref|NP_928593.1| glycine betaine transporter membrane protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36784676|emb|CAE13576.1| Glycine betaine/L-proline transport system permease protein proW
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 361

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     IPL  ++ +    +  N       +   +   ++     L  +P  + +   
Sbjct: 59  MDPFQHPLIPLDSWVTQAIDWIVLNFRPAFQGIRVPIDFVLSGFEQCLTSIPAPIAILFF 118

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   I + +   + L++I + G W E+  TLSL L S    + +G+PLG+  A 
Sbjct: 119 ALIAWQLSG-IGMGITALISLVIIGEIGAWHESMVTLSLALTSLLFCIIVGLPLGIWLAH 177

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   II+  LD+MQT P FVYL+P ++LFG+G VPG++ TI+F++P  VRLT LGI  
Sbjct: 178 SKRAAKIIQPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVIVTIIFALPPIVRLTILGIKQ 237

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 238 VPADLIEAAESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 297

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAI+LDRL       +R
Sbjct: 298 MVLRGIGRLDMGLATVGGVGIVILAILLDRLTQSFGYSNR 337


>gi|302561573|ref|ZP_07313915.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces griseoflavus Tu4000]
 gi|302479191|gb|EFL42284.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Streptomyces griseoflavus Tu4000]
          Length = 872

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 106/269 (39%), Positives = 155/269 (57%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD++      L  N  W  +    +   A + V  VLQ   PL+   + +++   +
Sbjct: 3   RIPLGDWVNSAVDWLLANVTWLFDFFKAVFTGAYDGVNAVLQAPEPLLLAGIFAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     V T  G   +     W+++  TL+LV+V+T I++ I VP+G+ AA   R  + 
Sbjct: 63  -RGTFAGVLTFGGFAFLDSLELWEDSMVTLALVIVATVIALVISVPVGIWAARSDRVSAF 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G  PGIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPILDFMQTLPAMIYLIPAILFFGTGPAPGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V+ ++ 
Sbjct: 182 AAEAFGTTPRNTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGAVIESIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ++IG G E+GL IVILAI LDR+ S   
Sbjct: 242 QLNIGLGSEAGLAIVILAIYLDRMTSALG 270


>gi|332711923|ref|ZP_08431853.1| ABC-type proline/glycine betaine transport system, permease
           component [Lyngbya majuscula 3L]
 gi|332349251|gb|EGJ28861.1| ABC-type proline/glycine betaine transport system, permease
           component [Lyngbya majuscula 3L]
          Length = 664

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 102/277 (36%), Positives = 164/277 (59%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++P     +PL  ++      L  N   F   +S  +   +  + ++L  +PPL+ + ++
Sbjct: 23  LNPFELYTLPLQQWITAAVNFLVDNFRPFFQGISLPISITLESIEWLLLSIPPLILLILI 82

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     IA+ +   L LI   G W +   +LSLV+ +    M IG+  G+  A 
Sbjct: 83  ALIAWQLAGG-RIAIYSVAALSLIGFLGAWTQAMVSLSLVVTAVVFCMVIGITFGIACAS 141

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   ++R  LD+MQT+P+FVYL+P ++LFG+G VPG++AT VF+IP  +RLT LGI  
Sbjct: 142 SDRIEKVLRPLLDAMQTLPSFVYLVPVVMLFGIGAVPGVMATCVFAIPPLIRLTNLGIRQ 201

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
               + EAA AFG+TP Q+  +V++P A+P I+A + Q I+L+LSM VVT+++G  GLG 
Sbjct: 202 VSTEVVEAAIAFGSTPTQMLFEVQIPLAMPTILAGVNQAILLALSMSVVTSMIGVGGLGQ 261

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            VL+ L  V++G     GL IV++A++LDR+  I   
Sbjct: 262 MVLQGLGRVNVGLAAVGGLSIVLIAVMLDRITQIVSQ 298


>gi|167552691|ref|ZP_02346443.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205322669|gb|EDZ10508.1| glycine betaine/L-proline transport system permease protein ProW
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 354

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 106/280 (37%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPLFQGIRVPVDYILNGFQQLLLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   V     + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 ALIAWQVSGV-GMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGSDSR 332


>gi|330013350|ref|ZP_08307621.1| glycine betaine/L-proline transport system permease protein ProW
           [Klebsiella sp. MS 92-3]
 gi|328533538|gb|EGF60261.1| glycine betaine/L-proline transport system permease protein ProW
           [Klebsiella sp. MS 92-3]
          Length = 355

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 55  MDPFHKTLIPLDSWVTHAIDWIVLHFRPLFQGIRVPIDYILSAFQQLLLGMPAPVAIIVF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+ + V T + L+ I   G W +   TL+LVL +    M IG+PLG+  A 
Sbjct: 115 ALIAWQIS-SLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCMVIGLPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPADLIEASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDAR 333


>gi|206580359|ref|YP_002236982.1| glycine betaine/L-proline ABC transporter, permease protein
           [Klebsiella pneumoniae 342]
 gi|288933940|ref|YP_003437999.1| binding-protein-dependent transporters inner membrane component
           [Klebsiella variicola At-22]
 gi|290510982|ref|ZP_06550351.1| glycine betaine/L-proline ABC transporter, permease [Klebsiella sp.
           1_1_55]
 gi|206569417|gb|ACI11193.1| glycine betaine/L-proline ABC transporter, permease protein
           [Klebsiella pneumoniae 342]
 gi|288888669|gb|ADC56987.1| binding-protein-dependent transport systems inner membrane
           component [Klebsiella variicola At-22]
 gi|289775975|gb|EFD83974.1| glycine betaine/L-proline ABC transporter, permease [Klebsiella sp.
           1_1_55]
          Length = 355

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 55  MDPFHKTLIPLDSWVTHAIDWIVLHFRPLFQGIRVPIDYILSAFQQLLLGMPAPVAIIVF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+ + V T + L+ I   G W +   TL+LVL +    M IG+PLG+  A 
Sbjct: 115 ALIAWQIS-SLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCMVIGLPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPADLIEASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDAR 333


>gi|7542432|gb|AAF63444.1|AF218267_1 glycine betaine/L-proline transport system permease protein
           [Pseudomonas putida]
          Length = 315

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 164/278 (58%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P   A IPLGD++      L  N       + + + + +N + F LQ +PP + + + 
Sbjct: 5   LDPFQAATIPLGDWVTATLNFLVHNFREVFRAIRWPIDQVLNGIEFTLQSIPPTIGIILS 64

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   +     +A+   + L L+   G W E+  TL+LVL S F    IG+PLG+L A 
Sbjct: 65  SLLGWQLAGK-RMALLCFVTLTLLGLIGVWAESMTTLALVLTSVFFCALIGIPLGILCAR 123

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   IIR  LD+MQT+P FVYL+P ++LFG+G VPG++ TIVF++P  VRLT LGI  
Sbjct: 124 SDRMERIIRPLLDAMQTLPAFVYLVPVVMLFGIGNVPGVLVTIVFALPPLVRLTNLGIRQ 183

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P    EAA AFG TP Q+  +V+LP A   I+A L QT+MLSLSMVV+ +++   GLG 
Sbjct: 184 VPEDKIEAARAFGCTPRQMLTRVQLPLATSTIMAGLNQTLMLSLSMVVIASMISVGGLGQ 243

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VLR +  +D+G     G+ +V+LAI LDRL      R
Sbjct: 244 MVLRGIGRLDMGLATVGGVGLVLLAIFLDRLTQAMGAR 281


>gi|312961036|ref|ZP_07775541.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens WH6]
 gi|311284694|gb|EFQ63270.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens WH6]
          Length = 321

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 162/279 (58%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P     +PLG +++     L  N       + + + + +N + F L  +PP +F+ + 
Sbjct: 7   LDPFQSINVPLGQWVEVTLNYLVHNFREVFRSIRWPIDQVLNGIQFGLLAIPPSIFIIIA 66

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   V     I +   + L L+   G W +   TL+LVL S F    IG+PLGVL A 
Sbjct: 67  TLLGWQVGGR-RIGILCFVTLTLLGVIGVWSDAMVTLALVLTSLFFCAVIGIPLGVLCAR 125

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R    +R  LD+MQT+P FVYL+P ++LFG+G VPG++ TI+FS+   VRLT LGI  
Sbjct: 126 SDRLEMFLRPVLDAMQTLPAFVYLVPVVMLFGIGNVPGVLVTIIFSVAPLVRLTNLGIRQ 185

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P    EAA AFG TP+Q+ R+V+LP A P I+A L Q +MLSLSMVV+ +++   GLG+
Sbjct: 186 VPEDKVEAARAFGCTPYQMLRRVQLPLAAPTIMAGLNQALMLSLSMVVIASMISVGGLGM 245

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            VLR +  +D+G     GL +V+LAI LDRL      R 
Sbjct: 246 MVLRGIGRLDMGLATVGGLGLVLLAIFLDRLTQAMGERS 284


>gi|163746754|ref|ZP_02154111.1| binding-protein-dependent transport systems inner membrane
           component [Oceanibulbus indolifex HEL-45]
 gi|161379868|gb|EDQ04280.1| binding-protein-dependent transport systems inner membrane
           component [Oceanibulbus indolifex HEL-45]
          Length = 277

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 134/277 (48%), Positives = 190/277 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  IP+ D  ++    L  NG WF + L+ ++ + +  +L+VLQ   PL+ + V 
Sbjct: 1   MDWLTENKIPVADVAEDALDWLQTNGAWFFDGLADLMERLIEAILWVLQTPHPLILIAVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   ++R+        +G L I+ Q YW+ET E+L+LVL +  + M +GVP+G+  A 
Sbjct: 61  AAITWGIQRNWKTVAFVVLGFLFILNQDYWEETMESLTLVLSACVVCMGVGVPIGIAVAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y+ +   LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT+LGI S
Sbjct: 121 RPRLYAWVAPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGA P Q   K+ELP+A+PQI+  L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKALLEAAQAFGAKPRQTLWKIELPYALPQIMTGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALN V+ G GFESGL IV++AI+LDR+  +   
Sbjct: 241 PVVRALNQVNTGLGFESGLVIVVVAIMLDRILRVGRK 277


>gi|312882313|ref|ZP_07742057.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309370026|gb|EFP97534.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 280

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 136/279 (48%), Positives = 193/279 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IP+G++++     LT NG  F + +S  L   ++ V+ V +++PP + + + 
Sbjct: 1   MNFITNNKIPVGEWIEAGVDWLTLNGAGFFDAISIFLETIIHFVVDVFKWMPPALPILLT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + V     LL I+  GYWQE  ET  LV  +T +S+ IGVP+G++AA 
Sbjct: 61  AAIAWYLHRSIPLVVFVVAALLTILNLGYWQEMLETFVLVFAATTMSVLIGVPVGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+I+R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+  
Sbjct: 121 RPWLYTILRPVLDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGMTK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELIEAGKAFGASRMKLLFKVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVIRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKE 279


>gi|319761857|ref|YP_004125794.1| binding-protein-dependent transport systems inner membrane
           component [Alicycliphilus denitrificans BC]
 gi|330826291|ref|YP_004389594.1| ABC transporter integral membrane subunit [Alicycliphilus
           denitrificans K601]
 gi|317116418|gb|ADU98906.1| binding-protein-dependent transport systems inner membrane
           component [Alicycliphilus denitrificans BC]
 gi|329311663|gb|AEB86078.1| ABC-type transporter, integral membrane subunit [Alicycliphilus
           denitrificans K601]
          Length = 370

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 103/272 (37%), Positives = 161/272 (59%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           +P+  ++ +      +N   F   +   +   ++ V   L  LP  V + ++SLL     
Sbjct: 78  LPVQGWINDGLHWAVENFRPFFQSVRAPIDATLSGVTDALLALPWPVMLLLISLLAWQFA 137

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
             + +A+ TA+ L +++  G W +   TL+LVL S    + +G+PLG++ A   R     
Sbjct: 138 GRM-LALATAVSLGVVVLLGIWPDAMVTLALVLTSLLFCVVLGLPLGIVLAASDRAQRFT 196

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  VRLT LG+    P L EA
Sbjct: 197 RPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLVRLTNLGLRQVRPDLIEA 256

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + A+GA+P+Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VLR +  
Sbjct: 257 SRAYGASPWQLLWKVQLPLALPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVLRGIGR 316

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +D+G     GL IV+LA++LDR+        R
Sbjct: 317 LDMGLASIGGLGIVLLAVVLDRITQAMGAPRR 348


>gi|283786767|ref|YP_003366632.1| glycine betaine/L-proline ABC transporter permease [Citrobacter
           rodentium ICC168]
 gi|282950221|emb|CBG89857.1| glycine betaine/L-proline ABC transporter, permease protein
           [Citrobacter rodentium ICC168]
          Length = 353

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ +    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 53  LDPFHKTLIPLDSWVTDGIDWVVAHFRPVFQGIRVPVDYILNGFQQLLLGMPAPVAIIVF 112

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +     + V T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 113 ALLAWQISGV-GMGVATLVSLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 171

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 172 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 231

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 232 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 291

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 292 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 331


>gi|121593479|ref|YP_985375.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax sp. JS42]
 gi|120605559|gb|ABM41299.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax sp. JS42]
          Length = 400

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 107/277 (38%), Positives = 159/277 (57%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    +P+  ++ E    + +N   F   +   +   +  V  +L  +P    + +V+LL
Sbjct: 85  IATDGLPVQGWINEGLHWVVENFRPFFQAVRAPIDATLTGVTDLLLAVPAPALIALVTLL 144

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +AVG A+ L L+   G W +   TL+LVL S    + IG+P+G++ A   R
Sbjct: 145 AWQFAGR-GLAVGAALSLGLVALLGIWPDAMVTLALVLTSLLFCVVIGLPMGIVLAASER 203

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
                R  LD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  VRLT LG+    P
Sbjct: 204 AQRWTRPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLVRLTNLGLRQVRP 263

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 264 DLIEASRAYGASPLQLLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 323

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI+LDRL        R
Sbjct: 324 RGIGRLDMGLATVGGLGIVLLAIVLDRLTQAMGQPRR 360


>gi|328881264|emb|CCA54503.1| Glycine betaine ABC transport system, permease or glycine
           betaine-binding protein OpuABC [Streptomyces venezuelae
           ATCC 10712]
          Length = 603

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 111/271 (40%), Positives = 160/271 (59%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG+++      L     W  + +S  +    + +  VL    PL+F  +++++   +
Sbjct: 3   RLPLGEWVDSSVDWLQAQFSWLFDAVSTGVTGLYDGIDAVLSAPQPLLFAGILAVVAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   V    G  L+     W E   TLSLVLV+T +++ I VPLG+ AA      ++
Sbjct: 63  -RGLAAGVLAFAGFALVDSVQLWDEAMATLSLVLVATLVTLVIAVPLGIWAARSKTVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATIVF++P  VR+T LGI      L E
Sbjct: 122 LRPVLDFMQTMPAMVYLIPGIIFFGVGVVPGIIATIVFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTPRNTLLRVQLPLALPTIMAGVNQVIMLGLSMVVIAGMVGGGGLGGAVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VDIG GFE+G+ IV+LA+ LDR+      +
Sbjct: 242 NVDIGLGFEAGVSIVVLAMYLDRMTGALGRQ 272


>gi|282864305|ref|ZP_06273361.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Streptomyces sp. ACTE]
 gi|282560792|gb|EFB66338.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Streptomyces sp. ACTE]
          Length = 879

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 107/268 (39%), Positives = 157/268 (58%), Gaps = 1/268 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
            G+++++    L  N  W  + +  +L    + V  VL    PL+   + ++L   + R 
Sbjct: 6   FGEWVEDAVDWLQSNLTWIFDAIKTVLGGMYDGVNAVLGGGEPLLMAAIFAVLAFWL-RG 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           I  AV T  G  LI     W E   TLSLV+V+  I++ I VP+G+ AA   +  + +R 
Sbjct: 65  IIPAVLTFAGFALIDSLALWDEAMATLSLVIVAAVITIVIAVPMGIWAARNSKVSATLRP 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIP ++ FG+G+ PG++ATIVF++P  VR+T LGI      L EAA 
Sbjct: 125 VLDVMQTMPAFVYLIPGVMFFGVGVTPGVIATIVFAMPPGVRMTELGIRQVDGELVEAAE 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG TP     +V+LP A+P I+A + Q IML+LSMVV+  + G+ GLG  V  A+  + 
Sbjct: 185 AFGTTPKHTLTRVQLPLALPTIMAGINQVIMLALSMVVIGGMAGAGGLGEKVYAAITQLQ 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPR 278
           +G   ESG+ +VILA+ LDR+    + R
Sbjct: 245 VGLAAESGIAVVILAMYLDRMTGALNER 272


>gi|238896133|ref|YP_002920869.1| glycine betaine transporter membrane protein [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238548451|dbj|BAH64802.1| glycine/betaine/proline transport system permease component
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 355

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P  V + V 
Sbjct: 55  MDPFHKTLIPLDSWVTHAIDWIVLHFRPLFQGIRVPIDYILSAFQQLLLGMPAPVAIIVF 114

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  S+ + V T + L+ I   G W +   TL+LVL +    M IG+PLG+  A 
Sbjct: 115 ALIAWQIS-SLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCMVIGLPLGIWLAR 173

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 174 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 233

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 234 VPADLIEASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 293

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 294 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDAR 333


>gi|154251521|ref|YP_001412345.1| substrate-binding region of ABC-type glycine betaine transport
           system [Parvibaculum lavamentivorans DS-1]
 gi|154155471|gb|ABS62688.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Parvibaculum lavamentivorans DS-1]
          Length = 633

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 96/271 (35%), Positives = 148/271 (54%)

Query: 10  PLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKR 69
           P+  ++         +     +  S  LL  +  +   L  LP  + +  V+       R
Sbjct: 356 PVEAWVNRAMKNFVADYGNAFHAASGWLLALIVALEAGLGALPWWLIILAVAGAAWHASR 415

Query: 70  SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIR 129
              + V  A  L LI   G W    +TL+L+LVS F ++ IG+P G+  A       I+ 
Sbjct: 416 HFALPVILAGLLFLIGTLGLWDLAIQTLALMLVSVFFAVLIGLPSGIAIAASDIARRIVL 475

Query: 130 LFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAA 189
             LD+MQT+P+FVYLIPAL+LFGLG VP + AT++++ P  +RL  LG+ +    L E A
Sbjct: 476 PVLDAMQTLPSFVYLIPALMLFGLGKVPALFATVIYATPPLIRLVDLGLRTVDRQLVEMA 535

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
              GA  ++    ++LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  +  +
Sbjct: 536 ADLGADKWRQLIDIKLPLALPSIMAGVNQTTMMALSMVVIASMIGARGLGEEVLLGIQRL 595

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           DIGRG  +G+ IV LAI+ DR+       +R
Sbjct: 596 DIGRGLAAGIAIVALAIVFDRITQAYGRVNR 626


>gi|332286150|ref|YP_004418061.1| substrate-binding region of ABC-type glycine betaine transport
           system [Pusillimonas sp. T7-7]
 gi|330430103|gb|AEC21437.1| substrate-binding region of ABC-type glycine betaine transport
           system [Pusillimonas sp. T7-7]
          Length = 654

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 108/275 (39%), Positives = 166/275 (60%), Gaps = 4/275 (1%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILS-FILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKR 69
           +   + +  + + +N   F    S F+L   +  V  ++Q +PP VF+ +V+ L     R
Sbjct: 374 IAALVNQQLMGVVKNYGGFFRQASGFMLTTVLLPVERLMQAVPPWVFLLLVAALSWHATR 433

Query: 70  SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIR 129
                V     L LI   G W +  +T +LVLVST +S+ +GVP+G++AA       ++ 
Sbjct: 434 KPVATVLYVACLYLIGAVGLWDKLIQTFALVLVSTLVSIVLGVPIGIIAARSRLLRRVLT 493

Query: 130 LFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAA 189
             LD MQT+P+FVYLIP L+LFGLG VP + ATI++++P  +RLT LG+      + EAA
Sbjct: 494 PVLDVMQTLPSFVYLIPVLMLFGLGKVPALFATIIYAVPPLIRLTILGLRQVDRDVMEAA 553

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
            AFG T +Q+  +V LP A P I+A + QT M++L+MVVV +++G+ GLG  VL  + T+
Sbjct: 554 QAFGVTRWQMLTRVTLPLARPSIMAGINQTTMMALAMVVVASMIGARGLGEDVLAGIQTL 613

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPD---PRDRI 281
           D+GRG ++G+ IVILAI++DR+         R R+
Sbjct: 614 DVGRGLQAGVAIVILAIVIDRITQAYGQPRRRRRV 648


>gi|95928647|ref|ZP_01311394.1| binding-protein-dependent transport systems inner membrane
           component [Desulfuromonas acetoxidans DSM 684]
 gi|95135437|gb|EAT17089.1| binding-protein-dependent transport systems inner membrane
           component [Desulfuromonas acetoxidans DSM 684]
          Length = 279

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 113/276 (40%), Positives = 167/276 (60%), Gaps = 1/276 (0%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
                 IPL +++Q+    L  N       +   + K+++   ++   LPP+V +  ++L
Sbjct: 5   NFEDQLIPLDEWVQDGVRWLAMNYRDIFQAIKVPIEKSLDGFQWLFNSLPPIVVIVFLAL 64

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           L         + + T   L LI   G W+ T  TLS+V+ S      +G+PLG+L+    
Sbjct: 65  LAWRYAGK-RVTLFTVSSLFLIGFLGQWEATMTTLSMVVCSVLFCGLVGIPLGILSGRSD 123

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
           RF  ++R  LD+MQT P FVYL+P ++LF +G V GI+ATIVF++P  +RLT LGI    
Sbjct: 124 RFEMLLRPCLDAMQTTPAFVYLVPVVMLFSIGPVSGILATIVFAMPPIIRLTNLGIRQVH 183

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
           P L EAA AFG+TP+QV  KV+ P A+P I+A L QTIM++LSMVV+ A++G+ GLG PV
Sbjct: 184 PELVEAAIAFGSTPWQVLCKVQFPLALPSIMAGLNQTIMMALSMVVIAAMIGAGGLGDPV 243

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           ++ LNT++IG     GL IV+LA+ILDR+      +
Sbjct: 244 VQGLNTLEIGLATIGGLSIVLLAMILDRITQGIGRK 279


>gi|298292987|ref|YP_003694926.1| choline ABC transporter permease [Starkeya novella DSM 506]
 gi|296929498|gb|ADH90307.1| choline ABC transporter, permease protein [Starkeya novella DSM
           506]
          Length = 283

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 141/279 (50%), Positives = 193/279 (69%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
             + +  IPLG +L++F   LT +G+ F + +S +L   +      L ++PPL+ + + +
Sbjct: 3   DWLTEHKIPLGIWLRDFVDLLTTHGQSFFDFVSLVLGGLIGGFTAALLWVPPLLLIAIFA 62

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
           L    + RSI + V     LLL+   GYW  T ETLSLV+ +T + + +GVP+G+ AA  
Sbjct: 63  LGAWWMHRSIGLVVFIVGALLLVTNLGYWSATMETLSLVICATLVCVIVGVPIGIAAAHR 122

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P  Y+ IR  LD MQTIPTFVYLIP LVLFGLG VPG+++T++F+IP  +RLT LGI S 
Sbjct: 123 PWLYTGIRPILDLMQTIPTFVYLIPTLVLFGLGAVPGLISTVIFAIPAPIRLTHLGISSV 182

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           PP L EA  AFGAT  Q+  KVELP+A+P I+A +TQ IMLSLSMVV+ ALVG++GLG P
Sbjct: 183 PPALYEAGKAFGATKTQLLFKVELPYALPTIMAGVTQCIMLSLSMVVIAALVGADGLGKP 242

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           V+RALN+V+I  GFE+GL IV+LAI+LDR+   P+ R +
Sbjct: 243 VVRALNSVNIAMGFEAGLAIVVLAIVLDRVCKRPERRPK 281


>gi|290476212|ref|YP_003469112.1| glycine/betaine/proline ABC transporter membrane protein
           [Xenorhabdus bovienii SS-2004]
 gi|289175545|emb|CBJ82348.1| glycine/betaine/proline transport protein (ABC superfamily,
           membrane) [Xenorhabdus bovienii SS-2004]
          Length = 364

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 157/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+P     IP   ++      L  +       +   +   +      L  +P  V + + 
Sbjct: 49  MAPFQHKLIPFDSWVTHAIDWLVLHFRPIFQGVRIPVDFILTGFEQFLISMPAPVTILIF 108

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +  +  + V + + L+LI   G W E   TL+LVL +    + IG+PL +  A 
Sbjct: 109 ALLAWQLTGA-GMGVTSFISLILIGAIGAWSEAMITLALVLTALLFCILIGLPLAIWLAH 167

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R   I+R  LD+MQT P FVYL+P ++LFG+G VPG++ TI+F++P  VRLT LGI  
Sbjct: 168 NERVARIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVMVTIIFALPPIVRLTILGIKQ 227

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 228 VPADLIEAAQSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 287

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +DIG     G  IVILAIILDRL       +R
Sbjct: 288 MVLRGIGRLDIGLAAVGGAGIVILAIILDRLTQSLGKNNR 327


>gi|296104355|ref|YP_003614501.1| glycine betaine/proline transport system permease protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295058814|gb|ADF63552.1| glycine betaine/proline transport system permease protein
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 354

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    ++  +P  V + + 
Sbjct: 54  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGIRVPVDYILNGFQQLMLGMPAPVAIVLF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+      S  + + T + L+ I   G W +   TL+LVL +    + IG+P G+  A 
Sbjct: 114 SLIAWQFG-SAGMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCIVIGLPTGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   I+R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIVRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|225867769|ref|YP_002743717.1| glycine-betaine binding permease [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701045|emb|CAW97837.1| putative glycine-betaine binding permease protein [Streptococcus
           equi subsp. zooepidemicus]
          Length = 576

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 173/279 (62%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+   +++    LT+    F ++L  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   MENLLQTTLPVAQLVEQLTEWLTKTFSGFFDLLQLVGNALMDWITQTLLFINPLLFMLLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
              +  + ++   +   T +GLL +  QG W E   T +LVLV++ IS+ +G+PLG+  A
Sbjct: 61  TCAMFFLARKKWPLPTFTLLGLLFVYNQGLWAELINTFTLVLVASLISVLLGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                + +I   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNKTVHQVINPMLDLMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTSLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+TP Q   KVELP A   ++A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 QIPTELIEASDAFGSTPKQKLLKVELPLAKHTMMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIGRGF SGL +VILAIILDR+    + +
Sbjct: 241 REVLSALQHADIGRGFVSGLALVILAIILDRMTQHFNGK 279


>gi|29347160|ref|NP_810663.1| glycine betaine/L-proline transport system permease [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|253571897|ref|ZP_04849302.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 1_1_6]
 gi|298387517|ref|ZP_06997069.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 1_1_14]
 gi|29339059|gb|AAO76857.1| glycine betaine/L-proline transport system permease [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|251838494|gb|EES66580.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 1_1_6]
 gi|298259724|gb|EFI02596.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 1_1_14]
          Length = 276

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 120/272 (44%), Positives = 173/272 (63%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT++   F + LS  +   ++    VL  +P  + + V++ L    K
Sbjct: 2   INIGQYIETAINWLTEHFASFFDALSMGIGGFIDGFQHVLFGIPFYITIAVLAALAWF-K 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                AV T +GLLLI   G+W+ET +TL+LVL ST +++ +GVPLG+  A   R   I+
Sbjct: 61  SGKGTAVFTLLGLLLIYGMGFWEETMQTLALVLSSTCLALLLGVPLGIWTANSDRCNKIM 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDFMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGATP+Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATPWQLLYKVQLPLALPTILTGINQTIMMSLSMVVIAAMISAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAI+LDR+        +
Sbjct: 241 MKIGLGFEGGIAVVILAIVLDRITQGMADNRK 272


>gi|167033694|ref|YP_001668925.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas putida GB-1]
 gi|166860182|gb|ABY98589.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas putida GB-1]
          Length = 317

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 165/278 (59%), Gaps = 1/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P   A IPLGD++      L  N       + + + + +N + F LQ +PP + + + 
Sbjct: 7   LDPFQAATIPLGDWVTATLNFLVHNFREVFRAIRWPIDQVLNGIEFTLQSIPPTIGILLS 66

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLL   +     +AV   + L L+   G W E+  TL+LVL S F    IG+PLG++ A 
Sbjct: 67  SLLGWQLAGK-RMAVLCFITLTLLGLIGVWSESMTTLALVLTSVFFCAVIGIPLGIVCAR 125

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  SIIR  LD+MQT+P FVYL+P ++LFG+G VPG++ TIVF++P  VRLT LGI  
Sbjct: 126 SNRLESIIRPLLDAMQTLPAFVYLVPVVMLFGIGNVPGVLVTIVFALPPLVRLTNLGIRQ 185

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P    EAA AFG TP Q+  +V+LP A   I+A L QT+MLSLSMVV+ +++   GLG 
Sbjct: 186 VPEDKIEAARAFGCTPRQMLTRVQLPLATSTIMAGLNQTLMLSLSMVVIASMISVGGLGQ 245

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VLR +  +D+G     G+ +V+LAI LDRL      R
Sbjct: 246 MVLRGIGRLDMGLATVGGVGLVLLAIFLDRLTQAMGAR 283


>gi|332999415|gb|EGK19000.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri VA-6]
          Length = 354

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +   + + V T + L+ I   G   +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISG-VGMGVATLVSLIAIGAIGACSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|16130592|ref|NP_417164.1| glycine betaine transporter subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|89109471|ref|AP_003251.1| glycine betaine transporter subunit [Escherichia coli str. K-12
           substr. W3110]
 gi|157162129|ref|YP_001459447.1| glycine betaine transporter membrane protein [Escherichia coli HS]
 gi|170019070|ref|YP_001724024.1| glycine betaine transporter membrane protein [Escherichia coli ATCC
           8739]
 gi|170082263|ref|YP_001731583.1| glycine betaine ABC transporter membrane protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|188496143|ref|ZP_03003413.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli 53638]
 gi|194439438|ref|ZP_03071514.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli 101-1]
 gi|238901822|ref|YP_002927618.1| glycine betaine transporter subunit [Escherichia coli BW2952]
 gi|253772461|ref|YP_003035292.1| glycine betaine transporter membrane protein [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037720|ref|ZP_04871778.1| glycine betaine/L-proline ABC transporter [Escherichia sp. 1_1_43]
 gi|254162615|ref|YP_003045723.1| glycine betaine transporter membrane protein [Escherichia coli B
           str. REL606]
 gi|256024810|ref|ZP_05438675.1| glycine betaine transporter membrane protein [Escherichia sp.
           4_1_40B]
 gi|293415929|ref|ZP_06658569.1| glycine betaine transporter membrane protein [Escherichia coli
           B185]
 gi|297517416|ref|ZP_06935802.1| glycine betaine transporter membrane protein [Escherichia coli
           OP50]
 gi|300930531|ref|ZP_07145927.1| ABC transporter, permease protein [Escherichia coli MS 187-1]
 gi|300949074|ref|ZP_07163121.1| ABC transporter, permease protein [Escherichia coli MS 116-1]
 gi|300957449|ref|ZP_07169662.1| ABC transporter, permease protein [Escherichia coli MS 175-1]
 gi|301026688|ref|ZP_07190099.1| ABC transporter, permease protein [Escherichia coli MS 196-1]
 gi|301645343|ref|ZP_07245290.1| ABC transporter, permease protein [Escherichia coli MS 146-1]
 gi|307139370|ref|ZP_07498726.1| glycine betaine transporter membrane protein [Escherichia coli
           H736]
 gi|312973111|ref|ZP_07787284.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 1827-70]
 gi|331643366|ref|ZP_08344497.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli H736]
 gi|130992|sp|P14176|PROW_ECOLI RecName: Full=Glycine betaine/L-proline transport system permease
           protein proW
 gi|147374|gb|AAA24428.1| proW peptide [Escherichia coli]
 gi|1789033|gb|AAC75725.1| glycine betaine transporter subunit [Escherichia coli str. K-12
           substr. MG1655]
 gi|1800066|dbj|BAA16543.1| glycine betaine transporter subunit [Escherichia coli str. K12
           substr. W3110]
 gi|157067809|gb|ABV07064.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli HS]
 gi|169753998|gb|ACA76697.1| binding-protein-dependent transport systems inner membrane
           component [Escherichia coli ATCC 8739]
 gi|169890098|gb|ACB03805.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Escherichia coli str. K-12 substr. DH10B]
 gi|188491342|gb|EDU66445.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli 53638]
 gi|194421614|gb|EDX37625.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli 101-1]
 gi|226839344|gb|EEH71365.1| glycine betaine/L-proline ABC transporter [Escherichia sp. 1_1_43]
 gi|238861367|gb|ACR63365.1| glycine betaine transporter subunit [Escherichia coli BW2952]
 gi|242378240|emb|CAQ33015.1| proW, subunit of proline ABC transporter [Escherichia coli
           BL21(DE3)]
 gi|253323505|gb|ACT28107.1| binding-protein-dependent transport systems inner membrane
           component [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974516|gb|ACT40187.1| glycine betaine transporter subunit [Escherichia coli B str.
           REL606]
 gi|253978683|gb|ACT44353.1| glycine betaine transporter subunit [Escherichia coli BL21(DE3)]
 gi|260448264|gb|ACX38686.1| binding-protein-dependent transport systems inner membrane
           component [Escherichia coli DH1]
 gi|291432118|gb|EFF05100.1| glycine betaine transporter membrane protein [Escherichia coli
           B185]
 gi|299879610|gb|EFI87821.1| ABC transporter, permease protein [Escherichia coli MS 196-1]
 gi|300315805|gb|EFJ65589.1| ABC transporter, permease protein [Escherichia coli MS 175-1]
 gi|300451460|gb|EFK15080.1| ABC transporter, permease protein [Escherichia coli MS 116-1]
 gi|300461587|gb|EFK25080.1| ABC transporter, permease protein [Escherichia coli MS 187-1]
 gi|301076377|gb|EFK91183.1| ABC transporter, permease protein [Escherichia coli MS 146-1]
 gi|309703043|emb|CBJ02375.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli ETEC H10407]
 gi|310333053|gb|EFQ00267.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 1827-70]
 gi|315137291|dbj|BAJ44450.1| glycine betaine transporter membrane protein [Escherichia coli DH1]
 gi|315615065|gb|EFU95702.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 3431]
 gi|323935628|gb|EGB31945.1| inner membrane transport system [Escherichia coli E1520]
 gi|323941486|gb|EGB37669.1| inner membrane transport system [Escherichia coli E482]
 gi|323960576|gb|EGB56203.1| inner membrane transport system [Escherichia coli H489]
 gi|323971477|gb|EGB66712.1| inner membrane transport system [Escherichia coli TA007]
 gi|331036837|gb|EGI09061.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli H736]
 gi|332344560|gb|AEE57894.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli UMNK88]
          Length = 354

 Score =  165 bits (417), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|300922748|ref|ZP_07138837.1| ABC transporter, permease protein [Escherichia coli MS 182-1]
 gi|300420933|gb|EFK04244.1| ABC transporter, permease protein [Escherichia coli MS 182-1]
          Length = 354

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL +++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDNWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|333001015|gb|EGK20585.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri K-272]
 gi|333015481|gb|EGK34820.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri K-227]
          Length = 354

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|15803198|ref|NP_289230.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 EDL933]
 gi|15832795|ref|NP_311568.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. Sakai]
 gi|168750921|ref|ZP_02775943.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|168755423|ref|ZP_02780430.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|168762473|ref|ZP_02787480.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|168768769|ref|ZP_02793776.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|168774790|ref|ZP_02799797.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4196]
 gi|168778660|ref|ZP_02803667.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|168787933|ref|ZP_02812940.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC869]
 gi|168800563|ref|ZP_02825570.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC508]
 gi|193065974|ref|ZP_03047033.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli E22]
 gi|194427910|ref|ZP_03060456.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli B171]
 gi|195938432|ref|ZP_03083814.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807590|ref|ZP_03249927.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208814097|ref|ZP_03255426.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208820172|ref|ZP_03260492.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209396362|ref|YP_002272144.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|217326993|ref|ZP_03443076.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|218690806|ref|YP_002399018.1| glycine betaine transporter membrane protein [Escherichia coli
           ED1a]
 gi|218701173|ref|YP_002408802.1| glycine betaine transporter membrane protein [Escherichia coli
           IAI39]
 gi|218706178|ref|YP_002413697.1| glycine betaine transporter membrane protein [Escherichia coli
           UMN026]
 gi|254794625|ref|YP_003079462.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|260845326|ref|YP_003223104.1| high-affinity transport system for glycine betaine and proline,
           membrane component [Escherichia coli O103:H2 str. 12009]
 gi|261225975|ref|ZP_05940256.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256767|ref|ZP_05949300.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291284011|ref|YP_003500829.1| Glycine betaine/L-proline ABC transporter permease protein
           [Escherichia coli O55:H7 str. CB9615]
 gi|293406175|ref|ZP_06650101.1| glycine betaine transporter membrane protein [Escherichia coli
           FVEC1412]
 gi|293412036|ref|ZP_06654759.1| glycine betaine transporter membrane protein [Escherichia coli
           B354]
 gi|298381912|ref|ZP_06991509.1| glycine betaine transporter membrane protein [Escherichia coli
           FVEC1302]
 gi|300898659|ref|ZP_07116980.1| ABC transporter, permease protein [Escherichia coli MS 198-1]
 gi|300941046|ref|ZP_07155565.1| ABC transporter, permease protein [Escherichia coli MS 21-1]
 gi|301306005|ref|ZP_07212085.1| ABC transporter, permease protein [Escherichia coli MS 124-1]
 gi|301327382|ref|ZP_07220631.1| ABC transporter, permease protein [Escherichia coli MS 78-1]
 gi|306812441|ref|ZP_07446639.1| glycine betaine transporter membrane protein [Escherichia coli
           NC101]
 gi|331648399|ref|ZP_08349487.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli M605]
 gi|331654161|ref|ZP_08355161.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli M718]
 gi|331658789|ref|ZP_08359731.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA206]
 gi|331669416|ref|ZP_08370262.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA271]
 gi|12517117|gb|AAG57788.1|AE005496_11 high-affinity transport system for glycine betaine and proline
           [Escherichia coli O157:H7 str. EDL933]
 gi|13363012|dbj|BAB36964.1| high-affinity glycine betaine / proline transport system protein
           [Escherichia coli O157:H7 str. Sakai]
 gi|187769535|gb|EDU33379.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4196]
 gi|188014969|gb|EDU53091.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|189003312|gb|EDU72298.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|189357321|gb|EDU75740.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|189362133|gb|EDU80552.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|189367256|gb|EDU85672.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|189372114|gb|EDU90530.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC869]
 gi|189377180|gb|EDU95596.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC508]
 gi|192926388|gb|EDV81023.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli E22]
 gi|194414143|gb|EDX30419.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli B171]
 gi|208727391|gb|EDZ76992.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208735374|gb|EDZ84061.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208740295|gb|EDZ87977.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209157762|gb|ACI35195.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|209762218|gb|ACI79421.1| high-affinity glycine betaine / proline transport system protein
           [Escherichia coli]
 gi|209762220|gb|ACI79422.1| high-affinity glycine betaine / proline transport system protein
           [Escherichia coli]
 gi|209762222|gb|ACI79423.1| high-affinity glycine betaine / proline transport system protein
           [Escherichia coli]
 gi|209762224|gb|ACI79424.1| high-affinity glycine betaine / proline transport system protein
           [Escherichia coli]
 gi|209762226|gb|ACI79425.1| high-affinity glycine betaine / proline transport system protein
           [Escherichia coli]
 gi|217319360|gb|EEC27785.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|218371159|emb|CAR18990.1| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli IAI39]
 gi|218428370|emb|CAR09299.2| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli ED1a]
 gi|218433275|emb|CAR14175.1| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli UMN026]
 gi|222034378|emb|CAP77119.1| glycine betaine/L-proline transport system permease [Escherichia
           coli LF82]
 gi|254594025|gb|ACT73386.1| glycine betaine transporter subunit; membrane component of ABC
           superfamily [Escherichia coli O157:H7 str. TW14359]
 gi|257760473|dbj|BAI31970.1| high-affinity transport system for glycine betaine and proline,
           membrane component [Escherichia coli O103:H2 str. 12009]
 gi|290763884|gb|ADD57845.1| Glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli O55:H7 str. CB9615]
 gi|291426181|gb|EFE99213.1| glycine betaine transporter membrane protein [Escherichia coli
           FVEC1412]
 gi|291468807|gb|EFF11298.1| glycine betaine transporter membrane protein [Escherichia coli
           B354]
 gi|298277052|gb|EFI18568.1| glycine betaine transporter membrane protein [Escherichia coli
           FVEC1302]
 gi|300357687|gb|EFJ73557.1| ABC transporter, permease protein [Escherichia coli MS 198-1]
 gi|300454210|gb|EFK17703.1| ABC transporter, permease protein [Escherichia coli MS 21-1]
 gi|300838716|gb|EFK66476.1| ABC transporter, permease protein [Escherichia coli MS 124-1]
 gi|300846036|gb|EFK73796.1| ABC transporter, permease protein [Escherichia coli MS 78-1]
 gi|305854479|gb|EFM54917.1| glycine betaine transporter membrane protein [Escherichia coli
           NC101]
 gi|312947213|gb|ADR28040.1| glycine betaine transporter membrane protein [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315254454|gb|EFU34422.1| ABC transporter, permease protein [Escherichia coli MS 85-1]
 gi|315298698|gb|EFU57952.1| ABC transporter, permease protein [Escherichia coli MS 16-3]
 gi|320189009|gb|EFW63668.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Escherichia coli O157:H7 str. EC1212]
 gi|320640667|gb|EFX10203.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. G5101]
 gi|320646032|gb|EFX15009.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H- str. 493-89]
 gi|320651332|gb|EFX19763.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H- str. H 2687]
 gi|320656723|gb|EFX24611.1| glycine betaine transporter membrane protein [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320662266|gb|EFX29663.1| glycine betaine transporter membrane protein [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320667317|gb|EFX34275.1| glycine betaine transporter membrane protein [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323159819|gb|EFZ45791.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli E128010]
 gi|323188440|gb|EFZ73726.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli RN587/1]
 gi|323966930|gb|EGB62358.1| inner membrane transport system [Escherichia coli M863]
 gi|323978711|gb|EGB73793.1| inner membrane transport system [Escherichia coli TW10509]
 gi|324005775|gb|EGB74994.1| ABC transporter, permease protein [Escherichia coli MS 57-2]
 gi|326338607|gb|EGD62433.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Escherichia coli O157:H7 str. 1044]
 gi|326342865|gb|EGD66633.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Escherichia coli O157:H7 str. 1125]
 gi|327251396|gb|EGE63082.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli STEC_7v]
 gi|330908709|gb|EGH37223.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Escherichia coli AA86]
 gi|331042146|gb|EGI14288.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli M605]
 gi|331047543|gb|EGI19620.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli M718]
 gi|331053371|gb|EGI25400.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA206]
 gi|331063084|gb|EGI34997.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA271]
          Length = 354

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|301050521|ref|ZP_07197397.1| ABC transporter, permease protein [Escherichia coli MS 185-1]
 gi|300297777|gb|EFJ54162.1| ABC transporter, permease protein [Escherichia coli MS 185-1]
          Length = 354

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|218675844|ref|YP_002394663.1| ABC transporter: transmembrane protein [Vibrio splendidus LGP32]
 gi|218324112|emb|CAV25283.1| ABC transporter: transmembrane protein [Vibrio splendidus LGP32]
          Length = 280

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 190/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I +  IP+G +++     LT N   F + +S  L   +  ++ V +++PP + + + 
Sbjct: 1   MNFITENKIPVGQWMEAGVDWLTINAAGFFDAISIFLETVIMFLVDVFKWMPPALPIVIT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + R  ++ +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++AA 
Sbjct: 61  AAIAWYLHRKPSLVIFVVAALLTILNLGYWQEMLETFVLVFAATTISVLIGVPVGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+  
Sbjct: 121 RPWLYTVLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELIEAGKAFGASRMKLLMKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKE 279


>gi|170680258|ref|YP_001744829.1| glycine betaine transporter membrane protein [Escherichia coli
           SMS-3-5]
 gi|170517976|gb|ACB16154.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli SMS-3-5]
          Length = 354

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRLPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|194433050|ref|ZP_03065333.1| glycine betaine/L-proline ABC transporter, permease protein
           [Shigella dysenteriae 1012]
 gi|194418777|gb|EDX34863.1| glycine betaine/L-proline ABC transporter, permease protein
           [Shigella dysenteriae 1012]
 gi|332087399|gb|EGI92527.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella boydii 5216-82]
 gi|332088693|gb|EGI93806.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella dysenteriae 155-74]
          Length = 354

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIIIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|311278367|ref|YP_003940598.1| binding-protein-dependent transport systems inner membrane
           component [Enterobacter cloacae SCF1]
 gi|308747562|gb|ADO47314.1| binding-protein-dependent transport systems inner membrane
           component [Enterobacter cloacae SCF1]
          Length = 354

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++      +  +       +   +   ++    +L  +P    + + 
Sbjct: 54  MDPFHKTLIPLDSWVTHGIDWVVMHFRPLFQGIRVPVDYILSAFQQLLLGMPAPAAIVLF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +  +  + V T   L LI   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQIGGA-GMGVATLASLFLIGAIGAWSQAMVTLALVLTALLFCVIIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATIGGVGIVILAIILDRLTQAVGRDSR 332


>gi|254505697|ref|ZP_05117843.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           16]
 gi|219551350|gb|EED28329.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           16]
          Length = 280

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 134/279 (48%), Positives = 188/279 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG +++     LT N     + +S  L   +  V+   +++PP + + + 
Sbjct: 1   MNFITDNKIPLGQWMEAGVDWLTDNAAGLFDAISIFLETIILFVVDGFKWMPPAMPILMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + +     LL I+  GYW+E  ET  LV  +T IS+ +GVPLG++AA 
Sbjct: 61  AAIAWYLHRSIPLVLFIVAALLTILNLGYWEEMLETFVLVFAATTISVLVGVPLGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGAT  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELVEAGKAFGATRMKLLFKVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKSPNQKE 279


>gi|26249073|ref|NP_755113.1| glycine betaine transporter membrane protein [Escherichia coli
           CFT073]
 gi|215487999|ref|YP_002330430.1| glycine betaine transporter membrane protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|227888212|ref|ZP_04006017.1| glycine betaine transporter membrane protein [Escherichia coli
           83972]
 gi|301019056|ref|ZP_07183267.1| ABC transporter, permease protein [Escherichia coli MS 69-1]
 gi|312965593|ref|ZP_07779823.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 2362-75]
 gi|331664235|ref|ZP_08365141.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA143]
 gi|331674199|ref|ZP_08374959.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA280]
 gi|331684296|ref|ZP_08384888.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli H299]
 gi|26109480|gb|AAN81683.1|AE016765_85 Glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli CFT073]
 gi|215266071|emb|CAS10491.1| high-affinity transport system for glycine betaine and proline;
           membrane component of ABC superfamily [Escherichia coli
           O127:H6 str. E2348/69]
 gi|227834852|gb|EEJ45318.1| glycine betaine transporter membrane protein [Escherichia coli
           83972]
 gi|284922620|emb|CBG35708.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli 042]
 gi|300399409|gb|EFJ82947.1| ABC transporter, permease protein [Escherichia coli MS 69-1]
 gi|307554654|gb|ADN47429.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli ABU 83972]
 gi|312289742|gb|EFR17632.1| glycine betaine/L-proline transport system permease protein proW
           [Escherichia coli 2362-75]
 gi|331058166|gb|EGI30147.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA143]
 gi|331068293|gb|EGI39688.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli TA280]
 gi|331077911|gb|EGI49117.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli H299]
          Length = 354

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|315291003|gb|EFU50368.1| ABC transporter, permease protein [Escherichia coli MS 153-1]
          Length = 327

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 27  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 86

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 87  ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 145

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 146 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 205

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 206 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 265

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 266 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 305


>gi|114762783|ref|ZP_01442217.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Pelagibaca bermudensis HTCC2601]
 gi|114544693|gb|EAU47699.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Roseovarius sp. HTCC2601]
          Length = 278

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 139/278 (50%), Positives = 190/278 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+GD     F  +  NGE   + LS  +   ++ +L++LQ  P L+ +   
Sbjct: 1   MQWLTDYKIPVGDAASAVFEWVRDNGEVVLDALSTFMEAMIDAILWILQEPPELIVILTF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             +   ++R+   A+    G L I+ Q YW+ETTE+L+LVL S  + M IGVP+G+ AA 
Sbjct: 61  VAITYALQRNWKTALFVFAGFLFILNQDYWEETTESLTLVLSSCLVCMAIGVPIGIYAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P+ Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LG+ S
Sbjct: 121 RPKVYTYLRPILDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTYLGVSS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGATP Q   KVELP+A+PQI+A L QTIMLSLSMVVV ALVG++GLGV
Sbjct: 181 TPKALLEAATAFGATPTQTLYKVELPYAVPQIMAGLNQTIMLSLSMVVVAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+RALN V+   GFESG  IV++AI+LDR+ ++   +
Sbjct: 241 PVVRALNQVNTALGFESGFVIVVVAIMLDRILNVGGRK 278


>gi|163795907|ref|ZP_02189871.1| putative BC-type proline/glycine betaine transport system, permease
           component [alpha proteobacterium BAL199]
 gi|159178940|gb|EDP63476.1| putative BC-type proline/glycine betaine transport system, permease
           component [alpha proteobacterium BAL199]
          Length = 288

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 141/281 (50%), Positives = 190/281 (67%), Gaps = 4/281 (1%)

Query: 1   MSPI----IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVF 56
           M PI        + LG  ++ F   LT N        S  L  A+  V+++L  +PP+  
Sbjct: 1   MDPISAFVEDHKLGLGRGVKTFVEWLTDNFYAQFRAFSDSLGWAIEGVIWLLSVVPPIAL 60

Query: 57  VCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGV 116
           + +V+ L   + RSI +      GLLLI+  GYW+ TTETL+LVL +T + + IGVP+G+
Sbjct: 61  IALVAGLAWWLHRSIGLVALVVAGLLLILNLGYWEATTETLALVLSATLVCVLIGVPVGI 120

Query: 117 LAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRL 176
            AA    FYS IR  LD MQTIPTFVYLIP L+LFGLG+VPG+++T+VF++P  +RLT L
Sbjct: 121 YAAHNRWFYSGIRPILDLMQTIPTFVYLIPTLMLFGLGVVPGLISTVVFAVPAPIRLTEL 180

Query: 177 GIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSN 236
           G+ + P  L EA  AFGAT +Q+  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG+N
Sbjct: 181 GVRNVPKPLIEAGEAFGATRWQLLLKVELPHAMPTIMAGVTQCIMLSLSMVVIAALVGAN 240

Query: 237 GLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           GLG PV+RALNTV+I +GFE+GL IVI+AI++DR+    + 
Sbjct: 241 GLGKPVVRALNTVNIAQGFEAGLAIVIVAILMDRIMRQSER 281


>gi|24113982|ref|NP_708492.1| glycine betaine transporter membrane protein [Shigella flexneri 2a
           str. 301]
 gi|30064045|ref|NP_838216.1| glycine betaine transporter membrane protein [Shigella flexneri 2a
           str. 2457T]
 gi|110806689|ref|YP_690209.1| glycine betaine transporter membrane protein [Shigella flexneri 5
           str. 8401]
 gi|24053095|gb|AAN44199.1| glycine betaine/L-proline transport system permease protein
           [Shigella flexneri 2a str. 301]
 gi|30042301|gb|AAP18026.1| glycine betaine/L-proline transport system permease protein
           [Shigella flexneri 2a str. 2457T]
 gi|110616237|gb|ABF04904.1| high-affinity transport system for glycine betaine and proline
           [Shigella flexneri 5 str. 8401]
 gi|281602054|gb|ADA75038.1| putative ABC-type proline/glycine betaine transport system,
           permease component [Shigella flexneri 2002017]
 gi|313648328|gb|EFS12772.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri 2a str. 2457T]
 gi|332753396|gb|EGJ83776.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri 4343-70]
 gi|332753903|gb|EGJ84278.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri K-671]
 gi|332755699|gb|EGJ86062.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri 2747-71]
 gi|332765628|gb|EGJ95841.1| binding--dependent transport system inner membrane component family
           protein [Shigella flexneri 2930-71]
 gi|333000638|gb|EGK20215.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri K-218]
 gi|333015889|gb|EGK35225.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella flexneri K-304]
          Length = 354

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALITWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|148653178|ref|YP_001280271.1| glycine betaine ABC transporter substrate-binding protein
           [Psychrobacter sp. PRwf-1]
 gi|148572262|gb|ABQ94321.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Psychrobacter sp. PRwf-1]
          Length = 652

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 100/267 (37%), Positives = 162/267 (60%), Gaps = 1/267 (0%)

Query: 15  LQEFFVCLTQNGEWFCNILSFI-LLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITI 73
           L      + QN       +S   L   +  +  ++   PP + + +V+LL  +  R I  
Sbjct: 370 LNNSLSYVVQNFGTVFRSISHGTLTYLLLPIEKLMHLTPPWLIIGLVALLGWLATRKIWF 429

Query: 74  AVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLD 133
           AV  A+GL LI   G W    +T++L++VS  ++M +G+P+G+L A       ++   LD
Sbjct: 430 AVSCALGLFLIGAFGLWPALVQTMALLIVSVIVTMVVGIPMGILMAGSSSLRKVVTPVLD 489

Query: 134 SMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFG 193
            MQT+P+FVYLIP L+LFG+G VP + ATI++++P  +RLT LGI   P  + EA  +FG
Sbjct: 490 VMQTMPSFVYLIPVLMLFGIGKVPALFATIIYALPPLIRLTMLGIKQVPHEMIEAGRSFG 549

Query: 194 ATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGR 253
           +   Q+   ++LP A+P I+A + Q +M+SLSMVV+ +++G+ GLG  VL+++ T++IG+
Sbjct: 550 SNHKQLLIWIKLPQALPSIMAGINQAVMMSLSMVVLASMIGAPGLGEDVLQSIQTLNIGQ 609

Query: 254 GFESGLCIVILAIILDRLFSIPDPRDR 280
           G ++G  IVI+AII+DR+        R
Sbjct: 610 GLQAGTAIVIMAIIIDRITQAFGQGRR 636


>gi|170017667|ref|YP_001728586.1| ABC-type proline/glycine betaine transport system, permease
           component [Leuconostoc citreum KM20]
 gi|169804524|gb|ACA83142.1| ABC-type proline/glycine betaine transport system, permease
           component [Leuconostoc citreum KM20]
          Length = 568

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 104/272 (38%), Positives = 168/272 (61%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL D + +    LT +     N++  +    ++ +   L  +P  + +  ++L+ ++ 
Sbjct: 6   QLPLEDIVTKGVNWLTNHLSGLFNLMQHVGQTVMDGMTNALVAVPMPLMIAGITLIAILT 65

Query: 68  K-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
             +     + T +GL +I  Q  W +   TL+LV++++ IS+ IG+PLG++ A  P+  +
Sbjct: 66  TPKKYGFPLFTFVGLAIIANQNLWDDLMSTLTLVIMASVISLVIGIPLGIITAKSPKTAA 125

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           +++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI   P  L 
Sbjct: 126 VVKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTDLGIRQVPVSLV 185

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T +Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GLG  VL A+
Sbjct: 186 EAADSFGSTTWQKLIKLELPSARNTILAGANQTIMLALSMVVTASMIGAPGLGRGVLSAV 245

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
              +IG GF +GL +VILAII+DR     + +
Sbjct: 246 QHANIGSGFVNGLGLVILAIIIDRFTQKLNSK 277


>gi|225869714|ref|YP_002745661.1| glycine-betaine binding permease protein [Streptococcus equi subsp.
           equi 4047]
 gi|225699118|emb|CAW92301.1| putative glycine-betaine binding permease protein [Streptococcus
           equi subsp. equi 4047]
          Length = 576

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 112/279 (40%), Positives = 174/279 (62%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++Q  +P+   +++    LT+    F ++L  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   MENLLQTTLPVAQLVEQLTEWLTKTFSGFFDLLQLVGNALMDWITQTLLFINPLLFMLLV 60

Query: 61  -SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
              +  + ++   + + T +GLL +  QG W E   T +LVLV++ IS+ +G+PLG+  A
Sbjct: 61  TCAMFFLARKKWPLPIFTLLGLLFVYNQGLWAELINTFTLVLVASLISVLLGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                + +I   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L + 
Sbjct: 121 KNKIVHQVINPMLDLMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLALR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+TP Q   KVELP A   ++A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 HIPTELVEASDAFGSTPKQKLLKVELPLAKHTMMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIGRGF SGL +VILAIILDR+    + +
Sbjct: 241 REVLSALQHADIGRGFVSGLALVILAIILDRMTQHFNGK 279


>gi|296111716|ref|YP_003622098.1| betaine ABC transporter permease and substrate binding protein
           [Leuconostoc kimchii IMSNU 11154]
 gi|295833248|gb|ADG41129.1| betaine ABC transporter permease and substrate binding protein
           [Leuconostoc kimchii IMSNU 11154]
          Length = 568

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 107/269 (39%), Positives = 166/269 (61%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL +++ +    LT +     N++       ++ +   L  +P  + +  ++L+ ++ 
Sbjct: 6   KIPLENWISDIVSWLTTHLSGLFNLMQKGGQNVMDGITNGLTAVPMPLMIIGLTLIAVLT 65

Query: 68  KRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            R      + T +GL LI  Q  W +   T++LV++++ IS+ IG+PLG+L A  P+  +
Sbjct: 66  TRKKYGFPIFTFIGLALIANQNLWSDLMSTVTLVIMASVISLVIGIPLGILTAKSPKTAA 125

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI   P  L 
Sbjct: 126 IVKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTDLGIRQVPIALV 185

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T +Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GLG  VL A+
Sbjct: 186 EAADSFGSTTWQKLIKLELPNARNTILAGANQTIMLALSMVVTASMIGAPGLGRGVLSAV 245

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIP 275
              D+G GF +GL +VILAII+DR     
Sbjct: 246 QRADVGSGFVNGLGLVILAIIIDRFTQKL 274


>gi|326692454|ref|ZP_08229459.1| ABC-type proline/glycine betaine transport system, permease
           component [Leuconostoc argentinum KCTC 3773]
          Length = 568

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 107/269 (39%), Positives = 166/269 (61%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL D++      LT +     N++  +    ++ +   L  +P  + +  ++L+ ++ 
Sbjct: 6   KLPLEDWVTAGVNWLTNHLSGLFNVMQHVGQAVMDGLTNGLTAIPMPLMIAGITLIAILT 65

Query: 68  K-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
             + I     T  GL ++  Q  W++   TL+LV++++ IS+ IG+PLG+L A  P+  +
Sbjct: 66  TPKKIGFPAFTFFGLAIVANQNLWEDLMSTLTLVIMASVISLVIGIPLGILTAKSPKTAA 125

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI   P  L 
Sbjct: 126 IVKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTDLGIRQVPVSLV 185

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T +Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GLG  VL A+
Sbjct: 186 EAADSFGSTTWQKLIKLELPSARNTILAGANQTIMLALSMVVTASMIGAPGLGRGVLSAV 245

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIP 275
              DIG GF +GL +VILAII+DR     
Sbjct: 246 QHADIGLGFVNGLGLVILAIIIDRFTQKL 274


>gi|239932299|ref|ZP_04689252.1| glycine betaine transport system permease protein [Streptomyces
           ghanaensis ATCC 14672]
 gi|291440664|ref|ZP_06580054.1| glycine betaine transport system permease protein [Streptomyces
           ghanaensis ATCC 14672]
 gi|291343559|gb|EFE70515.1| glycine betaine transport system permease protein [Streptomyces
           ghanaensis ATCC 14672]
          Length = 872

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 106/269 (39%), Positives = 156/269 (57%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD++      L  N  W  +    +   A + V   LQ   PL+   + +++   +
Sbjct: 3   RIPLGDWVNTAVDWLLANVTWLFDFFKAVFTGAYDGVNAALQAPEPLLLAGIFAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     V T +G   +     W+++  TL+LV+V+T I++ I VP+G+ AA   R  ++
Sbjct: 63  -RGTFAGVLTFVGFAFLDSLELWEDSMVTLALVIVATVIALVISVPVGIWAARSDRVSAM 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G  PGIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTLPAMIYLIPAILFFGTGPAPGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V+ A+ 
Sbjct: 182 AAEAFGTTPRNTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGAVIEAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ++IG G ESG+ IVILAI LDR+ S   
Sbjct: 242 QLNIGLGAESGIAIVILAIYLDRMTSALG 270


>gi|74313249|ref|YP_311668.1| glycine betaine transporter membrane protein [Shigella sonnei
           Ss046]
 gi|73856726|gb|AAZ89433.1| high-affinity transport system for glycine betaine and proline
           [Shigella sonnei Ss046]
 gi|323167147|gb|EFZ52865.1| glycine betaine/L-proline transport system permease protein proW
           [Shigella sonnei 53G]
          Length = 354

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNSFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|52424605|ref|YP_087742.1| ProW protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306657|gb|AAU37157.1| ProW protein [Mannheimia succiniciproducens MBEL55E]
          Length = 338

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 114/277 (41%), Positives = 163/277 (58%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +P GD+++     L  +   F   +S  +   ++L    L  LPP V + + 
Sbjct: 40  MYPFDHTLVPFGDWVESLINWLVTHLRSFFQFISAPIDYILSLFQTSLNVLPPTVMIILF 99

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LLV        +A+ T + + LI   G W E   TL+LVL S    + IG+PLG+  A 
Sbjct: 100 TLLVWQFT-HFRLALATLLSITLIGAVGAWNEMMITLALVLTSVSFCLLIGLPLGIWMAR 158

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  +I++  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 159 STRASAIVKPVLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIQQ 218

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFGA+  Q+  KV+LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 219 VPEALIEAAQAFGASKKQLLYKVQLPLAMPSIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 278

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            VLR +  +D+G     GL IV++AI+LDRL      
Sbjct: 279 MVLRGIGRLDMGEAATGGLGIVLMAIVLDRLTQKIAE 315


>gi|295097267|emb|CBK86357.1| ABC-type proline/glycine betaine transport system, permease
           component [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 354

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    ++  +P  V + + 
Sbjct: 54  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGIRIPVDYILNGFQQLMLGMPAPVAIILF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SL+      S  + + T + L+ I   G W +   TL+LVL +    + IG+P+G+  A 
Sbjct: 114 SLIAWQFG-SAGMGIATLISLIAIGAIGAWSQAMITLALVLTALLFCVVIGLPMGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|218547805|ref|YP_002381596.1| glycine betaine transporter membrane protein [Escherichia
           fergusonii ATCC 35469]
 gi|218355346|emb|CAQ87953.1| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia fergusonii ATCC 35469]
 gi|324111312|gb|EGC05294.1| inner membrane transport system [Escherichia fergusonii B253]
 gi|325496272|gb|EGC94131.1| glycine betaine transporter membrane protein [Escherichia
           fergusonii ECD227]
          Length = 354

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  + + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPMAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|91212039|ref|YP_542025.1| glycine betaine transporter membrane protein [Escherichia coli
           UTI89]
 gi|110642804|ref|YP_670534.1| glycine betaine transporter membrane protein [Escherichia coli 536]
 gi|117624914|ref|YP_853857.1| glycine betaine transporter membrane protein [Escherichia coli APEC
           O1]
 gi|191171377|ref|ZP_03032926.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli F11]
 gi|218559670|ref|YP_002392583.1| glycine betaine transporter membrane protein [Escherichia coli S88]
 gi|237706700|ref|ZP_04537181.1| high-affinity transport system for glycine betaine and proline
           [Escherichia sp. 3_2_53FAA]
 gi|300990598|ref|ZP_07179248.1| ABC transporter, permease protein [Escherichia coli MS 200-1]
 gi|91073613|gb|ABE08494.1| high-affinity transport system for glycine betaine and proline
           [Escherichia coli UTI89]
 gi|110344396|gb|ABG70633.1| glycine betaine/L-proline transport system permease protein ProW
           [Escherichia coli 536]
 gi|115514038|gb|ABJ02113.1| glycine betaine/L-proline transport system permease protein P
           [Escherichia coli APEC O1]
 gi|190908311|gb|EDV67901.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli F11]
 gi|218366439|emb|CAR04191.1| glycine betaine transporter subunit ; membrane component of ABC
           superfamily [Escherichia coli S88]
 gi|226899740|gb|EEH85999.1| high-affinity transport system for glycine betaine and proline
           [Escherichia sp. 3_2_53FAA]
 gi|294493392|gb|ADE92148.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia coli IHE3034]
 gi|300305715|gb|EFJ60235.1| ABC transporter, permease protein [Escherichia coli MS 200-1]
 gi|307625750|gb|ADN70054.1| glycine betaine transporter membrane protein [Escherichia coli
           UM146]
 gi|320194818|gb|EFW69447.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Escherichia coli WV_060327]
 gi|323951100|gb|EGB46976.1| inner membrane transport system [Escherichia coli H252]
 gi|323957109|gb|EGB52834.1| inner membrane transport system [Escherichia coli H263]
 gi|324014409|gb|EGB83628.1| ABC transporter, permease protein [Escherichia coli MS 60-1]
          Length = 354

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPSQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|315284931|gb|EFU44376.1| ABC transporter, permease protein [Escherichia coli MS 110-3]
          Length = 354

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 160/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGANPSQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|190892828|ref|YP_001979370.1| proline/glycine betaine ABC transporter permease [Rhizobium etli
           CIAT 652]
 gi|190698107|gb|ACE92192.1| proline/glycine betaine ABC transporter, permease protein
           [Rhizobium etli CIAT 652]
 gi|327189486|gb|EGE56642.1| proline/glycine betaine ABC transporter, permease protein
           [Rhizobium etli CNPAF512]
          Length = 281

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 175/277 (63%), Positives = 217/277 (78%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I  + IP+G + + F   LT NGEWF N L+F+L   ++ +LFVLQ   PL+ + V+
Sbjct: 1   MNWITDSKIPIGSWAKAFVDWLTSNGEWFFNQLAFLLSHVIDGLLFVLQKPHPLIVIAVI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           S L   ++RSI I + T +GLLLI+ QGYW+ETTETL+LVL STF+SM IG+PLG+ AA 
Sbjct: 61  SALAFWLRRSIGITLFTCLGLLLIMNQGYWKETTETLALVLASTFVSMVIGIPLGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               Y+ +R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWIYAAMRPVLDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA AFGA P QV RKVELPFA PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPSLVEAAVAFGARPVQVLRKVELPFATPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV++ +GFE+GLCIVILAIILDR+F     
Sbjct: 241 PVVRALNTVNVAKGFEAGLCIVILAIILDRMFRTAGE 277


>gi|86144740|ref|ZP_01063072.1| putative permease of ABC transporter [Vibrio sp. MED222]
 gi|85837639|gb|EAQ55751.1| putative permease of ABC transporter [Vibrio sp. MED222]
          Length = 280

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 190/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I +  IP+G +++     LT N   F + +S  L   +  ++ V +++PP + + + 
Sbjct: 1   MNFITENKIPVGQWMEAGVDWLTINAAGFFDAISIFLETVIMFLVDVFKWMPPALPIVMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + R  ++ +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++AA 
Sbjct: 61  AAIAWYLHRKPSLVIFVVAALLTILNLGYWQEMLETFVLVFAATTISVLIGVPVGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+  
Sbjct: 121 RPWLYTVLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELIEAGKAFGASRMKLLMKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKE 279


>gi|281179685|dbj|BAI56015.1| glycine/betaine/proline ABC transporter permease component
           [Escherichia coli SE15]
          Length = 354

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPSQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 332


>gi|115380392|ref|ZP_01467388.1| ABC-type proline/glycine betaine transport system, periplasmic
           component [Stigmatella aurantiaca DW4/3-1]
 gi|115362604|gb|EAU61843.1| ABC-type proline/glycine betaine transport system, periplasmic
           component [Stigmatella aurantiaca DW4/3-1]
          Length = 586

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 139/273 (50%), Positives = 189/273 (69%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
             +PLGD+L+     +T +       +S  +   +   + +L  +PPLV +   +L+   
Sbjct: 311 HKLPLGDWLERVIRFITAHFTGELRAISRAVTWLLESSVNLLLRIPPLVLIGATALVTYA 370

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
           ++R + +AV    G LLI   GYWQ T ETL LVLV+T +S+ +GVPLG++AA  PRFY+
Sbjct: 371 LRRGLALAVAIVAGGLLIWDLGYWQPTMETLVLVLVATALSLLLGVPLGIVAARRPRFYA 430

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           ++RL LD MQTIPTFVYLIP L+LFGLG+VPG+++T+VF +P  +RLT LGI S P  + 
Sbjct: 431 VLRLLLDLMQTIPTFVYLIPTLMLFGLGVVPGLLSTVVFVLPAPIRLTYLGITSVPKEMI 490

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EA  AFGA P Q+  K+ELP+A   I+  +TQ +MLSLSMVV+ ALVG+ GLG  V+RAL
Sbjct: 491 EAGEAFGARPLQLLVKIELPYARKAILEGVTQALMLSLSMVVIAALVGAGGLGSRVVRAL 550

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           NTVDI +GFE+GL IVILAI+LDR+F  P P+ 
Sbjct: 551 NTVDIRQGFEAGLVIVILAILLDRMFKHPAPQR 583


>gi|89076527|ref|ZP_01162838.1| ABC-type proline/glycine betaine transport system, permease
           component [Photobacterium sp. SKA34]
 gi|330448148|ref|ZP_08311796.1| choline ABC transporter, permease protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|89047803|gb|EAR53400.1| ABC-type proline/glycine betaine transport system, permease
           component [Photobacterium sp. SKA34]
 gi|328492339|dbj|GAA06293.1| choline ABC transporter, permease protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 280

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 135/279 (48%), Positives = 190/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG +++     LT N     + +SF L   +  ++ V +++PP + + + 
Sbjct: 1   MNFITDNKIPLGQWMEAGVDWLTINAAGLFDAISFFLETVILFLVDVFKWMPPALPILIT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   + R I++ V     LL+I+  GYWQE  ET  LV  +T IS+ IGVP+G+++A 
Sbjct: 61  AALAWYLHRKISLVVFVVAALLVILNLGYWQEMLETFVLVFAATSISVLIGVPIGIMSAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLMRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEDLIEAGKAFGASRMKLLLKVELPAAMPSIMAGITQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P  ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPAQKE 279


>gi|330956993|gb|EGH57253.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 281

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 133/276 (48%), Positives = 186/276 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IPLG+Y+  F   LT NG  + + ++  L   ++   F L +  PLV + +++ L
Sbjct: 2   LTDQKIPLGEYIAAFVDWLTANGADYFDAIASTLEMMIHGFTFALTWFNPLVLIGLIAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V   +  LLI+   YWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLVCVVIGVPLGIIAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+IIR  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTIIRPILDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG++  Q+  ++ELP+A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ + 
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAKK 277


>gi|323496152|ref|ZP_08101211.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           sinaloensis DSM 21326]
 gi|323318790|gb|EGA71742.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           sinaloensis DSM 21326]
          Length = 280

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 135/279 (48%), Positives = 189/279 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG +++     LT N     + +S  L   +  V+ + +++PP + + + 
Sbjct: 1   MNFITDNKIPLGQWMETGVDWLTDNAAGLFDAISIFLETIILFVVDIFKWMPPAMPIVMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++AA 
Sbjct: 61  AAIAWYLHRSIPLVLFVVAALLTILNLGYWQEMLETFVLVFAATTISVLIGVPVGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGAT  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELVEAGKAFGATRMKLLFKVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKSPNQKE 279


>gi|170765814|ref|ZP_02900625.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia albertii TW07627]
 gi|170124960|gb|EDS93891.1| glycine betaine/L-proline ABC transporter, permease protein
           [Escherichia albertii TW07627]
          Length = 353

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 162/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + + 
Sbjct: 53  MDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIILF 112

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +  +  + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 113 ALLAWQISGA-GMGVATLISLVAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 171

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 172 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 231

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 232 VPADLIEASRSFGASPHQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 291

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 292 MVLRGIGRLDMGLATVGGIGIVILAIILDRLTQAVGRDAR 331


>gi|90577630|ref|ZP_01233441.1| ABC-type proline/glycine betaine transport system, permease
           component [Vibrio angustum S14]
 gi|90440716|gb|EAS65896.1| ABC-type proline/glycine betaine transport system, permease
           component [Vibrio angustum S14]
          Length = 280

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 135/279 (48%), Positives = 190/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG +++     LT N     + +SF L   +  ++ V +++PP + + + 
Sbjct: 1   MNFITDNKIPLGQWMEAGVDWLTINAAGLFDAISFFLETVILFLVDVFKWMPPALPILIT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   + R I++ V     LL+I+  GYWQE  ET  LV  +T IS+ IGVP+G+++A 
Sbjct: 61  AALAWYLHRKISLVVFVVAALLVILNLGYWQEMLETFVLVFAATTISVLIGVPIGIMSAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLMRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEDLIEAGKAFGASRMKLLLKVELPAAMPSIMAGITQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P  ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPAQKE 279


>gi|323698733|ref|ZP_08110645.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio sp. ND132]
 gi|323458665|gb|EGB14530.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio desulfuricans ND132]
          Length = 276

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 117/276 (42%), Positives = 169/276 (61%), Gaps = 1/276 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
              A IPL  ++ +    L  N   F  +L + + + +      L  + PLV + VV LL
Sbjct: 2   FDNAIIPLDHWVSDAVEWLVDNYREFFQMLKWPVDRLLTGFEHGLTSVHPLVVIGVVCLL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+ +   +LL+   G W+ET  TL++VL S  I   IG+PLG+++    R
Sbjct: 62  AWKFSGK-RLALFSLASMLLVGFLGLWEETMITLAMVLSSVVICAVIGIPLGIMSGRSER 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           F + +R  LD+MQT P FVYL+P ++LF +G V G++ATI+F++P  +RLT LGI    P
Sbjct: 121 FEAGLRPVLDAMQTTPAFVYLVPIVMLFSVGNVAGVLATIIFALPPIIRLTGLGIRQVHP 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA AFGAT +QV  KV++P A+P I+A L QTIM++LSMVV+ AL+G+ GLG PV+
Sbjct: 181 ELVEAAQAFGATRWQVLVKVQIPLAMPTILAGLNQTIMMALSMVVIAALIGAGGLGSPVI 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
             LNT+DIGR    GL IV++AI+LDR+      + 
Sbjct: 241 LGLNTLDIGRAVVGGLGIVLMAIVLDRITQSMARKK 276


>gi|310818711|ref|YP_003951069.1| ABC-type proline/glycine betaine transport system, periplasmic
           component [Stigmatella aurantiaca DW4/3-1]
 gi|309391783|gb|ADO69242.1| ABC-type proline/glycine betaine transport system, periplasmic
           component [Stigmatella aurantiaca DW4/3-1]
          Length = 595

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 139/273 (50%), Positives = 189/273 (69%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
             +PLGD+L+     +T +       +S  +   +   + +L  +PPLV +   +L+   
Sbjct: 320 HKLPLGDWLERVIRFITAHFTGELRAISRAVTWLLESSVNLLLRIPPLVLIGATALVTYA 379

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
           ++R + +AV    G LLI   GYWQ T ETL LVLV+T +S+ +GVPLG++AA  PRFY+
Sbjct: 380 LRRGLALAVAIVAGGLLIWDLGYWQPTMETLVLVLVATALSLLLGVPLGIVAARRPRFYA 439

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           ++RL LD MQTIPTFVYLIP L+LFGLG+VPG+++T+VF +P  +RLT LGI S P  + 
Sbjct: 440 VLRLLLDLMQTIPTFVYLIPTLMLFGLGVVPGLLSTVVFVLPAPIRLTYLGITSVPKEMI 499

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EA  AFGA P Q+  K+ELP+A   I+  +TQ +MLSLSMVV+ ALVG+ GLG  V+RAL
Sbjct: 500 EAGEAFGARPLQLLVKIELPYARKAILEGVTQALMLSLSMVVIAALVGAGGLGSRVVRAL 559

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           NTVDI +GFE+GL IVILAI+LDR+F  P P+ 
Sbjct: 560 NTVDIRQGFEAGLVIVILAILLDRMFKHPAPQR 592


>gi|300172857|ref|YP_003772022.1| OpuABC protein [Leuconostoc gasicomitatum LMG 18811]
 gi|299887235|emb|CBL91203.1| OpuABC [Leuconostoc gasicomitatum LMG 18811]
          Length = 568

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 104/272 (38%), Positives = 167/272 (61%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL  ++ E    LT +     N++       ++ +   L  +P  + +  ++++ ++ 
Sbjct: 6   KVPLESWISEGVNWLTTHLSGLFNLMQRSGQSIMDGLTNGLTAIPMPLMIAGLTVIAILT 65

Query: 68  K-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
             +     + T +GL LI  Q  W +   T++LV++++ IS+ IG+PLG++ A  P+  +
Sbjct: 66  TPKKYGFPLFTLIGLALIANQNLWSDLMSTVTLVIMASVISLVIGIPLGIITAKSPKTAA 125

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P  VR+T LGI   P  L 
Sbjct: 126 IVKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASIIFALPPMVRMTDLGIRQVPVALV 185

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T +Q   K+ELP A   I+A   QTIML+LSMVV  +++G+ GLG  VL A+
Sbjct: 186 EAADSFGSTTWQKLIKLELPNARNTILAGANQTIMLALSMVVTASMIGAPGLGRGVLSAV 245

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
              D+G GF +GL +VILAII+DR     + +
Sbjct: 246 QRADVGSGFVNGLGLVILAIIIDRFTQKLNTK 277


>gi|300986100|ref|ZP_07177716.1| ABC transporter, permease protein [Escherichia coli MS 45-1]
 gi|300407925|gb|EFJ91463.1| ABC transporter, permease protein [Escherichia coli MS 45-1]
          Length = 324

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 161/280 (57%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 24  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 83

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 84  ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 142

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 143 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 202

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 203 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 262

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 263 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGRDSR 302


>gi|256788772|ref|ZP_05527203.1| glycine betaine transport system permease protein [Streptomyces
           lividans TK24]
 gi|289772667|ref|ZP_06532045.1| glycine betaine transport system permease [Streptomyces lividans
           TK24]
 gi|289702866|gb|EFD70295.1| glycine betaine transport system permease [Streptomyces lividans
           TK24]
          Length = 872

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 104/269 (38%), Positives = 153/269 (56%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD++      L  N  W    L  I   A + +  VLQ   PL+   + +++   +
Sbjct: 3   RIPLGDWVNSTVDWLLDNVSWLFTFLKDIFTGAYDGINAVLQAPEPLLLAGIFAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     + +  G   I     W+    TL+L+LV+T I++ + VP+G+ AA   R  + 
Sbjct: 63  -RGTFAGILSFAGFAFIDSLELWENAMVTLALLLVATIIALVVAVPVGIWAARSDRVSAF 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G  PGIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTLPAMIYLIPAILFFGTGSAPGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V+ ++ 
Sbjct: 182 AAEAFGTTPGNTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGDVMESIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            +++G G E+GL IVILAI LDR+ S   
Sbjct: 242 QLNVGLGAEAGLAIVILAIYLDRMTSALG 270


>gi|171778758|ref|ZP_02919854.1| hypothetical protein STRINF_00706 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282715|gb|EDT48139.1| hypothetical protein STRINF_00706 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 571

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 169/281 (60%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +Q  +P+ D + +    +T+N          +    ++ +   L ++PPL+ + ++
Sbjct: 1   MDNFLQNSLPIEDIVDKGIDWITKNLAELFRFTQLVGNSVMDFISDTLSFIPPLLLLIII 60

Query: 61  SLLVLMVKRSIT-IAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           SLL  ++       A+  A+GLL I  QG W     T +LVL+++ +S+ IG+PLG+  A
Sbjct: 61  SLLAYIISNKKKNFALLVALGLLFIYNQGLWDGMINTFTLVLIASLMSIVIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              R  SI+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T LGI 
Sbjct: 121 KSDRVRSIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EAA +FG+T  Q   KVELP A   I+A + QTIML+LSMVV  +++G+ GLG
Sbjct: 181 EIPEELIEAAESFGSTEGQRLFKVELPLAKNTILAGVNQTIMLALSMVVTASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
             VL AL   +IG GF SGL +VILAII+DR     +   R
Sbjct: 241 NGVLSALQHAEIGAGFVSGLALVILAIIIDRFIQYMNQPQR 281


>gi|254387391|ref|ZP_05002638.1| glycine betaine ABC transport system permease [Streptomyces sp.
           Mg1]
 gi|194346183|gb|EDX27149.1| glycine betaine ABC transport system permease [Streptomyces sp.
           Mg1]
          Length = 598

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 112/271 (41%), Positives = 163/271 (60%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG ++      L ++  W  + +S ++    + +  VL    PL+   ++++    +
Sbjct: 3   RLPLGSWVDTGVEFLQRHLSWLFDAISTVVTGLYDGIDAVLSAPAPLLLAGILAVAAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  A+    G  L+   G W E   TLSLVLV+T I++ I VPLG+ A+   R  ++
Sbjct: 63  -RGLLAALLAMAGFALVDSIGLWDEAMSTLSLVLVATLITLVISVPLGIWASRSDRVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+FS+P  VR+T LGI      L E
Sbjct: 122 LRPVLDFMQTMPAMVYLIPGIIFFGVGVVPGIIATIIFSLPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V +A+ 
Sbjct: 182 AADAFGTTPRDTLVRVQLPLALPTIMAGVNQVIMLGLSMVVIAGMVGGGGLGGAVYKAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VDIG GFE+G+ IVILA+ LDR+      +
Sbjct: 242 NVDIGLGFEAGISIVILAMYLDRMTGALGRQ 272


>gi|21220116|ref|NP_625895.1| glycine betaine transport system permease [Streptomyces coelicolor
           A3(2)]
 gi|6119662|emb|CAB59473.1| glycine betaine transport system permease protein [Streptomyces
           coelicolor A3(2)]
          Length = 871

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 104/269 (38%), Positives = 153/269 (56%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD++      L  N  W    L  I   A + +  VLQ   PL+   + +++   +
Sbjct: 3   RIPLGDWVNSTVDWLLDNVSWLFTFLKDIFTGAYDGINAVLQAPEPLLLAGIFAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     + +  G   I     W+    TL+L+LV+T I++ + VP+G+ AA   R  + 
Sbjct: 63  -RGTFAGILSFAGFAFIDSLELWENAMVTLALLLVATIIALVVAVPVGIWAARSDRVSAF 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  +YLIPA++ FG G  PGIVAT++F++   VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTLPAMIYLIPAILFFGTGSAPGIVATLIFALAPGVRMTELGIRQVDKELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V+ ++ 
Sbjct: 182 AAEAFGTTPGNTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGDVMESIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            +++G G E+GL IVILAI LDR+ S   
Sbjct: 242 QLNVGLGAEAGLAIVILAIYLDRMTSALG 270


>gi|222110194|ref|YP_002552458.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax ebreus TPSY]
 gi|221729638|gb|ACM32458.1| binding-protein-dependent transport systems inner membrane
           component [Acidovorax ebreus TPSY]
          Length = 400

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 107/277 (38%), Positives = 159/277 (57%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    +P+  ++ E    + +N   F   +   +   +  V  +L  +P    + +V+LL
Sbjct: 85  IATDGLPVQGWINEGLHWVVENFRPFFQAVRAPIDATLTGVTDLLLAVPAPALIALVTLL 144

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +AVG A+ L L+   G W +   TL+LVL S    + IG+P+G++ A   R
Sbjct: 145 AWQFAGR-GLAVGAALSLGLVALLGIWPDAMVTLALVLTSLLFCVVIGLPMGIVLAASER 203

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
                R  LD+MQT P FVYL+P ++LFG+G VPG++ TIVF++P  VRLT LG+    P
Sbjct: 204 AQRWTRPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIVFALPPLVRLTNLGLRQVRP 263

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ A+GA+P Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 264 DLIEASRAYGASPLQLLWKVQLPLAMPSIMAGINQALMLSLSMVVIASMIAVGGLGQMVL 323

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI+LDRL        R
Sbjct: 324 RGIGRLDMGLATVGGLGIVLLAIVLDRLTQAMGQPRR 360


>gi|320180199|gb|EFW55135.1| L-proline glycine betaine ABC transport system permease protein
           ProW [Shigella boydii ATCC 9905]
          Length = 354

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 108/277 (38%), Positives = 160/277 (57%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIIIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            VLR +  +D+G     G+ IVILAIILDRL      
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGR 329


>gi|66047934|ref|YP_237775.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|71734104|ref|YP_276848.1| glycine/betaine/L-proline ABC transporter permease [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257483034|ref|ZP_05637075.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289624806|ref|ZP_06457760.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289650617|ref|ZP_06481960.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298489209|ref|ZP_07007228.1| L-proline/glycine/betaine ABC transport system permease protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|63258641|gb|AAY39737.1| Binding-protein-dependent transport systems inner membrane
           component [Pseudomonas syringae pv. syringae B728a]
 gi|71554657|gb|AAZ33868.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298156291|gb|EFH97392.1| L-proline/glycine/betaine ABC transport system permease protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320326406|gb|EFW82459.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330619|gb|EFW86597.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330871164|gb|EGH05873.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330954941|gb|EGH55201.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae Cit 7]
 gi|330970917|gb|EGH70983.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330985873|gb|EGH83976.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331011730|gb|EGH91786.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 281

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 132/275 (48%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IPLG+Y+  F   LT NG  + + ++  L   ++   F L +  P V + +++ L
Sbjct: 2   LTDHKIPLGEYIAAFVDWLTANGADYFDAIASTLEMMIHGFTFALTWFNPFVLIGLIAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V   +  LLI+   YWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLVCVVIGVPLGIIAAHKPL 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+IIR  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTIIRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG++  Q+  ++ELP+A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ +
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAK 276


>gi|289672390|ref|ZP_06493280.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. syringae FF5]
 gi|302188551|ref|ZP_07265224.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. syringae 642]
 gi|330898813|gb|EGH30232.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330938581|gb|EGH42155.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330979968|gb|EGH78238.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 281

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 132/275 (48%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IPLG+Y+  F   LT NG  + + ++  L   ++   F L +  P V + +++ L
Sbjct: 2   LTDHKIPLGEYIAAFVDWLTANGADYFDAIASTLEMMIHGFTFALTWFNPFVLIGLIAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V   +  LLI+   YWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLVCVVIGVPLGIIAAHKPL 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+IIR  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTIIRPILDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG++  Q+  ++ELP+A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ +
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAK 276


>gi|148974204|ref|ZP_01811737.1| putative permease of ABC transporter [Vibrionales bacterium SWAT-3]
 gi|145965901|gb|EDK31149.1| putative permease of ABC transporter [Vibrionales bacterium SWAT-3]
          Length = 285

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 129/278 (46%), Positives = 189/278 (67%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
           + I +  IP+G +++     LT N   F + +S  L   +  ++ V +++PP + + + +
Sbjct: 7   NFITENKIPVGQWMEAGVDWLTINAAGFFDAISIFLETVILFLVDVFKWMPPALPIVITA 66

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
            +   + R +++ +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++AA  
Sbjct: 67  AIAWYLHRKLSLVIFVVAALLTILNLGYWQEMLETFVLVFAATTISVLIGVPVGIMAAHR 126

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+   
Sbjct: 127 PWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTKV 186

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+  LVG++GLG P
Sbjct: 187 PEELIEAGKAFGASRMKLLLKVELPAALPSIMAGVTQCIMLSLSMVVIATLVGADGLGKP 246

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           V+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 247 VVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKE 284


>gi|116512254|ref|YP_809470.1| ABC-type proline/glycine betaine transport system, permease
           component [Lactococcus lactis subsp. cremoris SK11]
 gi|116107908|gb|ABJ73048.1| ABC-type proline/glycine betaine transport system, permease
           component [Lactococcus lactis subsp. cremoris SK11]
          Length = 573

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 108/276 (39%), Positives = 168/276 (60%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++   IPL +++      +T       +++       +N +   L  +P  + + VV
Sbjct: 1   MIDLVIGKIPLANWVSSATDWITSTFSSGFDVIQKSGTVLMNGITGALTAVPFWLMIAVV 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++L ++V  +     + T +GL LI  QG W +   T++LVL+S+ +S+ IGVPLG+  A
Sbjct: 61  TILAILVSGKKFAFPLFTFIGLCLIANQGLWSDLMSTITLVLLSSLLSIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSELVAKIVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EAA +FG+T  Q   K+E P A   I+A + QTIML+LSMVV+ +++G+ GLG
Sbjct: 181 QVSTELVEAADSFGSTARQKLFKLEFPLAKGTIMAGVNQTIMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
             VL A+ + DIG+GF SG+ +VILAII+DR     
Sbjct: 241 RGVLAAVQSADIGKGFVSGISLVILAIIIDRFTQKL 276


>gi|237802385|ref|ZP_04590846.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025242|gb|EGI05298.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 281

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 134/276 (48%), Positives = 187/276 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG+Y+  F   LT NG  + + ++  L   ++   F L +  PLV + +++ L
Sbjct: 2   LIDQKIPLGEYIAAFVDWLTLNGADYFDAIASTLEMMIHGFTFALTWFNPLVLIGLIAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V   +  LLI+   YWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLVCVVIGVPLGIIAAHKPL 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+IIR  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTIIRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG++  Q+  ++ELP+A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ + 
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAKK 277


>gi|330891305|gb|EGH23966.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. mori str. 301020]
          Length = 281

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 132/275 (48%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IPLG+Y+  F   LT NG  + + ++  L   ++   F L +  P V + +++ L
Sbjct: 2   LTDHKIPLGEYIAAFVDWLTANGADYFDAIASTLEMMIHGFTFALTWFNPFVLIGLIAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V   +  LLI+   YWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLVCVVIGVPLGIIAAQKPL 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+IIR  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTIIRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG++  Q+  ++ELP+A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ +
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAK 276


>gi|302550270|ref|ZP_07302612.1| glycine betaine ABC transport system permease [Streptomyces
           viridochromogenes DSM 40736]
 gi|302467888|gb|EFL30981.1| glycine betaine ABC transport system permease [Streptomyces
           viridochromogenes DSM 40736]
          Length = 872

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 102/266 (38%), Positives = 151/266 (56%), Gaps = 1/266 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           LG ++ +    LT +  W  +    + L   + +  VLQ   PL+   + +++   + R 
Sbjct: 6   LGSWVNDGVDWLTTHMAWLFDFCKTVFLGLYDGINAVLQAPEPLLLAGIFAVIAFWL-RG 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
               V T +G   I     W+    TLSLVLV+T I++ I +P+G+ AA   R   ++R 
Sbjct: 65  TLAGVLTFVGFAFIDSLELWENAMITLSLVLVATVIALVISIPVGIWAARSDRVSGLVRP 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P  +YLIPA++ FG G   GIVAT++F++   VR+T LGI      L EAA 
Sbjct: 125 VLDFMQTLPAMIYLIPAILFFGTGAPAGIVATLIFALAPGVRMTELGIRQVDKELVEAAD 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG TP     +V+LP A+P ++A + Q IML LSM  +  +VG+ GLG  V  A+  ++
Sbjct: 185 AFGTTPRNTLLRVQLPLALPTVMAGVNQVIMLGLSMAAIAGMVGTGGLGGDVNEAIGQLN 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPD 276
           +G G E+G+ IVILAI LDR+ S   
Sbjct: 245 VGLGSEAGVAIVILAIYLDRMTSALG 270


>gi|329954688|ref|ZP_08295748.1| glycine betaine transport system permease protein opuAB
           [Bacteroides clarus YIT 12056]
 gi|328527229|gb|EGF54233.1| glycine betaine transport system permease protein opuAB
           [Bacteroides clarus YIT 12056]
          Length = 275

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 120/272 (44%), Positives = 174/272 (63%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT N   F + LS  +   ++    VL  +P  + + V+++L   +K
Sbjct: 2   INIGQYIETAINWLTNNFATFFDTLSIGIGSFIDSFQHVLYGIPFYITIAVLAILAW-MK 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                AV T +GLLLI   G+W+ET +TL+LVL ST +++ +GVPLG+  A   R   I+
Sbjct: 61  SGKGTAVFTVLGLLLIYGMGFWEETMQTLALVLSSTCLALLLGVPLGIWTANSNRCNKIM 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + EA
Sbjct: 121 RPILDFMQTMPAFVYLIPAVLFFGLGTVPGAFATVIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGATP+Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATPWQLLYKVQLPLALPTIMTGINQTIMMSLSMVVIAAMISAGGLGEVVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAI+LDR+        +
Sbjct: 241 MKIGLGFEGGIAVVILAIVLDRITQGMAQGKK 272


>gi|153833250|ref|ZP_01985917.1| glycine betaine transport system permease protein opuAB [Vibrio
           harveyi HY01]
 gi|156977390|ref|YP_001448296.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           harveyi ATCC BAA-1116]
 gi|148870521|gb|EDL69436.1| glycine betaine transport system permease protein opuAB [Vibrio
           harveyi HY01]
 gi|156528984|gb|ABU74069.1| hypothetical protein VIBHAR_06177 [Vibrio harveyi ATCC BAA-1116]
          Length = 280

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 136/279 (48%), Positives = 191/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    +PLG++++     LT N   F + +S  L   +  V+ + +++PP   + + 
Sbjct: 1   MNFITDNKLPLGEWMETGVDWLTMNASGFFDAISIFLETIILFVVDIFKWMPPAAPIIMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + V   + LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA 
Sbjct: 61  AAIAWFLHRSIPLVVFIVLALLTILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELIEAGKAFGASRMKLLFKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKAPNQKE 279


>gi|254475309|ref|ZP_05088695.1| choline ABC transporter, permease protein [Ruegeria sp. R11]
 gi|214029552|gb|EEB70387.1| choline ABC transporter, permease protein [Ruegeria sp. R11]
          Length = 276

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 142/274 (51%), Positives = 191/274 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G   +  F  L   GE F + LS++L   ++ +L+VLQ   P + V V 
Sbjct: 1   MDWLTDTKIPVGKTAKAVFEWLQDIGEPFFDWLSWLLELLIDGILWVLQTPHPFITVGVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             +  +++R+  I V  A+G L I+ QGYW+ETTE+L+LVL +  + M IGVP+G+ AA 
Sbjct: 61  VAITWLLQRNWKICVFVALGFLFILNQGYWEETTESLTLVLSACLVCMAIGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR +  +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LG+ S
Sbjct: 121 RPRLFVAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTHLGVSS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q   KVELP+A+PQI+  L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKPLLEAAEAFGATKSQTLWKVELPYALPQIMTGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSI 274
           PV+RALN V+   GFESG  IV++AIILDR+  +
Sbjct: 241 PVVRALNQVNTALGFESGFVIVVVAIILDRVLRV 274


>gi|227822905|ref|YP_002826877.1| proline/glycine betaine ABC transporter, permease protein
           [Sinorhizobium fredii NGR234]
 gi|227341906|gb|ACP26124.1| proline/glycine betaine ABC transporter, permease protein
           [Sinorhizobium fredii NGR234]
          Length = 281

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 172/273 (63%), Positives = 218/273 (79%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  IP+G + + F   LT N E F + L+ +L   ++++L++LQ   PL+ + +V
Sbjct: 1   MEFLTENRIPIGGWAKAFVDWLTTNFELFFDQLANLLSGIISVLLYILQTPHPLIVIAIV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L    +RSI IA  T +GLLLI+ QGYWQETTETL+LVL ++F+SM +GVPLG++AA 
Sbjct: 61  TALAWWFRRSIGIAAFTCLGLLLIVNQGYWQETTETLALVLAASFVSMAVGVPLGIVAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               YSI+R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWVYSIMRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA +FGATP+QV RKVE+PFA+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPSLVEAAESFGATPWQVLRKVEIPFAMPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           PVLRALNTV+I RGFESGLCIVILAI+LDRLF 
Sbjct: 241 PVLRALNTVNIARGFESGLCIVILAIVLDRLFR 273


>gi|256019540|ref|ZP_05433405.1| glycine betaine transporter membrane protein [Shigella sp. D9]
 gi|332280664|ref|ZP_08393077.1| glycine betaine/L-proline transport system permease proW [Shigella
           sp. D9]
 gi|332103016|gb|EGJ06362.1| glycine betaine/L-proline transport system permease proW [Shigella
           sp. D9]
          Length = 354

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 108/276 (39%), Positives = 160/276 (57%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +  IPL  ++ E    +  +       +   +   +N    +L  +P  V + V 
Sbjct: 54  LDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVF 113

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + V T + L+ I   G W +   TL+LVL +    + IG+PLG+  A 
Sbjct: 114 ALIAWQISGV-GMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLAR 172

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR   IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  +RLT LGI  
Sbjct: 173 SPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQ 232

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 233 VPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 292

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            VLR +  +D+G     G+ IVILAIILDRL     
Sbjct: 293 MVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVG 328


>gi|328949595|ref|YP_004366930.1| ABC-type transporter, integral membrane subunit [Marinithermus
           hydrothermalis DSM 14884]
 gi|328449919|gb|AEB10820.1| ABC-type transporter, integral membrane subunit [Marinithermus
           hydrothermalis DSM 14884]
          Length = 287

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 114/281 (40%), Positives = 167/281 (59%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M       +PLGD++  F   L          LS  LL  +  +   L  LP    V VV
Sbjct: 1   MEFPESLHLPLGDWVDAFVNWLVIQYGDAFEALSNSLLFVLVRLERFLGTLPWWSVVLVV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL     R   +AVG A  + LI   G W    +TL+L++V+T IS+ IGVP G+L + 
Sbjct: 61  ALLAWHASRRWVLAVGLAATMFLIGALGLWDLAIQTLALMIVATTISVLIGVPTGILMSR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  + +   LD+MQT+P+FVYLIPAL+LFGLG VP + AT+++++P ++RLT LGI  
Sbjct: 121 SDRLRAFLLPLLDAMQTMPSFVYLIPALMLFGLGKVPAVFATVIYAVPPAIRLTDLGIRL 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
               + EA+ AFGAT  Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG 
Sbjct: 181 VDKEVLEASEAFGATARQKLLGVQLPLALPNIMAGINQTTMMALSMVVIASMIGARGLGE 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            VL  +  +D+G+G E+G+ IV LAI++DR+      R  +
Sbjct: 241 QVLLGIQRLDVGQGTEAGVAIVALAIVMDRITQAYGKRTEV 281


>gi|28867693|ref|NP_790312.1| glycine/betaine/L-proline ABC transporter permease [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213967765|ref|ZP_03395912.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato T1]
 gi|301382401|ref|ZP_07230819.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302061206|ref|ZP_07252747.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302132422|ref|ZP_07258412.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28850928|gb|AAO54007.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213927541|gb|EEB61089.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. tomato T1]
 gi|330874755|gb|EGH08904.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330965478|gb|EGH65738.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331015007|gb|EGH95063.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 281

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 132/275 (48%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IPLG+Y+  F   LT NG  + + ++  L   ++   F L +  P V + +++ L
Sbjct: 2   LTDQKIPLGEYIAAFVDWLTANGADYFDAIASTLEMMIHGFTFALTWFNPFVLIGLIAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V   +  LLI+   YWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVILSFLLILNLHYWQETMETLAQVLFATLVCVVIGVPLGIIAAHKPL 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+IIR  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTIIRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG++  Q+  ++ELP+A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGSSRRQLLTRIELPYAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ +
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAK 276


>gi|158422810|ref|YP_001524102.1| ABC transporter permease [Azorhizobium caulinodans ORS 571]
 gi|158329699|dbj|BAF87184.1| ABC transporter permease [Azorhizobium caulinodans ORS 571]
          Length = 305

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 142/279 (50%), Positives = 191/279 (68%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
             +++  IPLG +L      L+ + +   +++S +L   +  +   L ++PPL+ +   +
Sbjct: 22  DWLVEHKIPLGRWLSAVVDFLSTHAQVVFDVISAVLAAMIGGLTAALLFIPPLLLIAACA 81

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
                V RSI +AV     LLL+   GYW  T ETLSLVL +TF+ + IGVP+G+ AA  
Sbjct: 82  AGAYWVHRSIGLAVFILGALLLVANLGYWDATVETLSLVLCATFVCVLIGVPVGIAAAHR 141

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P  Y+ IR  LD MQTIPTFVYLIP LVLFGLG+VPG+++T++F++P  +RLT LGI S 
Sbjct: 142 PWLYTAIRPVLDLMQTIPTFVYLIPTLVLFGLGVVPGLISTVIFALPAPIRLTHLGISSV 201

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           PP L EA  AFGAT  Q+  KVELP+A+P I+A +TQ IMLSLSMVV+ ALVGS+GLG P
Sbjct: 202 PPALVEAGEAFGATRRQLLFKVELPYALPTIMAGITQCIMLSLSMVVIAALVGSDGLGKP 261

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           V+RALNTV++  GFE+G+ IVILAI+LDR+   PD   R
Sbjct: 262 VVRALNTVNVAMGFEAGMAIVILAIVLDRVCKRPDRAGR 300


>gi|323694649|ref|ZP_08108813.1| ABC transporter permease [Clostridium symbiosum WAL-14673]
 gi|323501289|gb|EGB17187.1| ABC transporter permease [Clostridium symbiosum WAL-14673]
          Length = 613

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 94/273 (34%), Positives = 158/273 (57%), Gaps = 2/273 (0%)

Query: 8   PIPLG-DYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
            IP+  +           N       +   L   +N++  +L  +P  + + +V      
Sbjct: 334 VIPIDVNAFDTSVKAF-ANQSTVFKAIRDGLNILINVLNAILNLIPWWLLIAIVFFGGYK 392

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
           +   +   +  ++ L L+   G W    ETLS+VL S  IS+ IG+P+G++ +   R   
Sbjct: 393 LSGKVRNGIIYSILLFLVGAIGLWDLMYETLSIVLASVVISLLIGLPVGIMISGSDRANV 452

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I+R  LD+MQT+P FVYLIPA++ FGLG  P ++AT +++I   +RLT  GI    P + 
Sbjct: 453 IVRPILDTMQTMPVFVYLIPAVLFFGLGKAPAVIATTIYAIVPVIRLTSHGIRQVDPEVV 512

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T +Q   KV++P A+P I+  + QT+M++++MVV  +++G++GLG+ VL ++
Sbjct: 513 EAARSFGSTKWQCLFKVQIPQALPTILTGVNQTLMMAMAMVVTCSMIGASGLGMEVLISV 572

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           N ++IGRG  +G  +VI+AI++DRL      R 
Sbjct: 573 NRIEIGRGLLAGTAVVIVAILMDRLTQGWFKRK 605


>gi|315924093|ref|ZP_07920319.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622495|gb|EFV02450.1| glycine betaine/carnitine/choline ABC superfamily ATP binding
           cassette transporter, membrane/binding protein
           [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 576

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 109/277 (39%), Positives = 168/277 (60%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+   IP+ D ++     +T+    F + + +    A++ +   L +LPP++ +  +
Sbjct: 1   MFKILTTAIPVADGVEHVVSWMTKAWAGFFSAVQWGGKGAMDAITRFLVFLPPVLVILGL 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++    V  R   + +   +GLL +  QG W++   T++LV ++  +S+ IG+PLG+L A
Sbjct: 61  AVAAYFVANRKKGLPIFVLIGLLFVYNQGLWEDMMNTVTLVFMAALLSVVIGIPLGILMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              R   +I+  LD MQT+P FVYLIPA+  FG+GMVPG+ A+I+F++P +VR T LGI 
Sbjct: 121 KKDRAQVVIQPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASIIFALPPTVRFTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   K+ELP A   I+A + QTIML+LSMVV  +++G+ GLG
Sbjct: 181 EIPRELIEASDAFGSTSSQKLFKIELPLARNTIMAGINQTIMLALSMVVTASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
             VL AL    +G GF SG+ +V+LAII+DR      
Sbjct: 241 RGVLSALQRAQVGNGFVSGMALVVLAIIIDRFTQKLA 277


>gi|328470867|gb|EGF41778.1| putative permease [Vibrio parahaemolyticus 10329]
          Length = 298

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 136/278 (48%), Positives = 190/278 (68%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
           + I    +PLG +++     LT N   F + +S  L   +  V+ + +++PP   + + +
Sbjct: 20  NFITDNKLPLGQWMETGVDWLTINASGFFDAISITLETIIMFVVDIFKWMPPAAPIIMTA 79

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
            L   + RS+ + V   + LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA  
Sbjct: 80  ALAWFLHRSLPLVVFIVLALLAILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAHR 139

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGII  
Sbjct: 140 PWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGIIKV 199

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG P
Sbjct: 200 PEELLEAGKAFGASRMKLLFKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGKP 259

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           V+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 260 VVRALNTVNISQGFEAGLAIVLVAIILDRLCKAPNQKE 297


>gi|330810520|ref|YP_004354982.1| glycine betaine ABC transporter permease [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327378628|gb|AEA69978.1| putative Glycine betaine ABC transporter, permease component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 282

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 131/278 (47%), Positives = 181/278 (65%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I Q  +PLG+++  +   LTQ+G    + +S  L   ++     L +  PL  + V +L
Sbjct: 2   WITQEKLPLGEHIARYVEWLTQHGAGVFDAISLSLSGVISAFTSALLWFNPLALIAVFAL 61

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           L   ++R  ++ +   +  LLI   GYWQET ETL+ V  +T + + IGVPLG++AA  P
Sbjct: 62  LAYYIQRKASLTLFVTLSFLLIFNLGYWQETMETLAQVTFATLVCVVIGVPLGIVAAHRP 121

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
            FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P
Sbjct: 122 WFYAALRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVP 181

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV
Sbjct: 182 DELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV 241

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + ALNT DI  GFE+GL IV+LAIILDR+    +   R
Sbjct: 242 VNALNTADISMGFEAGLAIVLLAIILDRICKQREAVKR 279


>gi|323487142|ref|ZP_08092449.1| ABC transporter permease [Clostridium symbiosum WAL-14163]
 gi|323399545|gb|EGA91936.1| ABC transporter permease [Clostridium symbiosum WAL-14163]
          Length = 625

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 94/273 (34%), Positives = 158/273 (57%), Gaps = 2/273 (0%)

Query: 8   PIPLG-DYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
            IP+  +           N       +   L   +N++  +L  +P  + + +V      
Sbjct: 346 VIPIDVNAFDTSVKAF-ANQSTVFKAIRDGLNILINVLNAILNLIPWWLLIAIVFFGGYK 404

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
           +   +   +  ++ L L+   G W    ETLS+VL S  IS+ IG+P+G++ +   R   
Sbjct: 405 LSGKVRNGIIYSILLFLVGAIGLWDLMYETLSIVLASVVISLLIGLPVGIMISGSDRANV 464

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I+R  LD+MQT+P FVYLIPA++ FGLG  P ++AT +++I   +RLT  GI    P + 
Sbjct: 465 IVRPILDTMQTMPVFVYLIPAVLFFGLGKAPAVIATTIYAIVPVIRLTSHGIRQVDPEVV 524

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA +FG+T +Q   KV++P A+P I+  + QT+M++++MVV  +++G++GLG+ VL ++
Sbjct: 525 EAARSFGSTKWQCLFKVQIPQALPTILTGVNQTLMMAMAMVVTCSMIGASGLGMEVLISV 584

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           N ++IGRG  +G  +VI+AI++DRL      R 
Sbjct: 585 NRIEIGRGLLAGTAVVIVAILMDRLTQGWFKRK 617


>gi|149915311|ref|ZP_01903838.1| binding-protein-dependent transport systems inner membrane
           component [Roseobacter sp. AzwK-3b]
 gi|149810600|gb|EDM70441.1| binding-protein-dependent transport systems inner membrane
           component [Roseobacter sp. AzwK-3b]
          Length = 278

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 141/274 (51%), Positives = 190/274 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ + +  IP+GD  + FF+ L  N   F + LS  +   ++  L+VLQ   PL+ + V 
Sbjct: 1   MNWLSENKIPVGDAAEIFFLWLQDNAALFFDALSVAMEGLIDAFLWVLQTPHPLILIGVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L  + +R+    +  A+G L ++ Q YW+E TE+L+LVL +    M IGVP+G+  A 
Sbjct: 61  VGLTWLFQRNWKTCLFVALGFLFVLNQDYWEEMTESLTLVLSACVFCMAIGVPIGIATAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y  +R  LD MQT+P FVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI S
Sbjct: 121 RPGLYRGLRPVLDLMQTLPPFVYLIPAIVFFGIGMVPGLIATVIFVVPAPIRLTHLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGATP Q   KVELP+A+PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKPLLEAAQAFGATPRQTLWKVELPYALPQIMAGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSI 274
           PVLRA+N+V+I  GFESGL IV++AIILDR+  +
Sbjct: 241 PVLRAINSVNIALGFESGLMIVVVAIILDRMLRL 274


>gi|125623880|ref|YP_001032363.1| glycine betaine-binding periplasmic protein precursor [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|6119854|gb|AAF04259.1|AF139575_2 glycine-betaine binding permease protein [Lactococcus lactis]
 gi|7212814|gb|AAF40474.1|AF184955_2 OpuABC [Lactococcus lactis subsp. cremoris MG1363]
 gi|124492688|emb|CAL97642.1| glycine betaine-binding periplasmic protein precursor [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|300070654|gb|ADJ60054.1| glycine betaine-binding periplasmic protein precursor [Lactococcus
           lactis subsp. cremoris NZ9000]
          Length = 573

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 107/276 (38%), Positives = 167/276 (60%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  ++   IPL +++      +T       +++       +N +   L  +P  + + VV
Sbjct: 1   MIDLVIGKIPLANWVSSATDWITSTFSSGFDVIQKSGTVLMNGITGALTAVPFWLMIAVV 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++L ++V  +     +   +GL LI  QG W +   T++LVL+S+ +S+ IGVPLG+  A
Sbjct: 61  TILAILVSGKKFAFPLFAFIGLCLIANQGLWSDLMSTITLVLLSSLLSIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSELVAKIVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EAA +FG+T  Q   K+E P A   I+A + QTIML+LSMVV+ +++G+ GLG
Sbjct: 181 QVSTELVEAADSFGSTARQKLFKLEFPLAKGTIMAGVNQTIMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
             VL A+ + DIG+GF SG+ +VILAII+DR     
Sbjct: 241 RGVLAAVQSADIGKGFVSGISLVILAIIIDRFTQKL 276


>gi|260777812|ref|ZP_05886705.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605825|gb|EEX32110.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio coralliilyticus ATCC BAA-450]
          Length = 280

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 135/279 (48%), Positives = 192/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IP+G++++     LT N   F + +S+ L   +  V+ + +++PP + + + 
Sbjct: 1   MNFITNNKIPVGEWMETGVDWLTMNAAGFFDSVSYFLETIILFVVDIFKWMPPALPILLT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+GV+AA 
Sbjct: 61  AAIAWYLHRSIPLVLFIIGALLTILNLGYWQEMLETFVLVFAATTISVLIGVPVGVMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELIEAGQAFGASKMKLLFKVELPAALPSIMAGITQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKSPNQKE 279


>gi|160898108|ref|YP_001563690.1| binding-protein-dependent transport systems inner membrane
           component [Delftia acidovorans SPH-1]
 gi|160363692|gb|ABX35305.1| binding-protein-dependent transport systems inner membrane
           component [Delftia acidovorans SPH-1]
          Length = 399

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 102/277 (36%), Positives = 159/277 (57%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    +P+  ++      +  +   F   +   +   ++ +   +  LP  + + V++L+
Sbjct: 93  LTTDGLPVQGWINSGLEWVVHHFRPFFQAVRTPIDGTLSGITDAMLALPWPLLILVLTLV 152

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +A+G A+ L+++   G W E   TLSLVL S    M IG+P G+L A   R
Sbjct: 153 AWQFAGRA-MAIGAAVSLVVVAMLGIWPEAMVTLSLVLTSLVFCMVIGLPAGILLASSDR 211

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
                R  LD+MQT P FVYL+P ++LFG+G VPG++ TI+F++P  +RLT LGI    P
Sbjct: 212 AQRWTRPLLDAMQTTPAFVYLVPVVMLFGIGNVPGVIVTIIFALPPLIRLTNLGIRQVRP 271

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA+ A+GA+P+Q+  KV+LP A+P I+A + Q +MLSLSMVV+ +++   GLG  VL
Sbjct: 272 DLIEASRAYGASPWQLLWKVQLPLAMPSIMAGVNQALMLSLSMVVIASMIAVGGLGQMVL 331

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           R +  +D+G     GL IV+LAI+LDR+        R
Sbjct: 332 RGIGRLDMGLATVGGLGIVLLAIVLDRITQAMGQTTR 368


>gi|150397506|ref|YP_001327973.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium medicae WSM419]
 gi|150029021|gb|ABR61138.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium medicae WSM419]
          Length = 281

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 174/277 (62%), Positives = 219/277 (79%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + + PIP+G + + F   LT N + F + L+ +L   ++++L++LQ   PL+ + +V
Sbjct: 1   MELLTENPIPIGAWAKAFVDWLTTNFDLFFDQLANVLSGIISVLLYILQTPHPLIVIAIV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L    +RSI IAV T +G+LLI+ QGYWQETTETL+LVL +TF+SM +GVPLG+ AA 
Sbjct: 61  TALAWWFRRSIGIAVFTCLGMLLIVNQGYWQETTETLALVLAATFVSMAVGVPLGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               YS +R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWIYSFMRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA +FGATP+QV RKVELPFA+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPALVEAAESFGATPWQVLRKVELPFAMPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PVLRALNTV+I RGFESGLCIVILAI+LDRLF   D 
Sbjct: 241 PVLRALNTVNIARGFESGLCIVILAIVLDRLFRSSDE 277


>gi|254452526|ref|ZP_05065963.1| choline ABC transporter, permease protein [Octadecabacter
           antarcticus 238]
 gi|198266932|gb|EDY91202.1| choline ABC transporter, permease protein [Octadecabacter
           antarcticus 238]
          Length = 277

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 138/277 (49%), Positives = 188/277 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  IP+GD  +  F  L      F + ++  +   ++ +L++LQ   P + +   
Sbjct: 1   MDWLTKNKIPVGDTAEAAFDWLEPRSRAFFDGMADTMESLIDGILWLLQTPHPFIVIAAF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L   ++RS    +  A+G L I+ Q YW+ETTE+L+LVL +  + M IGVP+G+ AA 
Sbjct: 61  VALTWAMQRSWKPCLMIAIGFLFILNQDYWEETTESLTLVLSACVVCMGIGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI S
Sbjct: 121 RPRLYAWMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTHLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q   KVELP A+PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPLPLLEAADAFGATKRQKLLKVELPSALPQIMAGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RAL TVD  +GFESGL IV++AI+LDR+  +   
Sbjct: 241 PVVRALGTVDTAKGFESGLVIVVVAIMLDRMLRVGSK 277


>gi|294497625|ref|YP_003561325.1| glycine/betaine ABC transporter permease OpuAB [Bacillus megaterium
           QM B1551]
 gi|294347562|gb|ADE67891.1| glycine/betaine ABC transporter, permease protein OpuAB [Bacillus
           megaterium QM B1551]
          Length = 281

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 120/273 (43%), Positives = 183/273 (67%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G+++  F   L  N + F +++S I+   V+ ++ VL + P L+ + +V ++    
Sbjct: 6   KIPVGNWIDHFVTFLNDNIKGFFDVISAIVDGIVSFIVLVLTFPPALILILIVGIIAWFS 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +  +  + + +GLL I+  GYWQET +TL+LVL S FIS+ +G+PLG+ A+   +   I
Sbjct: 66  SKKWSFTILSMIGLLFILNLGYWQETMDTLALVLTSVFISIIVGIPLGIWASQSEKTARI 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPAL  FG+G+VPG++++++F++P ++RLT LGI   P  L E
Sbjct: 126 ITPILDFMQTMPAFVYLIPALFFFGIGVVPGVISSVIFAMPPTIRLTNLGIREVPADLVE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA A+G+T  Q   KV+LP A   I+A + Q+IMLSLSMVV+ +LVG+ GLG  V RA++
Sbjct: 186 AANAYGSTTKQKLFKVQLPLATKTIMAGINQSIMLSLSMVVIASLVGAPGLGAEVYRAVS 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +++G GFE+G+ IVILAIILDR+      R +
Sbjct: 246 RLEVGTGFEAGISIVILAIILDRITQYFGNRSK 278


>gi|298375042|ref|ZP_06984999.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 3_1_19]
 gi|298267542|gb|EFI09198.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 3_1_19]
          Length = 274

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 119/272 (43%), Positives = 176/272 (64%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G+Y++     LT++G  F ++LS  +   ++ +L VL  +P  + + +++ L L  K
Sbjct: 2   INIGEYIEMAVEWLTEHGASFFDLLSLGVEGVIDGILCVLLGIPFYITIAILTFLALY-K 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                 + T +GL LI   G+W+ET +TL+LVL ST +++ +G+PLG+  A   R   I+
Sbjct: 61  SGRGTGIFTLLGLSLIYGMGFWEETMQTLALVLSSTGMALLLGIPLGIWMAGSGRCNKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           +  LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P   RLT LG+   P  + EA
Sbjct: 121 QPVLDCMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFALPPVARLTALGLRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A +FGATP Q+  KVELP A+P I+A + QTIM+SLSMVVV A++ + GLG  VL  +  
Sbjct: 181 ARSFGATPSQLLFKVELPLALPTILAGINQTIMMSLSMVVVAAMISAGGLGEVVLIGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAI+LDR+      + +
Sbjct: 241 MKIGMGFEGGIAVVILAIVLDRITQGMARKKQ 272


>gi|86358687|ref|YP_470579.1| proline/glycine betaine ABC transporter, permease protein
           [Rhizobium etli CFN 42]
 gi|86282789|gb|ABC91852.1| proline/glycine betaine ABC transporter, permease protein
           [Rhizobium etli CFN 42]
          Length = 281

 Score =  161 bits (407), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 174/277 (62%), Positives = 215/277 (77%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I  + IP+G   + F   LT NGEWF N L+F+L   ++ +L VLQ   PL+ + V+
Sbjct: 1   MNWITDSKIPIGPLAKSFVDWLTSNGEWFFNQLAFLLSHVIDGLLLVLQKPHPLIVIAVI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           S L   ++RSI I + T +GLLLI+ QGYW+ETTETL+LVL STF+SM IG+PLG+ AA 
Sbjct: 61  SALAFWLRRSIAITLFTCLGLLLIMNQGYWKETTETLALVLASTFVSMVIGIPLGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               Y+ +R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWVYAAMRPVLDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA AFGA P QV RKVELPFA PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPSLVEAAVAFGARPMQVLRKVELPFAAPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV++ +GFE+GLCIVILAIILDR+F     
Sbjct: 241 PVVRALNTVNVAKGFEAGLCIVILAIILDRMFRTAGE 277


>gi|254486656|ref|ZP_05099861.1| choline ABC transporter, permease protein [Roseobacter sp. GAI101]
 gi|214043525|gb|EEB84163.1| choline ABC transporter, permease protein [Roseobacter sp. GAI101]
          Length = 277

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 137/277 (49%), Positives = 186/277 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+ D  +  F  L  N  W  + LS  +   ++ +L+VLQ   P   + V 
Sbjct: 1   MDWLTDNKIPIDDAAEAVFDWLLINAGWMFDGLSVAMEALIDAILWVLQTPHPFYIIAVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +     ++R+    V   +G L I+ Q YW+ETTE+L+LVL +  + M +GVP+G+ AA 
Sbjct: 61  AAFTWALQRNWKTPVFVVLGFLFILNQDYWEETTESLTLVLSACVVCMGVGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT+LGI S
Sbjct: 121 RPRLYRYMAPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTQLGIAS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGA P Q   K+ELP+A+PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKSLLEAAQAFGAKPSQTLWKIELPYALPQIMAGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALN V+ G GFESGL IV++AI+LDR+  +   
Sbjct: 241 PVVRALNQVNTGLGFESGLIIVVVAIMLDRMLRVTRK 277


>gi|90410103|ref|ZP_01218120.1| putative permease of ABC transporter [Photobacterium profundum
           3TCK]
 gi|90329456|gb|EAS45713.1| putative permease of ABC transporter [Photobacterium profundum
           3TCK]
          Length = 282

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 141/280 (50%), Positives = 194/280 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I +  IPLG+++  F   LT N   F + LS+ L   + L++ + ++ PP V + + 
Sbjct: 1   MDFITEHKIPLGEWMATFVDWLTYNASGFFDSLSYTLESMIMLLVDLFKWFPPAVPIVMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   + RS+++ +     LLLI+  GYW+E  ET  LVL +T  S+ +GVP+G+ AA 
Sbjct: 61  ALLAWFLHRSLSLVIFVVAALLLIMNLGYWEEMIETFVLVLSATMFSVIVGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+I+R  LD MQTIPTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 KPWLYTIMRPILDLMQTIPTFVYLIPTLVLFGLGVVPGLISTIIFAIAAPIRLTYLGISR 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV++ALVG++GLG 
Sbjct: 181 VPEELVEAGRAFGASRMKLLFKVELPAAMPNIMAGITQCIMLSLSMVVISALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P  + R
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPASQSR 280


>gi|255015584|ref|ZP_05287710.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 2_1_7]
          Length = 274

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 117/272 (43%), Positives = 177/272 (65%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G+Y++     LT++G  F ++LS  +   ++ +L VL  +P  + + +++ L L  K
Sbjct: 2   INIGEYIEMAVEWLTEHGASFFDLLSLGVESVIDGILCVLLGIPFYITIAILTFLALY-K 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                 + T +GL L+   G+W+ET +TL+LVL ST +++ +G+PLG+  A       I+
Sbjct: 61  SGRGTGIFTLLGLSLVYGMGFWEETMQTLALVLSSTGMALMLGIPLGIWMAGSGHCNKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           +  LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P   RLT LG+   P  ++EA
Sbjct: 121 QPVLDCMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFALPPVARLTALGLRQVPKNVEEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A +FGATP Q+  KVELP A+P I+A + QTIM+SLSMVVV A++ + GLG  VL+ +  
Sbjct: 181 ARSFGATPVQLLFKVELPLALPTILAGVNQTIMMSLSMVVVAAMISAGGLGEVVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAI+LDR+      + +
Sbjct: 241 MKIGMGFEGGIAVVILAIVLDRITQGMARKKQ 272


>gi|15966153|ref|NP_386506.1| putative glycine betaine transport system permease ABC transporter
           protein [Sinorhizobium meliloti 1021]
 gi|19880074|gb|AAM00245.1|AF360731_2 ProW [Sinorhizobium meliloti]
 gi|15075423|emb|CAC46979.1| Putative choline ABC transporter, permease component [Sinorhizobium
           meliloti 1021]
          Length = 281

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 173/277 (62%), Positives = 217/277 (78%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + + PIP+G + + F   LT N   F + L+ +L   ++++L++LQ   PL+ + VV
Sbjct: 1   MEFLTENPIPIGAWAKSFVDWLTTNFNLFFDQLANVLSAIISVLLYILQTPHPLIIIAVV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L    +RS+ IA  T +GLLLI+ QGYWQETTETL+LVL +TF+SM +GVP G+ AA 
Sbjct: 61  TALAWWFRRSLGIAAFTCLGLLLIVNQGYWQETTETLALVLAATFVSMAVGVPFGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               YSI+R  LD MQTIPTFVYLIPAL+LFGLG+VPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWIYSIMRPILDLMQTIPTFVYLIPALILFGLGVVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA +FGATP+QV RKVELPFA+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPALVEAAESFGATPWQVLRKVELPFAMPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PVLRALNTV+I RGFESGLCIVILAI+LDRLF   D 
Sbjct: 241 PVLRALNTVNIARGFESGLCIVILAIVLDRLFRSSDE 277


>gi|149188392|ref|ZP_01866685.1| putative permease of ABC transporter [Vibrio shilonii AK1]
 gi|148837610|gb|EDL54554.1| putative permease of ABC transporter [Vibrio shilonii AK1]
          Length = 280

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 137/279 (49%), Positives = 189/279 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG +++     LT N     + +S  L   +  V+ V +++PP + + + 
Sbjct: 1   MNFITDNKIPLGQWMEAGVDWLTFNAAGLFDAISIFLETIILFVVDVFKWMPPAMPIIMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + +     LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA 
Sbjct: 61  AAIAWYLHRSIPLVLFVIGALLTILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGAT  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELVEAGKAFGATRMKLLFKVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKSPNQKE 279


>gi|126732156|ref|ZP_01747958.1| putative glycine betaine transport system permease abc transporter
           protein [Sagittula stellata E-37]
 gi|126707445|gb|EBA06509.1| putative glycine betaine transport system permease abc transporter
           protein [Sagittula stellata E-37]
          Length = 277

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 149/273 (54%), Positives = 199/273 (72%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + +  +P+G  +++    LT N  WF + LS  L   ++ +L+ LQ  P L+ V ++
Sbjct: 1   MEWLEEHKLPIGSVVRDAVDWLTDNAVWFFDGLSLALESVIDALLWCLQTPPALLIVALI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL    +RS+   + TA GLLLII QGYW+ETTETL+LV+ +  + M +GVP+G+ AA 
Sbjct: 61  TLLSWFARRSVGFTIFTAAGLLLIINQGYWEETTETLALVIAAAVVCMGVGVPVGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +   LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLT LGI S
Sbjct: 121 RPWLYNALSPVLDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTHLGITS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGAT  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPTALIEAGEAFGATRRQLLYKVELPYAMPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           P LRALN+V+I +GFE G+ IV++AII DR+F 
Sbjct: 241 PTLRALNSVNIAQGFEVGIAIVLVAIIFDRMFK 273


>gi|291287940|ref|YP_003504756.1| binding-protein-dependent transport systems inner membrane
           component [Denitrovibrio acetiphilus DSM 12809]
 gi|290885100|gb|ADD68800.1| binding-protein-dependent transport systems inner membrane
           component [Denitrovibrio acetiphilus DSM 12809]
          Length = 279

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 116/275 (42%), Positives = 171/275 (62%), Gaps = 1/275 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
             +  IPL  ++Q     L +N      ++ + + K+++ + +VL  + PLV + +++ L
Sbjct: 6   FDERIIPLDQWVQSGVDFLVENYREVFQLIKYPVEKSLDSISWVLTSMHPLVLIAILAFL 65

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    + + T   + LI   G W+E   TL++V+ S      +G+PLG+L+    R
Sbjct: 66  AFRYAGK-RVTIFTIATMFLIGMLGLWEEAMITLAMVICSVLFCAIVGIPLGILSGRSNR 124

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           F S IR FLD+MQT P FVYL+P ++LF +G V G++ATIVF++P  +RLT LGI    P
Sbjct: 125 FESCIRPFLDAMQTTPAFVYLVPVVMLFSIGTVSGVLATIVFAMPPIIRLTGLGIRQVHP 184

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA +FGATP QV RKV++P A+P I+A L QTIM+SLSMVV+ AL+G+ GLG PV 
Sbjct: 185 ELVEAAVSFGATPMQVLRKVQIPLAMPSIMAGLNQTIMMSLSMVVIAALIGAGGLGTPVF 244

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           + LNT+DIG     GL IV+LA++LDR+      +
Sbjct: 245 QGLNTLDIGLATIGGLGIVLLAMVLDRITQGMGKK 279


>gi|54303410|ref|YP_133403.1| putative permease of ABC transporter [Photobacterium profundum SS9]
 gi|46916840|emb|CAG23603.1| putative permease of ABC transporter [Photobacterium profundum SS9]
          Length = 282

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 141/280 (50%), Positives = 194/280 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I +  IPLG+++  F   LT N   F + LS+ L   + L++ + ++ PP V + + 
Sbjct: 1   MDFITEHKIPLGEWMATFVDWLTYNASGFFDSLSYTLESMIMLLVDLFKWFPPAVPIVMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   + RS+++ +     LLLI+  GYW+E  ET  LVL +T  S+ +GVP+G+ AA 
Sbjct: 61  ALLAWFLHRSLSLVIFVVAALLLIMNLGYWEEMIETFVLVLSATMFSVIVGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+I+R  LD MQTIPTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTIMRPILDLMQTIPTFVYLIPTLVLFGLGVVPGLISTIIFAIAAPIRLTYLGISR 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV++ALVG++GLG 
Sbjct: 181 VPEELVEAGRAFGASRMKLLFKVELPAAMPNIMAGITQCIMLSLSMVVISALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P  + R
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPASQSR 280


>gi|84686267|ref|ZP_01014162.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84665794|gb|EAQ12269.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Rhodobacterales bacterium HTCC2654]
          Length = 277

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 141/273 (51%), Positives = 191/273 (69%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G   ++ F  L   G    + +S      ++ +L+VLQ  PPL+ V V 
Sbjct: 1   MDWLEDTKIPVGKVARDVFDWLQDVGGPVFDWISVAGETMIDAILWVLQTPPPLLIVAVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           ++L   ++++  I V   +G L I+ QGYW+ETTE+L+LVL +  + M IGVP+G+ AA 
Sbjct: 61  AVLTWFLQKNWKIVVFVVLGFLFIMNQGYWEETTESLTLVLSACVVCMAIGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P+ Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI S
Sbjct: 121 RPKLYAGMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVLPAPIRLTHLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  LKEAA AFGAT  Q+  KVELP+A+PQI+  L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPMALKEAAQAFGATGRQLLWKVELPYALPQIMTGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           PV+RALN V+   GFESG  IV++AIILDR+  
Sbjct: 241 PVVRALNQVNTALGFESGFVIVVVAIILDRMLR 273


>gi|227502678|ref|ZP_03932727.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, permease protein [Corynebacterium accolens
           ATCC 49725]
 gi|227076408|gb|EEI14371.1| proline/glycine betaine ABC superfamily ATP binding cassette
           transporter, permease protein [Corynebacterium accolens
           ATCC 49725]
          Length = 296

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 106/277 (38%), Positives = 168/277 (60%), Gaps = 1/277 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +   IP+GD+  +    LT N +W  +  S ++   V      L  +P  V + + 
Sbjct: 1   MDENVIPRIPIGDWTNDGIDWLTDNAKWLFDAFSALMKFLVEGFSEALTSVPAAVMLVIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++     RS  +A+G+ +G +L++    W    +T+SLVLVST  ++ + +PLG+ AA 
Sbjct: 61  AVIAWFF-RSWRLALGSIIGFVLVLGMRQWDTMLQTMSLVLVSTLTAVILAIPLGIWAAK 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                +I+R  +D MQT+P FVYLIPA+  F +G+VPG+ +TI+F++P  VR+T LGI  
Sbjct: 120 SNTVSAIVRPIMDFMQTMPAFVYLIPAVTFFSIGVVPGVFSTIIFALPPGVRMTELGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
                 EA  ++GAT  Q+ R +++P AIP I+A + Q IMLSLSM V+  +VG++GLG 
Sbjct: 180 VDQETVEAGRSYGATSGQILRGIQIPLAIPTIMAGINQVIMLSLSMAVIAGMVGADGLGK 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            V  A++T+D+ +G E+GL +VILA+ LDRL +    
Sbjct: 240 EVTSAISTLDVAQGVEAGLAVVILAVFLDRLTAALGN 276


>gi|83954131|ref|ZP_00962851.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Sulfitobacter sp. NAS-14.1]
 gi|83841168|gb|EAP80338.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Sulfitobacter sp. NAS-14.1]
          Length = 277

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 136/277 (49%), Positives = 188/277 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+ D  +  F  L  N  W  + L+  +   ++ +L+VLQ   PL+ + V 
Sbjct: 1   MNWLTDNKIPIDDAAEAVFDWLLINAGWLFDGLAVAMEWLIDAILWVLQTPHPLIVIAVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L   ++R+    +   +G L I+ Q YW+ETTE+L+LVL +  + M +GVP+G+ AA 
Sbjct: 61  GALTWAIQRNWKTPLLIVLGFLFILNQDYWEETTESLTLVLSACVVCMGVGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT+LGI S
Sbjct: 121 RPRMYRYMAPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTQLGIAS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGA P Q   K+ELP+A+PQI+  L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKALLEAAQAFGAKPSQTLWKIELPYALPQIMTGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALN V+ G GFESGL IV++AI+LDR+  +   
Sbjct: 241 PVVRALNQVNTGLGFESGLIIVVVAIMLDRMLRVTRK 277


>gi|307308504|ref|ZP_07588206.1| choline ABC transporter, permease protein [Sinorhizobium meliloti
           BL225C]
 gi|307317282|ref|ZP_07596722.1| choline ABC transporter, permease protein [Sinorhizobium meliloti
           AK83]
 gi|306896871|gb|EFN27617.1| choline ABC transporter, permease protein [Sinorhizobium meliloti
           AK83]
 gi|306900904|gb|EFN31513.1| choline ABC transporter, permease protein [Sinorhizobium meliloti
           BL225C]
          Length = 281

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 174/277 (62%), Positives = 217/277 (78%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  + + PIP+G + + F   LT N   F + L+ +L   ++++L++LQ   PL+ + VV
Sbjct: 1   MEFLTENPIPIGAWAKSFVDWLTTNFNLFFDQLANVLSAIISVLLYILQTPHPLIIIAVV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L    +RS+ IA  T +GLLLI+ QGYWQETTETL+LVL +TF+SM +GVP G+ AA 
Sbjct: 61  TALAWWFRRSLGIAAFTCLGLLLIVNQGYWQETTETLALVLAATFVSMAVGVPFGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               YSI+R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWIYSIMRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA +FGATP+QV RKVELPFA+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPALVEAAESFGATPWQVLRKVELPFAMPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PVLRALNTV+I RGFESGLCIVILAI+LDRLF   D 
Sbjct: 241 PVLRALNTVNIARGFESGLCIVILAIVLDRLFRSSDE 277


>gi|296271876|ref|YP_003654507.1| binding-protein-dependent transporter inner membrane component
           [Arcobacter nitrofigilis DSM 7299]
 gi|296096051|gb|ADG92001.1| binding-protein-dependent transport systems inner membrane
           component [Arcobacter nitrofigilis DSM 7299]
          Length = 341

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 110/272 (40%), Positives = 157/272 (57%), Gaps = 1/272 (0%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
           +P   + IP   ++      + +N   F       +   +  +   LQ L P V +    
Sbjct: 39  NPFDHSIIPFDSWVNGGINWIVENFRDFFISAKAPVDVILRFIETFLQSLSPYVVIGFFV 98

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
           LL L V  S  +A GT + L  I   G W  +  TL+LV+ S   S+ IG+PLG+ +A  
Sbjct: 99  LLALQVS-SKKMAFGTFVSLAFIGFIGAWDASMTTLALVITSVLFSVLIGLPLGIWSAKS 157

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
                I+R  LD MQT P FVYLIP ++LFG+G VPG++ TI+F++P  +RLT LGI   
Sbjct: 158 DMVEKILRPILDGMQTTPAFVYLIPIVMLFGIGNVPGVIVTIIFALPPLIRLTNLGIRQV 217

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA+ +FGA+  Q+  KV+LP A+P I+A + QT+MLSLSMVV+ +++   GLG  
Sbjct: 218 PADLIEASRSFGASSSQMLFKVQLPVAMPTIMAGINQTLMLSLSMVVIASMIAVGGLGQM 277

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           VLR +  +DIG     G+ IVILA+ILDR+  
Sbjct: 278 VLRGIGRLDIGLAAVGGIGIVILAVILDRITQ 309


>gi|209550403|ref|YP_002282320.1| choline ABC transporter permease [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536159|gb|ACI56094.1| choline ABC transporter, permease protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 281

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 169/277 (61%), Positives = 214/277 (77%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IP+G + + F   LT NG WF + L+ +L   ++ +LFVLQ   PL+ + V+
Sbjct: 1   MNWITDFKIPIGPWAKSFVDWLTSNGAWFFDQLASVLSHVIDGLLFVLQKPHPLIVIAVI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   ++RSI + + T +GLLLI+ QGYW+ETTETL+LVL STF+SM IG+PLG+ AA 
Sbjct: 61  AAIAFWLRRSIAVTLFTCLGLLLIMNQGYWKETTETLALVLASTFVSMVIGIPLGIAAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               Y+ +R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 121 RAWIYAAMRPALDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA AFGA P QV RKVELPFA PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPPSLVEAAVAFGARPMQVLRKVELPFAAPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV++ +GFE+GLCIVILAIILDR+F     
Sbjct: 241 PVVRALNTVNVAKGFEAGLCIVILAIILDRMFRAAGE 277


>gi|281492007|ref|YP_003353987.1| glycine betaine/carnitine/choline ABC transporter
           permease/substrate-binding protein [Lactococcus lactis
           subsp. lactis KF147]
 gi|281375716|gb|ADA65220.1| Glycine betaine/carnitine/choline ABC transporter, permease and
           substrate-binding protein [Lactococcus lactis subsp.
           lactis KF147]
          Length = 573

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 107/276 (38%), Positives = 168/276 (60%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    +P+ +++      +T       +++       +N +   L  +P  + + VV
Sbjct: 1   MIDLAIGQVPIANWVSSATDWITSTFSSGFDVIQKSGTVLMNGITGALTAVPFWLMIAVV 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++L ++V  + I   + T +GL LI  QG W +   T++LVL+S+ +S+ IGVPLG+  A
Sbjct: 61  TILAILVSGKKIAFPLFTFIGLSLIANQGLWSDLMSTITLVLLSSLLSIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSDLVAKIVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EAA +FG+T  Q   K+E P A   I+A + QTIML+LSMVV+ +++G+ GLG
Sbjct: 181 QVSTELVEAADSFGSTARQKLFKLEFPLAKGTIMAGVNQTIMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
             VL A+ + DIG+GF SG+ +VILAII+DR     
Sbjct: 241 RGVLAAVQSADIGKGFVSGISLVILAIIIDRFTQKL 276


>gi|104784101|ref|YP_610599.1| glycine betaine/L-proline ABC transporter permease [Pseudomonas
           entomophila L48]
 gi|95113088|emb|CAK17816.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Pseudomonas entomophila L48]
          Length = 281

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 133/273 (48%), Positives = 182/273 (66%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LTQNG  + + ++  L   ++ V   L +  P V + + + L
Sbjct: 2   LIDQKIPLGQYIASFVEWLTQNGASYFDAIAQGLEFMIHGVTSALTWFNPFVLIALFAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             +++R   + V  A+  LLI+  GYWQET ETL+ V  +T + + IGVPLG+ AA  P 
Sbjct: 62  AHLIQRKWALTVFVALSFLLILNLGYWQETMETLAQVTFATVVCVVIGVPLGIAAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGICDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGCSRRQLLTRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ALNT DI  GFE+GL IV+LAI+LDR+   P+
Sbjct: 242 NALNTADISLGFEAGLAIVLLAIMLDRICKQPE 274


>gi|163801661|ref|ZP_02195559.1| putative permease of ABC transporter [Vibrio sp. AND4]
 gi|159174578|gb|EDP59380.1| putative permease of ABC transporter [Vibrio sp. AND4]
          Length = 293

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 135/278 (48%), Positives = 191/278 (68%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
           + I    +PLG++++     LT N   F + +S  L   +  V+ + +++PP   + + +
Sbjct: 15  NFITDNKLPLGEWMEMGVDWLTMNASGFFDAISIFLETIILFVVDIFKWMPPAAPIIMTA 74

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
            +  ++ RSI + V   + LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA  
Sbjct: 75  TIAWLLHRSIPLVVFIVLALLTILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAHR 134

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI   
Sbjct: 135 PWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITKV 194

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG P
Sbjct: 195 PEELIEAGKAFGASRMKLLFKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGKP 254

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           V+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 255 VVRALNTVNISQGFEAGLAIVLVAIILDRLCKAPNQKE 292


>gi|170724070|ref|YP_001751758.1| choline ABC transporter permease [Pseudomonas putida W619]
 gi|169762073|gb|ACA75389.1| choline ABC transporter, permease protein [Pseudomonas putida W619]
          Length = 281

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 133/273 (48%), Positives = 183/273 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LTQNG  + + ++  L   ++ V   L +  P V + + + L
Sbjct: 2   LIDQKIPLGQYIASFVEWLTQNGADYFDAIAQGLEFMIHGVTSTLTWFNPFVLIALFAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             +++R   + V  A+  LLI+  GYWQET ETL+ V  +T + + IGVPLG++AA  P 
Sbjct: 62  AHLIQRKWALTVFVALSFLLILNLGYWQETMETLAQVTFATVVCVAIGVPLGIVAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGICDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ALNT DI  GFE+GL IV+LAI+LDR+   P+
Sbjct: 242 NALNTADISLGFEAGLAIVLLAIMLDRICKQPE 274


>gi|323494633|ref|ZP_08099736.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           brasiliensis LMG 20546]
 gi|323311066|gb|EGA64227.1| glycine betaine/L-proline ABC transporter permease protein [Vibrio
           brasiliensis LMG 20546]
          Length = 280

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 132/279 (47%), Positives = 191/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IP+G++++     LT N   F + +S  L   +  V+ + +++PP + + + 
Sbjct: 1   MNFITNNKIPVGEWMETGVDWLTLNAAGFFDAISIFLETVILFVVDIFKWMPPALPILMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   + RSI + +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++A+ 
Sbjct: 61  AAIAWYLHRSIPLMLFIVGALLTILNLGYWQEMLETFVLVFAATTISVLIGVPIGIMASH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+  
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGMTK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELIEAGKAFGASRMKLLFKVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKTPNQKE 279


>gi|15673433|ref|NP_267607.1| betaine ABC transporter permease and substrate binding protein
           [Lactococcus lactis subsp. lactis Il1403]
 gi|7188801|gb|AAF37879.1|AF234619_2 OpuABC [Lactococcus lactis]
 gi|12724442|gb|AAK05549.1|AE006375_3 betaine ABC transporter permease and substrate binding protein
           [Lactococcus lactis subsp. lactis Il1403]
 gi|326406928|gb|ADZ63999.1| glycine betaine/carnitine/choline ABC transporter, permease and
           substrate-binding protein [Lactococcus lactis subsp.
           lactis CV56]
          Length = 573

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 107/276 (38%), Positives = 168/276 (60%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    +P+ +++      +T       +++       +N +   L  +P  + + VV
Sbjct: 1   MIDLAIGQVPIANWVSSATDWITSTFSSGFDVIQKSGTVLMNGITGALTAVPFWLMIAVV 60

Query: 61  SLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           ++L ++V  + I   + T +GL LI  QG W +   T++LVL+S+ +S+ IGVPLG+  A
Sbjct: 61  TILAILVSGKKIAFPLFTFIGLSLIANQGLWSDLMSTITLVLLSSLLSIIIGVPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+T LGI 
Sbjct: 121 KSDLVAKIVQPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                L EAA +FG+T  Q   K+E P A   I+A + QTIML+LSMVV+ +++G+ GLG
Sbjct: 181 QVSTELVEAADSFGSTARQKLFKLEFPLAKGTIMAGVNQTIMLALSMVVIASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
             VL A+ + DIG+GF SG+ +VILAII+DR     
Sbjct: 241 RGVLAAVQSADIGKGFVSGISLVILAIIIDRFTQKL 276


>gi|37676170|ref|NP_936566.1| ABC-type proline/glycine betaine transport system, permease
           component [Vibrio vulnificus YJ016]
 gi|37200711|dbj|BAC96536.1| ABC-type proline/glycine betaine transport system, permease
           component [Vibrio vulnificus YJ016]
          Length = 280

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 133/279 (47%), Positives = 190/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I +  +P G++++     LT N   F + ++F L   +  V+ + +++PP + +   
Sbjct: 1   MNFITENKLPFGEWMEMGVDWLTLNAAGFFDAVAFFLESIILFVVDLFKWMPPAMPIIAT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   + RSI + +   + LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++AA 
Sbjct: 61  ALIAWFLHRSIGLVLFVVLALLTILNLGYWQEMLETFVLVFAATTISVLIGVPIGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RRWIYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA   ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELVEAGKAFGANRLKLLLKVELPAALPSIMAGITQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P  ++
Sbjct: 241 PVVRALNTVNIAQGFEAGLAIVLVAIILDRLCKTPQQKE 279


>gi|83942956|ref|ZP_00955416.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Sulfitobacter sp. EE-36]
 gi|83845964|gb|EAP83841.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Sulfitobacter sp. EE-36]
          Length = 277

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 136/277 (49%), Positives = 188/277 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+ D  +  F  L  N  W  + L+  +   ++ +L+VLQ   PL+ + V 
Sbjct: 1   MNWLTDNKIPIDDAAEAVFDWLLINAGWLFDGLAVAMEWLIDAILWVLQTPHPLIVIAVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L   ++R+    +   +G L I+ Q YW+ETTE+L+LVL +  + M +GVP+G+ AA 
Sbjct: 61  GALTWAIQRNWKTPLLIMLGFLFILNQDYWEETTESLTLVLSACVVCMGVGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT+LGI S
Sbjct: 121 RPRMYRYMAPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTQLGIAS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGA P Q   K+ELP+A+PQI+  L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPKALLEAAQAFGAKPSQTLWKIELPYALPQIMTGLNQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALN V+ G GFESGL IV++AI+LDR+  +   
Sbjct: 241 PVVRALNQVNTGLGFESGLIIVVVAIMLDRMLRVTRK 277


>gi|295702996|ref|YP_003596071.1| glycine/betaine ABC transporter permease OpuAB [Bacillus megaterium
           DSM 319]
 gi|294800655|gb|ADF37721.1| glycine/betaine ABC transporter, permease protein OpuAB [Bacillus
           megaterium DSM 319]
          Length = 281

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 119/272 (43%), Positives = 181/272 (66%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G+++  F   L  N + F +++S I+   V+ ++ VL + P L+ + +V ++    
Sbjct: 6   KIPVGNWIDHFVTFLNDNIKGFFDVISAIVDGIVSFIVLVLTFPPALILILIVGIIAWFS 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +  +  + + +GLL I+  GYWQET +TL+LVL S  IS+ +G+PLG+ A+   +   I
Sbjct: 66  SKKWSFTILSMIGLLFILNLGYWQETMDTLALVLTSVLISIIVGIPLGIWASQSEKTARI 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPAL  FG+G+VPG++++++F++P ++RLT LGI   P  L E
Sbjct: 126 ITPILDFMQTMPAFVYLIPALFFFGIGVVPGVISSVIFAMPPTIRLTNLGIREVPADLVE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA A+G+T  Q   KV+LP A   I+A + Q+IMLSLSMVV+ +LVG+ GLG  V RA++
Sbjct: 186 AANAYGSTTKQKLFKVQLPLATKTIMAGINQSIMLSLSMVVIASLVGAPGLGAEVYRAVS 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            +++G GFE+G+ IVILAIILDR+      R 
Sbjct: 246 RLEVGTGFEAGISIVILAIILDRITQYFGNRS 277


>gi|220919715|ref|YP_002495018.1| choline ABC transporter, permease protein [Methylobacterium
           nodulans ORS 2060]
 gi|219952135|gb|ACL62526.1| choline ABC transporter, permease protein [Methylobacterium
           nodulans ORS 2060]
          Length = 285

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 144/279 (51%), Positives = 195/279 (69%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
           + I+   I LG +L+     L+++ +   +++S +L   V  +   L  +PPL  + + +
Sbjct: 3   NWIVDHKISLGIWLKAGVDFLSRHAQAVFDLISTVLGAMVQGLTDTLLAVPPLAMIGLFA 62

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
               ++ RS+ +A+     LLL+   GYWQ T ETLSLV+ ST   + +GVP+G+LAA  
Sbjct: 63  AGAYLLHRSLGLALFIVTSLLLVANLGYWQATIETLSLVIWSTAACVVVGVPVGILAAHR 122

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P FY+ IR  LD MQTIPTFVYLIP LVLFGLGMVPGI++T++F++P  +RLT+LGI S 
Sbjct: 123 PMFYAAIRPLLDLMQTIPTFVYLIPTLVLFGLGMVPGIISTVIFALPAPIRLTQLGISSV 182

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L+EAA A+GAT  Q+  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG P
Sbjct: 183 PESLREAALAYGATRTQMLFKVELPSAMPTILAGVTQCIMLSLSMVVIAALVGADGLGKP 242

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           V+RALNTV+I  GFE+GL IV+LAIILDR+   P PR R
Sbjct: 243 VVRALNTVNIAMGFEAGLAIVVLAIILDRVCKRPAPRSR 281


>gi|260903030|ref|ZP_05911425.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           AQ4037]
 gi|308108320|gb|EFO45860.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           AQ4037]
          Length = 280

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 137/279 (49%), Positives = 191/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    +PLG +++     LT N   F + +S  L   +  V+ + +++PP   + + 
Sbjct: 1   MNFITDNKLPLGQWMETGVDWLTINASGFFDAISITLETIIMFVVDIFKWMPPAAPIIMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   + RS+ + V   + LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA 
Sbjct: 61  AALAWFLHRSLPLVVFIVLALLAILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGII 
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGIIK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELLEAGKAFGASRMKLLFKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKAPNQKE 279


>gi|325273145|ref|ZP_08139441.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas sp. TJI-51]
 gi|324101720|gb|EGB99270.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas sp. TJI-51]
          Length = 281

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 131/273 (47%), Positives = 181/273 (66%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LT +G  F + ++  L   ++ V   L +  P V   + + L
Sbjct: 2   LIDQKIPLGQYIASFVEWLTLHGANFFDAIAQGLEFMIHGVTSALTWFNPFVLTALFAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             +++R  ++    A+  LLI+  GYWQET ETL+ V  +T + + IGVPLG++AA  P 
Sbjct: 62  AHLIQRKWSLTAFVALSFLLILNLGYWQETMETLAQVTFATVVCVAIGVPLGIVAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGICDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ALNT DI  GFE+GL IV+LAI+LDR+   P+
Sbjct: 242 NALNTADISLGFEAGLAIVLLAIMLDRICKQPE 274


>gi|70733048|ref|YP_262821.1| glycine/betaine/L-proline ABC transporter permease [Pseudomonas
           fluorescens Pf-5]
 gi|68347347|gb|AAY94953.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens Pf-5]
          Length = 287

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 131/275 (47%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IPLG Y+  F   LT++G    + ++  L   ++ V F L +  PL  + +++LL
Sbjct: 8   LTDQKIPLGQYIAAFVEWLTKHGANTFDAIATTLETMIHGVTFALTWFNPLALIGLIALL 67

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             +++R   +     +  LLI+  GYWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 68  AHLIQRKWGLTAFVVLSFLLILNLGYWQETMETLAQVLFATLVCVLIGVPLGIVAAHKPL 127

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+++R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 128 FYTMMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 187

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 188 ELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 247

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   P+ +
Sbjct: 248 NALNTADIALGFEAGLAIVLLAIMLDRICKQPEAK 282


>gi|260771576|ref|ZP_05880496.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio metschnikovii CIP 69.14]
 gi|260613353|gb|EEX38552.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio metschnikovii CIP 69.14]
          Length = 279

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 135/276 (48%), Positives = 194/276 (70%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I +  IPLG +++ F   LT +GE F ++++F+L  ++ L++ + + +PP   + + + L
Sbjct: 2   ITEHKIPLGQWMESFVDWLTIHGERFFDVIAFVLESSILLLIDLFKAMPPAAPILITAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              + RS ++ +     LLLI+  GYWQE  ET  LV  +T IS+ IGVP+G++AA    
Sbjct: 62  AWWLHRSFSLVIFIIASLLLILNLGYWQEMLETFVLVFAATTISVLIGVPIGIMAAHRAW 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+   P 
Sbjct: 122 LYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTRVPE 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELLEAGKAFGASKMKLLFKVELPAALPSIMAGITQCIMLSLSMVVIAALVGADGLGKPVI 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           RALNTV+I +GFE+GL IV++AIILDRL   P  ++
Sbjct: 242 RALNTVNISQGFEAGLAIVLVAIILDRLCKTPQRKE 277


>gi|260767494|ref|ZP_05876430.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio furnissii CIP 102972]
 gi|260617394|gb|EEX42577.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio furnissii CIP 102972]
          Length = 280

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 137/276 (49%), Positives = 192/276 (69%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    IPLG +++     LT +   F + +SF+L   + +++ V ++ PP V + V + L
Sbjct: 2   ISDHKIPLGHWMEAGVDWLTLHASGFFDAISFLLESIIMVLVDVFKWFPPAVPIIVTAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              + RS+++ +     LLLI+  GYWQE  ET  LV  +T IS+ IGVPLG++AA  P 
Sbjct: 62  AWWLHRSLSLVIFIIAALLLILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAHRPW 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+   P 
Sbjct: 122 MYTVMRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTRVPE 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ALIEAGKAFGASKMKLLFKVELPAALPSIMAGITQCIMLSLSMVVIAALVGADGLGKPVI 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 242 RALNTVNISQGFEAGLAIVLVAIILDRLCKAPNSKE 277


>gi|73669863|ref|YP_305878.1| glycine betaine/L-proline ABC transporter permease [Methanosarcina
           barkeri str. Fusaro]
 gi|72397025|gb|AAZ71298.1| glycine betaine/L-proline ABC transporter, permease [Methanosarcina
           barkeri str. Fusaro]
          Length = 274

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 127/272 (46%), Positives = 178/272 (65%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+GD ++     +  N   F + +S  L   ++ +   L +LPP +F+ V+ LL   V
Sbjct: 3   RLPVGDTVELAVDWIEANFGQFLDTISQQLDFLISSLKDALLFLPPELFIAVIFLLAYFV 62

Query: 68  -KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            KR+I +A GTA+G  LI   G W  + ETL+LVL ST +++ IG+PLG+L+A      S
Sbjct: 63  GKRNIKLAAGTAIGFFLIQNMGLWTLSMETLALVLSSTLLALIIGIPLGILSAKNTTLSS 122

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I++  LD MQT+P FVYLIPAL+ F LG VP ++AT+VF++P ++RLT LGI   P  L 
Sbjct: 123 ILKPVLDFMQTMPPFVYLIPALIFFQLGNVPSMIATVVFAMPPAIRLTNLGIRQVPIELT 182

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           E A +FG+T +Q   KVELP A+P I+A + Q IMLSLSMVV+ A++G+ GLG  VL  +
Sbjct: 183 EVADSFGSTSWQKLSKVELPVALPTIMAGVNQCIMLSLSMVVIAAMIGARGLGYQVLLGI 242

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VDIG GFE+GL IVI+A+ LDR+     PR
Sbjct: 243 QRVDIGMGFEAGLSIVIIAVFLDRITQHLSPR 274


>gi|20090989|ref|NP_617064.1| glycine betaine/L-proline ABC transporter, permease [Methanosarcina
           acetivorans C2A]
 gi|19916076|gb|AAM05544.1| glycine betaine/L-proline ABC transporter, permease [Methanosarcina
           acetivorans C2A]
          Length = 276

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 124/276 (44%), Positives = 178/276 (64%), Gaps = 1/276 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           ++   +P+GD ++     +  N     + +S  L   ++ +   L  LPP +F+ V++LL
Sbjct: 1   MLIPRLPIGDTVEFAVDWIEANFGSLLDFISDKLDFLISGLKDALLLLPPELFILVIALL 60

Query: 64  VLMV-KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
                KR++ +A+GTA G  LI   G W  + ETL+LVL S  +++ IG+P G+L+A   
Sbjct: 61  AYFAGKRNLKLAIGTAFGFFLIDNMGLWTLSMETLALVLSSALLALIIGIPTGILSAKNE 120

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
             Y  ++  LD MQT+P FVYLIPAL+ FGLG VPG++AT+VF++P ++RLT LGI   P
Sbjct: 121 VLYHFLKPTLDFMQTMPPFVYLIPALLFFGLGNVPGMIATVVFAMPPAIRLTNLGIRQVP 180

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L E A AFG+T +Q   KVELP A+P I+A + Q IMLSLSMVV+ A++G+ GLG  V
Sbjct: 181 KELTEVADAFGSTGWQKLTKVELPVALPTIMAGINQCIMLSLSMVVIAAMIGARGLGYQV 240

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           L  +  VDIG GFE+GL IVI+A++LDR+     PR
Sbjct: 241 LFGIQRVDIGLGFEAGLAIVIIAVVLDRVTQHLSPR 276


>gi|254882041|ref|ZP_05254751.1| binding-protein-dependent transport system inner membrane component
           [Bacteroides sp. 4_3_47FAA]
 gi|319640951|ref|ZP_07995659.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 3_1_40A]
 gi|254834834|gb|EET15143.1| binding-protein-dependent transport system inner membrane component
           [Bacteroides sp. 4_3_47FAA]
 gi|317387396|gb|EFV68267.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 3_1_40A]
          Length = 274

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 113/272 (41%), Positives = 173/272 (63%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT+N     + ++  +   ++    +L ++P  V + ++++L     
Sbjct: 2   INIGKYIETAINWLTENFAPLFDAINVGIGGFIDGFQNILMWIPFYVTIALLAILAWYKS 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +++ T +GLLLI   G+W ET +TL+LVL ST I++ +G+PLG+ +A   R   I+
Sbjct: 62  GK-GVSIFTILGLLLIWGMGFWNETMQTLALVLSSTIIALIVGLPLGIWSANSKRCDKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 HPILDLMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTSLGIKQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGATP Q+  KV+LP A+P I+  + QTI++SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATPMQLLFKVQLPLALPTIMTGINQTILMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAIILDR+      + +
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGLGKQKK 272


>gi|28900965|ref|NP_800620.1| putative permease [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836719|ref|ZP_01989386.1| ABC-type proline/glycine betaine transport system, permease
           component [Vibrio parahaemolyticus AQ3810]
 gi|260366177|ref|ZP_05778637.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           K5030]
 gi|260879819|ref|ZP_05892174.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           AN-5034]
 gi|260894493|ref|ZP_05902989.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           Peru-466]
 gi|28809411|dbj|BAC62453.1| putative permease of ABC transporter [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149750068|gb|EDM60813.1| ABC-type proline/glycine betaine transport system, permease
           component [Vibrio parahaemolyticus AQ3810]
 gi|308086416|gb|EFO36111.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308092739|gb|EFO42434.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308114846|gb|EFO52386.1| choline ABC transporter, permease protein [Vibrio parahaemolyticus
           K5030]
          Length = 280

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 136/279 (48%), Positives = 191/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    +PLG +++     LT N   F + +S  L   +  V+ + +++PP   + + 
Sbjct: 1   MNFITDNKLPLGQWMETGVDWLTINASVFFDAISITLETIIMFVVDIFKWMPPAAPIIIT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   + RS+ + +   + LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA 
Sbjct: 61  AALAWFLHRSLPLVIFIVVALLAILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGII 
Sbjct: 121 RPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGIIK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELLEAGKAFGASRMKLLFKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKAPNQKE 279


>gi|167031338|ref|YP_001666569.1| choline ABC transporter permease [Pseudomonas putida GB-1]
 gi|166857826|gb|ABY96233.1| choline ABC transporter, permease protein [Pseudomonas putida GB-1]
          Length = 281

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 134/273 (49%), Positives = 183/273 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LTQNG  + + ++  L   ++ V   L +  P V + + + L
Sbjct: 2   LIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTNALTWFNPFVLIALFAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
             +++R   + V  A+  LLI+  GYWQET ETL+ V  +T + + IGVPLG+LAA  P 
Sbjct: 62  AHLIQRKWALTVFVALSFLLILNLGYWQETMETLAQVTFATVVCVVIGVPLGILAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGICDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ALNT DI  GFE+GL IV+LAI+LDR+   P+
Sbjct: 242 NALNTADISLGFEAGLAIVLLAIMLDRICKQPE 274


>gi|315178683|gb|ADT85597.1| hypothetical permease of ABC transporter [Vibrio furnissii NCTC
           11218]
          Length = 280

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 137/276 (49%), Positives = 192/276 (69%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    IPLG +++     LT +   F + +SF+L   + +++ V ++ PP V + V + L
Sbjct: 2   ISDHKIPLGHWMEAGVDWLTLHASGFFDAISFLLESIIMVLVDVFKWFPPAVPIIVTAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              + RS+++ +     LLLI+  GYWQE  ET  LV  +T IS+ IGVPLG++AA  P 
Sbjct: 62  AWWLHRSLSLVIFIIAALLLILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAHRPW 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y+++R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+   P 
Sbjct: 122 MYTVMRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTRVPE 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EA  AFGA+  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ALIEAGKAFGASNMKLLFKVELPAALPSIMAGITQCIMLSLSMVVIAALVGADGLGKPVI 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 242 RALNTVNISQGFEAGLAIVLVAIILDRLCKAPNSKE 277


>gi|304392280|ref|ZP_07374222.1| choline ABC transporter, permease protein [Ahrensia sp. R2A130]
 gi|303296509|gb|EFL90867.1| choline ABC transporter, permease protein [Ahrensia sp. R2A130]
          Length = 278

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 147/274 (53%), Positives = 200/274 (72%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G   +     L  NG  F + L   L   V  +L VLQ+ PPL+ V ++
Sbjct: 1   MEWLTDNKIPVGKAAESVVDWLIANGSAFFDALENGLSVIVEAILAVLQFPPPLIGVAII 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  ++ RSI   +  A+GLL I+ QGYW+ETTETL+LVL S F+ M IGVP+G+  A 
Sbjct: 61  TVMSFLLHRSIIFTIAMAVGLLFIVNQGYWEETTETLTLVLSSAFLCMAIGVPIGIYLAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           +PR ++I R  LD MQT+PTFVYLIPA++ FG+GMVPG+VAT++F IP  +RLT+LGI +
Sbjct: 121 HPRAFAIARPILDLMQTLPTFVYLIPAIIFFGIGMVPGLVATVIFVIPAPIRLTQLGIAA 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L+EA  AFGA+ +Q+ RKVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLG+
Sbjct: 181 TPAALREAGTAFGASSWQMLRKVELPYALPQIMAGLTQTIMLSLSMVVIAALVGADGLGI 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSI 274
           P++RALNTV+   GFE+G  IV+LAI+LDRL  +
Sbjct: 241 PIVRALNTVNTSLGFEAGFVIVVLAILLDRLLRV 274


>gi|284009253|emb|CBA76363.1| glycine betaine/L-proline ABC transporter, permease protein
           [Arsenophonus nasoniae]
          Length = 308

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 114/281 (40%), Positives = 158/281 (56%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P  Q  IPL  ++      +  +       +   +   ++    +L  LP  + +   
Sbjct: 1   MHPFQQPLIPLDSWVSHAIDWIVLHFHPLFQGIRLPIDFMLSRFEQILTTLPATLIIISF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL   +  +  +AV T + L+ I   G W E   TLSLVL S F  + IG+PLG+  A 
Sbjct: 61  ALLAWQLA-NKKVAVATFISLVFIGAIGAWSEAMITLSLVLTSLFFCLLIGLPLGIWLAN 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPGIV TI+F++P  +RLT LGI  
Sbjct: 120 SKPASQIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGIVVTIIFALPPIIRLTILGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA+  Q+  KV+LP A P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 180 VPDDLIEAAESFGASRNQLLFKVQLPLAAPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            VLR +  +D+G     G  IVILAIILDRL      +  I
Sbjct: 240 MVLRGIGRLDMGLAAVGGTGIVILAIILDRLTQSLGEKASI 280


>gi|320011770|gb|ADW06620.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Streptomyces flavogriseus ATCC 33331]
          Length = 875

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 106/271 (39%), Positives = 157/271 (57%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +  G ++++    L  N  W  + +  +L    + V  VL    PL+   + +++   +
Sbjct: 3   RLSFGSWVEDAVDWLQSNLTWIFDFIKTVLGGMYDGVNAVLGGGEPLLMAGIFAVIAFWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +  AV T +G  LI     W E   TLSLV+V+  I++ I VP G+ AA   R  S 
Sbjct: 63  -RGVIPAVATFVGFALIDSLALWDEAMATLSLVVVAAVITIVIAVPTGIWAARNSRVSSA 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIP ++ FG+G+ PG++ATIVF++P  VR+T LGI      L E
Sbjct: 122 LRPVLDVMQTMPAFVYLIPGVMFFGVGVTPGVIATIVFAMPPGVRMTELGIRQVDSELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG +P     +V+LP A+P I+A + Q IML+LSMVV+  + G+ GLG  V  A+ 
Sbjct: 182 AAEAFGTSPKHTLTRVQLPLALPTIMAGINQVIMLALSMVVIGGMAGAGGLGEKVYAAIT 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            + +G   ESG+ +VILA+ LDR+    + R
Sbjct: 242 QLQVGLAAESGIAVVILAMYLDRMTGALNER 272


>gi|77461460|ref|YP_350967.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77385463|gb|ABA76976.1| putative glycine betaine/L-proline ABC transport system, membrane
           protein [Pseudomonas fluorescens Pf0-1]
          Length = 287

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 134/275 (48%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LTQ+G    + ++  L   ++ V F L +  PLV + +++LL
Sbjct: 8   LIDQKIPLGQYIAGFVEWLTQHGANTFDAIAVTLETMIHGVTFALTWFNPLVLIGLIALL 67

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   +        LLI+  GYWQET ETL+ V+ +T + + IGVPLG++AA  P 
Sbjct: 68  AHFIQRKWGLTAFVVASFLLILNLGYWQETMETLAQVMFATLVCVVIGVPLGIVAAHKPM 127

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+++R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 128 FYTLMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 187

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 188 ELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 247

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   PD +
Sbjct: 248 NALNTADIALGFEAGLAIVLLAIMLDRICKQPDAK 282


>gi|254719609|ref|ZP_05181420.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella sp. 83/13]
 gi|265984617|ref|ZP_06097352.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. 83/13]
 gi|306837899|ref|ZP_07470759.1| choline ABC transporter, permease protein [Brucella sp. NF 2653]
 gi|264663209|gb|EEZ33470.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. 83/13]
 gi|306406987|gb|EFM63206.1| choline ABC transporter, permease protein [Brucella sp. NF 2653]
          Length = 278

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 135/278 (48%), Positives = 196/278 (70%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   P + + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPFLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+  A 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAVAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|150005778|ref|YP_001300522.1| glycine betaine/L-proline transport system permease [Bacteroides
           vulgatus ATCC 8482]
 gi|294776156|ref|ZP_06741645.1| ABC transporter, permease protein [Bacteroides vulgatus PC510]
 gi|149934202|gb|ABR40900.1| glycine betaine/L-proline transport system permease [Bacteroides
           vulgatus ATCC 8482]
 gi|294449979|gb|EFG18490.1| ABC transporter, permease protein [Bacteroides vulgatus PC510]
          Length = 274

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 113/272 (41%), Positives = 173/272 (63%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT+N     + ++  +   ++    +L ++P  V + ++++L     
Sbjct: 2   INIGKYIETAINWLTENFAPLFDAINVGIGGFIDGFQNILMWIPFYVTIALLAILAWYKS 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +++ T +GLLLI   G+W ET +TL+LVL ST I++ +G+PLG+ +A   R   I+
Sbjct: 62  GK-GVSIFTILGLLLIWGMGFWNETMQTLALVLSSTIIALIMGLPLGIWSANSKRCDKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 HPILDLMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTSLGIKQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGATP Q+  KV+LP A+P I+  + QTI++SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATPMQLLFKVQLPLALPTIMTGINQTILMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAIILDR+      + +
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGLGKQKK 272


>gi|261252053|ref|ZP_05944627.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio orientalis CIP 102891]
 gi|260938926|gb|EEX94914.1| L-proline Glycine Betaine ABC transport system permease protein
           proW [Vibrio orientalis CIP 102891]
          Length = 280

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 136/279 (48%), Positives = 190/279 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG +++     LT N     + ++  L   +  V+ + +++PP + + + 
Sbjct: 1   MNFITDNKIPLGQWMEAGVDWLTFNAAGLFDAIAIFLETIILFVVDIFKWMPPAMPIVMT 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++   + RSI + +     LL I+  GYWQE  ET  LV  +T IS+ IGVPLG++AA 
Sbjct: 61  AVIAWYLHRSIPLVLFVIGALLTILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+I+R  LD MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LGI  
Sbjct: 121 RPWLYTIMRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGITK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGAT  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELVEAGKAFGATRMKLLFKVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+GL IV++AIILDRL   P+ ++
Sbjct: 241 PVVRALNTVNISQGFEAGLAIVLVAIILDRLCKSPNQKE 279


>gi|317154718|ref|YP_004122766.1| binding-protein-dependent transporter inner membrane component
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316944969|gb|ADU64020.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio aespoeensis Aspo-2]
          Length = 275

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 114/275 (41%), Positives = 163/275 (59%), Gaps = 1/275 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
             +  IPL  ++      L  N       L + + + +N +   L  L PL+ +  V  +
Sbjct: 2   FEEQVIPLDLWVSNGVDWLVTNHRDIFQALKWPVEQTLNGLDAGLNALHPLMVIAAVVFV 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                    +AV T   ++LI   G W+++  TL++VL S      +G+PLG+ A    R
Sbjct: 62  AWRFVGK-RMAVFTLGSMVLIGLLGLWEDSMTTLAMVLSSVVFCFVVGIPLGIAAGRSDR 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           F S +R  LD+MQT P FVYL+P ++LF +G V G++ATI+F++P  +RLT LGI    P
Sbjct: 121 FESALRPVLDAMQTTPAFVYLVPIVMLFSVGNVAGVLATIIFALPPIIRLTSLGIRGVHP 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA AFGAT  QV  +V++P A+P I+A L QTIM++LSMVV+ AL+G+ GLG PV+
Sbjct: 181 ELIEAAQAFGATRTQVLLRVQVPLAMPTILAGLNQTIMMALSMVVIAALIGAGGLGSPVV 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             LNT+DIGR    GL IV++AIILDR+      R
Sbjct: 241 LGLNTLDIGRAVIGGLGIVLMAIILDRITQSMARR 275


>gi|229593055|ref|YP_002875174.1| putative glycine betaine/L-proline ABC transporter membrane protein
           [Pseudomonas fluorescens SBW25]
 gi|229364921|emb|CAY53014.1| putative glycine betaine/L-proline ABC transport system, membrane
           protein [Pseudomonas fluorescens SBW25]
          Length = 281

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 134/275 (48%), Positives = 186/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           + +  IPLG Y+  F   LTQ+G  + + ++  L   ++ V F L +  PL  + +++LL
Sbjct: 2   LTEQKIPLGQYIAAFVEWLTQHGANYFDAIASTLETMIHGVTFALTWFNPLALIGLIALL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V      LLI+  GYWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVIASFLLILNLGYWQETMETLAQVLFATLVCVVIGVPLGIVAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+++R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTLMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   PD +
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPDAK 276


>gi|119944387|ref|YP_942067.1| glycine betaine ABC transporter, binding protein inner membrane
           component [Psychromonas ingrahamii 37]
 gi|119862991|gb|ABM02468.1| glycine betaine ABC transporter, binding protein inner membrane
           component [Psychromonas ingrahamii 37]
          Length = 356

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 102/280 (36%), Positives = 157/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           + P  +A +P   +++     L  +G      +   +   +      L   P  + + ++
Sbjct: 49  LHPFQEAIMPFDQWVETGLNWLVVHGRPVFQAIRVPIDLILTSFQSALVSTPAPIMLLIL 108

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+   +     + + +   L++I   G W +   TL+LV+ S F    +G+PLG+  A 
Sbjct: 109 ALIAWQLAGP-RMGITSLFSLIIIGLVGAWSQAMVTLALVMTSVFFCFLMGLPLGIWLAR 167

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 168 SQSAAKIIRPMLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIQQ 227

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFGA+P Q+  +++LP A+P I+A + QT+MLSLSMVV+ +++   GLG 
Sbjct: 228 VPEELIEAGHAFGASPKQMLYRIQLPLAMPTIMAGVNQTLMLSLSMVVIASMIAVGGLGQ 287

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     GL IVILAI+LDR+        R
Sbjct: 288 MVLRGIGRLDMGLAAVGGLGIVILAILLDRITQTIGKNKR 327


>gi|212693216|ref|ZP_03301344.1| hypothetical protein BACDOR_02726 [Bacteroides dorei DSM 17855]
 gi|237709959|ref|ZP_04540440.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 9_1_42FAA]
 gi|237725376|ref|ZP_04555857.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. D4]
 gi|265753610|ref|ZP_06088965.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 3_1_33FAA]
 gi|212664321|gb|EEB24893.1| hypothetical protein BACDOR_02726 [Bacteroides dorei DSM 17855]
 gi|229436063|gb|EEO46140.1| glycine betaine/L-proline transport system permease [Bacteroides
           dorei 5_1_36/D4]
 gi|229456052|gb|EEO61773.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 9_1_42FAA]
 gi|263235324|gb|EEZ20848.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 3_1_33FAA]
          Length = 274

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 114/272 (41%), Positives = 174/272 (63%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT+N     + ++  +   ++    +L ++P  V + ++++L    K
Sbjct: 2   INIGKYIETAINWLTENFAPLFDAINVGIGGFIDGFQNILMWIPFYVTIALLAILAWY-K 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +++ T +GLLLI   G+W ET +TL+LVL ST I++ +G+PLG+ +A   R   I+
Sbjct: 61  SGKGVSIFTILGLLLIWGMGFWNETMQTLALVLSSTIIALIMGLPLGIWSANSKRCDKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 HPILDLMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTSLGIKQVPKNVIEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGATP Q+  KV+LP A+P I+  + QTI++SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATPMQLLFKVQLPLALPTIMTGINQTILMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + IG GFE G+ +VILAIILDR+      + +
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGLGKQKK 272


>gi|26987037|ref|NP_742462.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas putida KT2440]
 gi|148545570|ref|YP_001265672.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas putida F1]
 gi|24981657|gb|AAN65926.1|AE016220_8 glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas putida KT2440]
 gi|148509628|gb|ABQ76488.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas putida F1]
 gi|313496659|gb|ADR58025.1| Glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas putida BIRD-1]
          Length = 281

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 133/273 (48%), Positives = 181/273 (66%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LTQNG  + + ++  L   ++ V   L +  P V + + + L
Sbjct: 2   LIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTSALTFFNPFVLIALFAAL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   +    A+  LLI+  GYWQET ETL+ V  +T + + IGVPLG+LAA  P 
Sbjct: 62  AHFIQRKWALTAFVALSFLLILNLGYWQETMETLAQVTFATVVCVVIGVPLGILAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGICDVPQ 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            ALNT DI  GFE+GL IV+LAI+LDR+   P+
Sbjct: 242 NALNTADISLGFEAGLAIVLLAIMLDRICKQPE 274


>gi|226314655|ref|YP_002774551.1| glycine betaine ABC transporter permease protein [Brevibacillus
           brevis NBRC 100599]
 gi|226097605|dbj|BAH46047.1| glycine betaine ABC transporter permease protein [Brevibacillus
           brevis NBRC 100599]
          Length = 281

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 113/272 (41%), Positives = 171/272 (62%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL  +++     L +N  +  + +S  +   V+L  ++L  +P    + + +LL    
Sbjct: 9   KLPLDSWVETIVDGLEKNLGFLFDFISAGIGGTVDLFSWILTGIPFWALIILFTLLAYRA 68

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +   IA+ T +GLLLI   GYW+ + ETL+LVL +  IS+ IG+P+G+  A       +
Sbjct: 69  GKVA-IALFTFIGLLLIQNLGYWEHSMETLALVLTAGLISVIIGIPVGIWCAKNDSVQKV 127

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG VPG++A+++F++P ++RLT LGI   P  L E
Sbjct: 128 VTPLLDFMQTMPAFVYLIPAIFFFGLGKVPGVIASVIFAMPPTIRLTNLGIRQVPADLIE 187

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFG+T +Q   KV+LP A   ++A + Q+IML+LSMVV+ +++G+ GLG  V RA+ 
Sbjct: 188 ASEAFGSTYWQKLTKVQLPIAKTTMMAGINQSIMLALSMVVIASMIGAKGLGADVYRAVT 247

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            + IG GFE+GL IVILAI+LDRL      R 
Sbjct: 248 QIKIGEGFEAGLAIVILAILLDRLTQSVGKRK 279


>gi|241205792|ref|YP_002976888.1| choline ABC transporter permease [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859682|gb|ACS57349.1| choline ABC transporter, permease protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 285

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 170/277 (61%), Positives = 216/277 (77%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++ I +  IP+G + + F   LT NGEWF N ++F+L  A++ +LFVLQ   PL+ +  +
Sbjct: 5   LNWITEFKIPVGPWAKSFVDWLTSNGEWFFNQIAFLLSSAIDGLLFVLQKPHPLIVIAAI 64

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   ++RSI +AV T +GLLLI+ Q YW+ETTETL+LVL +TF+ M IG+PLG+ AA 
Sbjct: 65  TAIAFWLRRSIAVAVFTCLGLLLIVNQDYWKETTETLALVLAATFVCMVIGIPLGIAAAR 124

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 125 RPWVYAAMRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 184

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA AFGATP QV RK+ELPFA PQI+A LTQTIMLSLSMVV+ ALVG+ GLGV
Sbjct: 185 TPPSLVEAAIAFGATPIQVLRKIELPFATPQIMAGLTQTIMLSLSMVVIAALVGAPGLGV 244

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+I +GFE+G CIVILAIILDR+F     
Sbjct: 245 PVVRALNTVNIAKGFEAGFCIVILAIILDRMFRTAGE 281


>gi|269957314|ref|YP_003327103.1| binding-protein-dependent transport systems inner membrane
           component [Xylanimonas cellulosilytica DSM 15894]
 gi|269305995|gb|ACZ31545.1| binding-protein-dependent transport systems inner membrane
           component [Xylanimonas cellulosilytica DSM 15894]
          Length = 289

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 110/274 (40%), Positives = 162/274 (59%), Gaps = 1/274 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG ++  F   +T         +  +L    + +  +L   P  V   V++ L L  
Sbjct: 8   RLPLGQWVDTFVDWVTATFRPLFRFIKDVLDGVYDGLDTILSGPPFWVVAIVLAALALFA 67

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           K    +A+G+ +G ++I     W    +TL+LVL+S  I++ + VPLG+ AA   R    
Sbjct: 68  KG-WKLALGSLVGFVVIAGVNQWGNAMDTLALVLLSAAIALILAVPLGIWAARNERVSQT 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIP +V+F  G VPGI+ATI+F++   VR T LGI      + E
Sbjct: 127 LRPVLDFMQTMPGFVYLIPTVVIFLTGPVPGIIATIIFAMAPGVRFTELGIRQVDKEVVE 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGATP ++ R+++LP A+P ++A + Q IMLSLSMVV+  +VG+ GLG  V+ AL 
Sbjct: 187 AGHAFGATPGRILRQIQLPLALPTVMAGVNQVIMLSLSMVVIAGMVGAGGLGNDVVAALQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            VD+  GFE+GL +VILA+ LDR+ S    R  +
Sbjct: 247 RVDVALGFEAGLAVVILAMFLDRVTSALGERAPV 280


>gi|126650095|ref|ZP_01722328.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Bacillus sp.
           B14905]
 gi|169827315|ref|YP_001697473.1| glycine betaine transport system permease [Lysinibacillus
           sphaericus C3-41]
 gi|126593267|gb|EAZ87229.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Bacillus sp.
           B14905]
 gi|168991803|gb|ACA39343.1| Glycine betaine transport system permease protein [Lysinibacillus
           sphaericus C3-41]
          Length = 284

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 112/282 (39%), Positives = 168/282 (59%), Gaps = 3/282 (1%)

Query: 1   MSPIIQA--PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVC 58
           M+  +     IPL  +++     LT N   F N +       +N V  +L  +P ++ + 
Sbjct: 1   MNNFLDNIPTIPLAPWVESAMDWLTSNFSAFFNSIQQFGKLLMNQVTDLLNSIPAIILIL 60

Query: 59  VVSLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVL 117
           +V +       +   +A  + +GLL I  QG W    ET +LV+ S+ IS+ IG+PLG+L
Sbjct: 61  LVVVFAFYATGKKFGLASFSLIGLLFIYNQGLWTNLMETTTLVIFSSIISIIIGIPLGIL 120

Query: 118 AAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLG 177
            +      SII+  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+T LG
Sbjct: 121 MSKSTIAESIIKPILDFMQTMPGFVYLIPAVAFFGIGIVPGVFASVIFALPPTVRMTNLG 180

Query: 178 IISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNG 237
           I   P  L EAA ++G+T  Q   KVE+P A   I+A + QT+MLSLSMVV+ +++G+ G
Sbjct: 181 IRQVPKELVEAADSYGSTASQKLFKVEIPLAKSTIMAGINQTVMLSLSMVVIASMIGAPG 240

Query: 238 LGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           LG  VL AL    +G GF +GL +VI AII+DRL    + + 
Sbjct: 241 LGREVLTALQRTQVGNGFVAGLGLVIFAIIIDRLTQSFNKKK 282


>gi|256831080|ref|YP_003159808.1| binding-protein-dependent transport systems inner membrane
           component [Desulfomicrobium baculatum DSM 4028]
 gi|256580256|gb|ACU91392.1| binding-protein-dependent transport systems inner membrane
           component [Desulfomicrobium baculatum DSM 4028]
          Length = 278

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 107/274 (39%), Positives = 166/274 (60%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+G+ ++     L ++  +     + I+   +  +   L  +P  VF+ +V   V 
Sbjct: 3   EYKLPVGEVIETGIDFLVEHLSFITKASAEIVEMLLGAMESGLLLIPIPVFIVLVGAGVW 62

Query: 66  MVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFY 125
            + +   + +G+A+GL LI   G W  T  T++LVLV+T  ++ IGVPLG+ AA     Y
Sbjct: 63  FLTKERKLTLGSALGLALIWNMGLWTATVSTIALVLVATLCAIAIGVPLGICAAISKGTY 122

Query: 126 SIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPIL 185
            ++   LD MQT+P FVYLIPA+  FGLG    I +T++FS+P ++R T LGI   P  L
Sbjct: 123 RVVMPILDVMQTMPAFVYLIPAIPFFGLGKTAAIFSTVIFSMPPAIRFTCLGIRQIPAEL 182

Query: 186 KEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRA 245
            E + AFGAT  Q   K++LP A P I+A + QT+ML+LSMVV+ +++G+ GLG  V +A
Sbjct: 183 VECSTAFGATRMQRLYKLDLPLAAPTIMAGINQTVMLALSMVVIASMIGAKGLGGEVWKA 242

Query: 246 LNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           +  + +GRGFE+G+ IVI+A+ILDR+      R 
Sbjct: 243 IQRLQMGRGFEAGIAIVIVAMILDRVLQKLGTRK 276


>gi|222149405|ref|YP_002550362.1| ABC transporter membrane spanning protein (proline/glycine betaine)
           [Agrobacterium vitis S4]
 gi|221736388|gb|ACM37351.1| ABC transporter membrane spanning protein (proline/glycine betaine)
           [Agrobacterium vitis S4]
          Length = 281

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 170/276 (61%), Positives = 216/276 (78%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G   +     LT NG WF + LS ++  +++ VLFVLQY  PLV    +
Sbjct: 1   MDWLTDFKIPIGPTAKVVVDWLTANGAWFFDWLSHLISSSIDGVLFVLQYPNPLVTALAI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           S++  +++RS+ +A+ T +GL LII QGY++ETTETL+LVL ST + M IGVPLG+LAA 
Sbjct: 61  SIIAWLLRRSLLVAIFTFLGLALIINQGYFKETTETLALVLASTAVCMLIGVPLGILAAR 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               Y+++R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F++P+ +RLTRLGI+S
Sbjct: 121 RAWIYALMRPVLDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAVPSPIRLTRLGIVS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGATP QV RKVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG+ GLGV
Sbjct: 181 TPSSLVEAAVAFGATPTQVLRKVELPYALPQIMAGLTQTIMLSLSMVVIAALVGAAGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           PV+RALNTV+I RGFE+GLCIVILAIILDR+F IP 
Sbjct: 241 PVVRALNTVNIARGFEAGLCIVILAIILDRMFRIPS 276


>gi|326798242|ref|YP_004316061.1| glycine/betaine ABC transporter permease [Sphingobacterium sp. 21]
 gi|326549006|gb|ADZ77391.1| ABC-type transporter, integral membrane subunit [Sphingobacterium
           sp. 21]
          Length = 278

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 116/275 (42%), Positives = 168/275 (61%), Gaps = 1/275 (0%)

Query: 5   IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLV 64
           ++  I +G Y+ E    LT+N   F + +       +  V ++   +P  V + + + + 
Sbjct: 1   MEKIIDIGQYVAEAVNWLTENLRPFFDFIKNTGNAGIEGVEWIFVSIPFYVTIALFTFIA 60

Query: 65  LMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
              +    IA+ T +GL LI   G+W+ET +TL+L+L ST I++ I VPLG+ +A     
Sbjct: 61  WR-RAGKGIALFTLLGLGLIYLMGFWEETMQTLALILSSTLIALVIAVPLGIWSAKNQTA 119

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
           + IIR  LD MQT+P FVYLIPA++ F +G +PG  ATI+F++P +VRLT LGI      
Sbjct: 120 HKIIRPLLDLMQTMPAFVYLIPAVLFFSIGKLPGAFATIIFAMPPAVRLTTLGIEQVQGD 179

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           + EAA + GAT  Q+  KVELP A+  I+  + QTI+LSLSMVV+  ++ + GLG  VL 
Sbjct: 180 VLEAARSLGATQRQILLKVELPLALKTILTGINQTILLSLSMVVIAGMIAAGGLGEKVLE 239

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            +N +DIG GFESGL +VILAIILDR+      R 
Sbjct: 240 GINNLDIGLGFESGLAVVILAIILDRITQSFGNRS 274


>gi|126461621|ref|YP_001042735.1| binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides ATCC 17029]
 gi|126103285|gb|ABN75963.1| binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides ATCC 17029]
          Length = 284

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 137/277 (49%), Positives = 188/277 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +  +    +P+G + +  F  L  NG  F N++S ++   ++ +L VL   PPL+ + ++
Sbjct: 8   LGWLTDHKLPVGRWSKMGFDWLNANGGPFFNLISRMMQAVIDAMLNVLDAAPPLLVIAIL 67

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   ++R+  +      G   I+ QGYW ET ++L+L++++    M IGVPLG+ AA 
Sbjct: 68  AALAWFLQRNWRVTALVVAGFAFILNQGYWDETMQSLTLIVLACVTCMAIGVPLGIAAAH 127

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FGLGMVPG++AT++F +P  +RLT LGI S
Sbjct: 128 RPRLYQAMSPVLDLMQTLPTFVYLIPAIVFFGLGMVPGLIATVIFVLPAPIRLTHLGIAS 187

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  LKEAA AFGATP Q   KVELP+A PQI+  L QTIMLSLSMVV+ ALVG+NGLGV
Sbjct: 188 TPMALKEAATAFGATPRQRLWKVELPYAFPQIMTGLNQTIMLSLSMVVIAALVGANGLGV 247

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+   GFESG  IV++AI+LDR+  +   
Sbjct: 248 PVVRALNTVNTALGFESGFIIVVVAIVLDRMLRVTRK 284


>gi|332557611|ref|ZP_08411933.1| Binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides WS8N]
 gi|332275323|gb|EGJ20638.1| Binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides WS8N]
          Length = 284

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 138/277 (49%), Positives = 189/277 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +  +    +P+G + +  F  L  NG  F N++S ++   ++ +L VL   PPL+ + ++
Sbjct: 8   LGWLTDHKLPVGRWSKMGFDWLNANGGPFFNLISRMMQAVIDAMLNVLDAAPPLLVIAIL 67

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L  +++R+  +      G   I+ QGYW ET ++L+L+L++    M IGVPLG+ AA 
Sbjct: 68  AALAWVLQRNWRVTALVVAGFAFILNQGYWDETMQSLTLILLACVTCMAIGVPLGIAAAH 127

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FGLGMVPG++AT++F +P  +RLT LGI S
Sbjct: 128 RPRLYQAMSPVLDLMQTLPTFVYLIPAIVFFGLGMVPGLIATVIFVLPAPIRLTHLGIAS 187

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  LKEAA AFGATP Q   KVELP+A PQI+  L QTIMLSLSMVV+ ALVG+NGLGV
Sbjct: 188 TPMALKEAATAFGATPRQRLWKVELPYAFPQIMTGLNQTIMLSLSMVVIAALVGANGLGV 247

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+   GFESG  IV++AI+LDR+  +   
Sbjct: 248 PVVRALNTVNTALGFESGFIIVVVAIVLDRMLRVTRK 284


>gi|330812274|ref|YP_004356736.1| glycine betaine/L-proline ABC transporter permease [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380382|gb|AEA71732.1| putative glycine betaine/L-proline ABC transporter, permease
           component [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 281

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 135/275 (49%), Positives = 185/275 (67%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IPLG Y+  F   LTQ+G    + ++  L   ++ V F L +  PL  + +++LL
Sbjct: 2   LIDQKIPLGQYIAGFVEWLTQHGASTFDAIALFLETMIHGVTFALTWFNPLALIGLIALL 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++R   + V      LLI+  GYWQET ETL+ VL +T + + IGVPLG++AA  P 
Sbjct: 62  AHFIQRKWGLTVFVIASFLLILNLGYWQETMETLAQVLFATLVCVLIGVPLGIVAAHKPM 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FY+++R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P 
Sbjct: 122 FYTLMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVPD 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV+
Sbjct: 182 ELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPVV 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            ALNT DI  GFE+GL IV+LAI+LDR+   PD +
Sbjct: 242 NALNTADIALGFEAGLAIVLLAIMLDRICKQPDAK 276


>gi|146278349|ref|YP_001168508.1| binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides ATCC 17025]
 gi|145556590|gb|ABP71203.1| binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides ATCC 17025]
          Length = 278

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 139/277 (50%), Positives = 191/277 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +  +    +P+G + +  F  L  NG  F +++S  +   ++ +L VL   PPL+ + ++
Sbjct: 2   LDWLTDHKLPVGRWSKMMFDWLNANGGPFFDLISRTMQAVIDAILGVLGASPPLLIIAIL 61

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   ++RS  +A    +G   I+ QGYW+ET ++L+L+L++    M IGVPLG+ AA 
Sbjct: 62  AGLAWYLQRSWRVAALVVVGFAFILNQGYWRETMQSLTLILLACVTCMAIGVPLGIAAAH 121

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y ++   LD MQT+PTFVYLIPA+V FGLGMVPG++AT++F +P  +RLT LG+ S
Sbjct: 122 RPRLYQVMSPILDLMQTLPTFVYLIPAIVFFGLGMVPGLIATVIFVLPAPIRLTHLGVSS 181

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  LKEAA AFGATP Q   KVELP+A PQI+  L QTIMLSLSMVV+ ALVG+NGLGV
Sbjct: 182 TPLALKEAATAFGATPRQRLWKVELPWAFPQIMTGLNQTIMLSLSMVVIAALVGANGLGV 241

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+   GFESG  IV++AIILDR+  +   
Sbjct: 242 PVVRALNTVNTALGFESGFIIVVVAIILDRMLRVTRK 278


>gi|21909680|ref|NP_663948.1| putative glycine-betaine binding permease protein [Streptococcus
           pyogenes MGAS315]
 gi|21903863|gb|AAM78751.1| putative glycine-betaine binding permease protein [Streptococcus
           pyogenes MGAS315]
          Length = 561

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 109/265 (41%), Positives = 165/265 (62%), Gaps = 1/265 (0%)

Query: 15  LQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL-LVLMVKRSITI 73
           +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V+  +  + K+   +
Sbjct: 1   MEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLVTAGMFFLAKKKWPL 60

Query: 74  AVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLD 133
              T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A       I+   LD
Sbjct: 61  PTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMAKNATVRQIVNPILD 120

Query: 134 SMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFG 193
            MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I   P  L EA+ AFG
Sbjct: 121 FMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIRDIPTELIEASDAFG 180

Query: 194 ATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGR 253
           +T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG  VL AL   DIG 
Sbjct: 181 STGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLGREVLSALQHADIGS 240

Query: 254 GFESGLCIVILAIILDRLFSIPDPR 278
           GF SGL +VILAI+LDR+  + + +
Sbjct: 241 GFVSGLALVILAIVLDRMTQLFNSK 265


>gi|114319894|ref|YP_741577.1| binding-protein-dependent transport systems inner membrane
           component [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226288|gb|ABI56087.1| binding-protein-dependent transport systems inner membrane
           component [Alkalilimnicola ehrlichii MLHE-1]
          Length = 282

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 115/273 (42%), Positives = 161/273 (58%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D++      LT         +S  +   V LV+  L Y PP V +     L   +
Sbjct: 10  KIPLADWIDSGLDWLTDKFALVTRAISRFMGDGVELVVGALTYPPPWVVILGFMALAWWL 69

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                +A+GT +GL L+     W  T ETL+LVL +T +++ I +P+G+      R + +
Sbjct: 70  AGR-RVAIGTGLGLALLWNLQLWVATMETLTLVLFATAVAVTIALPIGIWGGLSGRAHRV 128

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG V  + AT++FS+P ++RLT LGI   P  L E
Sbjct: 129 MTPVLDFMQTMPAFVYLIPAVPFFGLGPVAAMFATVIFSMPPAIRLTTLGIRQVPAELVE 188

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGAT  Q   KV+LP A+P I+A + QTIML+LSMVV+ A++G+ GLG  V RA+ 
Sbjct: 189 AADAFGATRRQKLFKVQLPLAVPTIMAGINQTIMLALSMVVIAAMIGAGGLGSEVWRAIQ 248

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G GFE+G+ IVILA+ILDR+        +
Sbjct: 249 RLQSGNGFEAGIAIVILAMILDRVTQKIGKGKQ 281


>gi|116253276|ref|YP_769114.1| transmembrane component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257924|emb|CAK09022.1| putative transmembrane component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 305

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 170/277 (61%), Positives = 216/277 (77%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++ I +  IP+G + + F   LT NGEWF N ++F+L  A++ +LFVLQ   PL+ +  +
Sbjct: 25  LNWITEFKIPVGPWAKSFVDWLTSNGEWFFNQIAFLLSSAIDGLLFVLQKPHPLIVIAAI 84

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + +   ++RSI +AV T +GLLLI+ Q YW+ETTETL+LVL +TF+ M IG+PLG+ AA 
Sbjct: 85  TAIAFWLRRSIAVAVFTCLGLLLIVNQDYWKETTETLALVLAATFVCMVIGIPLGIAAAR 144

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLTRLGIIS
Sbjct: 145 RPWVYAAMRPVLDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS 204

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP L EAA AFGATP QV RK+ELPFA PQI+A LTQTIMLSLSMVV+ ALVG+ GLGV
Sbjct: 205 TPPSLVEAAVAFGATPIQVLRKIELPFATPQIMAGLTQTIMLSLSMVVIAALVGAPGLGV 264

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+I +GFE+G CIVILAIILDR+F     
Sbjct: 265 PVVRALNTVNIAKGFEAGFCIVILAIILDRMFRTAGE 301


>gi|222086662|ref|YP_002545196.1| proline/glycine betaine ABC transporter [Agrobacterium radiobacter
           K84]
 gi|221724110|gb|ACM27266.1| proline/glycine betaine ABC transporter [Agrobacterium radiobacter
           K84]
          Length = 285

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 163/279 (58%), Positives = 210/279 (75%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
           + +    IP+G + +     LT N  WF + LSF+    +  +LF+LQ   PL+ V V++
Sbjct: 6   NWLTDYRIPIGPWAKAVVDWLTTNFIWFFDGLSFVASHGIKGLLFLLQAPHPLIVVVVIA 65

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
            +   ++RS+ +   T +GLL+ I QGYW+ETTETL+LVL STF+ M +GVPLG+ AA  
Sbjct: 66  AIAYWMRRSVAVTALTFIGLLVTINQGYWKETTETLALVLASTFVCMLVGVPLGIAAARR 125

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P  Y+I+R  LD MQTIPTFVYL+PA++L GLGMVPG++AT+VF+IP S+R+TRLGIIST
Sbjct: 126 PWLYAIMRPILDLMQTIPTFVYLVPAMILLGLGMVPGLIATVVFAIPASIRMTRLGIIST 185

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           PP L EAA AFGATP QV RKVE+PFA+PQI+A LTQTIMLSLSMV + ALVG+ GLGVP
Sbjct: 186 PPSLVEAAEAFGATPRQVLRKVEVPFAMPQIMAGLTQTIMLSLSMVSIAALVGAPGLGVP 245

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           VLRALN+V++ + F+SG CIVILAIILDR+F  P   DR
Sbjct: 246 VLRALNSVNVAKSFDSGSCIVILAIILDRMFRAPGEGDR 284


>gi|242278151|ref|YP_002990280.1| glycine/betaine ABC transporter permease [Desulfovibrio salexigens
           DSM 2638]
 gi|242121045|gb|ACS78741.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio salexigens DSM 2638]
          Length = 278

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 108/273 (39%), Positives = 171/273 (62%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G+ ++     L ++  +     S +L   +++V   ++  PP +F+ +V+ + L +
Sbjct: 5   RIPIGEVIESSIDFLVEHFSFATKAFSAVLEAGLDVVEGTMKACPPWLFIFIVAAITLRL 64

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +S    + +  GLLLI   G W+ T  T++LV+VST +++  G+P+G+LAA       I
Sbjct: 65  TKSKRTTIFSIAGLLLIWNIGLWKATVSTIALVIVSTLLALLFGIPIGILAAMNKHVNKI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG V  I +TI+F++P S+RLT LGI   P  L E
Sbjct: 125 VMPVLDVMQTMPAFVYLIPAIPFFGLGKVAAIFSTIIFAMPPSIRLTCLGIKQVPEELVE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
            A AFG+  +Q   K+ELP A P I+A + QT+ML+LSMVV+ A++G+ GLG  V +A+ 
Sbjct: 185 CAEAFGSNRWQRLFKLELPIATPTIMAGVNQTVMLALSMVVIAAMIGAKGLGGEVWKAIQ 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            + +G+GFE+G+ IVI+A+I+DR+        +
Sbjct: 245 RLQMGKGFEAGIGIVIVAMIMDRVLQNIGSGKK 277


>gi|77462729|ref|YP_352233.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Rhodobacter sphaeroides 2.4.1]
 gi|77387147|gb|ABA78332.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Rhodobacter sphaeroides 2.4.1]
          Length = 284

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 137/277 (49%), Positives = 189/277 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +  +    +P+G + +  F  L  NG  F N++S ++   ++ +L VL   PPL+ + ++
Sbjct: 8   LGWLTDHKLPVGRWSKMGFDWLNANGGPFFNLISRMMQAVIDAMLNVLDAAPPLLVIAIL 67

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L  +++R+  +      G   I+ QGYW ET ++L+L++++    M IGVPLG+ AA 
Sbjct: 68  AALAWILQRNWRVTALVVAGFAFILNQGYWDETMQSLTLIVLACVTCMAIGVPLGIAAAH 127

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FGLGMVPG++AT++F +P  +RLT LGI S
Sbjct: 128 RPRLYQAMSPVLDLMQTLPTFVYLIPAIVFFGLGMVPGLIATVIFVLPAPIRLTHLGIAS 187

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  LKEAA AFGATP Q   KVELP+A PQI+  L QTIMLSLSMVV+ ALVG+NGLGV
Sbjct: 188 TPMALKEAATAFGATPRQRLWKVELPYAFPQIMTGLNQTIMLSLSMVVIAALVGANGLGV 247

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+   GFESG  IV++AI+LDR+  +   
Sbjct: 248 PVVRALNTVNTALGFESGFIIVVVAIVLDRMLRVTRK 284


>gi|300780046|ref|ZP_07089902.1| glycine betaine ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium genitalium ATCC 33030]
 gi|300534156|gb|EFK55215.1| glycine betaine ABC superfamily ATP binding cassette transporter,
           membrane protein [Corynebacterium genitalium ATCC 33030]
          Length = 293

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 108/276 (39%), Positives = 168/276 (60%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +   I +GD++ +    LT N     N  S ++   V      L  +P  + + ++
Sbjct: 1   MDQTLIPRINVGDWVNDGIDWLTDNATVLFNAFSAVMTFLVEGFSNALLSIPVFILLAIL 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            L+   V RS  +A+G  +G LL++    W+   +T+SLVLVST  ++ + +PLG+ AA 
Sbjct: 61  VLIAWFV-RSWRLALGALIGFLLVMGMRQWETMLQTMSLVLVSTLTAVIMAIPLGIWAAK 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 I+R  +D MQT+P FVYLIPA+  F +G+VPG+ +TI+F++P  VR+T LGI  
Sbjct: 120 SETVSKIVRPIMDFMQTMPAFVYLIPAVTFFSIGVVPGVFSTIIFALPPGVRMTELGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
                 EA  ++GATP+Q+ R ++LP A+P I+A + Q IMLSLSM V+  +VG++GLG 
Sbjct: 180 VDEETVEAGRSYGATPWQILRGIQLPLAVPTIMAGINQVIMLSLSMAVIAGMVGADGLGK 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            V  A++T+D+ +G E+GL +VILA+ LDRL +   
Sbjct: 240 EVTAAISTLDVAQGVEAGLAVVILAVYLDRLTAALG 275


>gi|221638590|ref|YP_002524852.1| binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides KD131]
 gi|221159371|gb|ACM00351.1| Binding-protein-dependent transport systems inner membrane
           component [Rhodobacter sphaeroides KD131]
          Length = 286

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 138/277 (49%), Positives = 189/277 (68%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           +  +    +P+G + +  F  L  NG  F N++S ++   ++ +L VL   PPL+ + ++
Sbjct: 10  LGWLTDHKLPVGRWSKMGFDWLNANGGPFFNLISRMMQAVIDAMLNVLDAAPPLLVIVIL 69

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L  +++R+  +      G   I+ QGYW ET ++L+L+L++    M IGVPLG+ AA 
Sbjct: 70  AALAWVLQRNWRVTALVVAGFAFILNQGYWDETMQSLTLILLACVTCMAIGVPLGIAAAH 129

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  +   LD MQT+PTFVYLIPA+V FGLGMVPG++AT++F +P  +RLT LGI S
Sbjct: 130 RPRLYQAMSPVLDLMQTLPTFVYLIPAIVFFGLGMVPGLIATVIFVLPAPIRLTHLGIAS 189

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  LKEAA AFGATP Q   KVELP+A PQI+  L QTIMLSLSMVV+ ALVG+NGLGV
Sbjct: 190 TPMALKEAATAFGATPRQRLWKVELPYAFPQIMTGLNQTIMLSLSMVVIAALVGANGLGV 249

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+   GFESG  IV++AI+LDR+  +   
Sbjct: 250 PVVRALNTVNTALGFESGFIIVVVAIVLDRMLRVTRK 286


>gi|114562993|ref|YP_750506.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella frigidimarina NCIMB 400]
 gi|114334286|gb|ABI71668.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella frigidimarina NCIMB 400]
          Length = 283

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 115/276 (41%), Positives = 162/276 (58%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M    +  IPL  ++      L +   WF  ++ + +   ++ V   L   PPL+ + + 
Sbjct: 1   MFSFDERVIPLDAWITSLVDWLVEGYRWFFQMIKWPVDFILSSVSDGLLATPPLLVIALF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            ++   V     +A  T   L+LI   G+W ET  TL++V  S      +GVP G+ A  
Sbjct: 61  GVIAWRVSG-FKLAGFTLASLILIGLLGFWSETMITLAMVFSSVVFCTVVGVPFGIWAGR 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  +I+R  LD+MQT P FVYL+P ++LF +G   G++ATI+F++P  VRLT LGI  
Sbjct: 120 SDRVNNILRPILDAMQTTPAFVYLVPIVMLFSIGNTAGVLATIIFALPPLVRLTSLGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P L EAA AFGAT  QV  KV++P A+P I+A L QTIM+SLSMVV+ A++G+ GLG 
Sbjct: 180 VHPELVEAALAFGATSSQVLLKVQIPLALPTIMAGLNQTIMMSLSMVVIAAMIGAGGLGA 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           PV+  LNT+DIG     GL IV+LAIILDR+     
Sbjct: 240 PVVLGLNTLDIGLATVGGLAIVLLAIILDRITQSMA 275


>gi|47717445|gb|AAT37720.1| glycine betaine/L-proline transport system permease [Yersinia
           enterocolitica]
          Length = 290

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 159/280 (56%), Gaps = 1/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M P     +PL  ++ +    +  +       +   +   ++    +L  +P  V + V 
Sbjct: 4   MDPFHNTWVPLDSWVTQGIDWVVLHFRPLFQGIRVPVDFILSGFQHLLLGMPAPVAILVF 63

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L+      ++ + V T + L+ I   G W +   TL+LVL S F  + IG+PLG+  A 
Sbjct: 64  ALIAWQFS-TLGMGVATLVSLIAIGAIGAWSQAMVTLALVLTSLFFCILIGLPLGIWLAR 122

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 IIR  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI  
Sbjct: 123 SNNAARIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIKQ 182

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA +FGA P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG 
Sbjct: 183 VPADLIEAAESFGANPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQ 242

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VLR +  +D+G     G+ IVILAIILDRL        R
Sbjct: 243 MVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 282


>gi|227832443|ref|YP_002834150.1| glycine betaine ABC transporter, permease protein [Corynebacterium
           aurimucosum ATCC 700975]
 gi|262183694|ref|ZP_06043115.1| glycine betaine ABC transporter, permease protein [Corynebacterium
           aurimucosum ATCC 700975]
 gi|227453459|gb|ACP32212.1| glycine betaine ABC transporter, permease protein [Corynebacterium
           aurimucosum ATCC 700975]
          Length = 290

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 111/276 (40%), Positives = 170/276 (61%), Gaps = 1/276 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M       IP+GD++ +    LT N     +  S I+   ++     L  +P ++ + ++
Sbjct: 1   MDQNALPRIPVGDWVSDGIDWLTDNAAVLFDAFSAIMSFLIDGFSNTLLSVPGMIMLVIL 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL     RS   AVG+A+G LL++    W    ET+SLVL++T  +  + VPLG+ AA 
Sbjct: 61  ALLGWFF-RSPKFAVGSALGFLLVMCMRQWDTMLETMSLVLIATLSATILAVPLGIWAAK 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                +IIR  +D MQT+P FVYLIPA+  F +G+VPGI +TI+F++P  VR+T LGI  
Sbjct: 120 SNTASAIIRPIMDFMQTMPAFVYLIPAVTFFSIGVVPGIFSTIIFALPPGVRMTELGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
                 EA  ++GAT +Q+ + ++LP A+P I+A + Q IMLSLSM V+  +VG++GLG 
Sbjct: 180 VDSETVEAGKSYGATNWQILKGIQLPLAVPTIMAGINQVIMLSLSMAVIAGMVGADGLGK 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
            V+ A++T+DI +G E+GL +VILA+ LDRL +   
Sbjct: 240 EVVSAISTLDIAKGVEAGLAVVILAVFLDRLTAALG 275


>gi|299538418|ref|ZP_07051701.1| glycine betaine transport system permease protein [Lysinibacillus
           fusiformis ZC1]
 gi|298726005|gb|EFI66597.1| glycine betaine transport system permease protein [Lysinibacillus
           fusiformis ZC1]
          Length = 284

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 170/282 (60%), Gaps = 3/282 (1%)

Query: 1   MSPIIQA--PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVC 58
           M+  +     +PL  +++     LT N   F N +       +N V  +L  +P ++ + 
Sbjct: 1   MNNFLDNIPTLPLAQWVESAMDWLTSNFSAFFNSIQQFGKLLMNQVTDLLISIPAIILIL 60

Query: 59  VVSLLVLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVL 117
           +V +    V  + + +A  + +GLL I  QG W    ET +LV+ S+ IS+ IG+PLG+L
Sbjct: 61  LVVIFAFFVSGKKLGLAAFSLIGLLFIYNQGLWTHLMETTTLVIFSSIISIIIGIPLGIL 120

Query: 118 AAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLG 177
            +      +II+  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR+T LG
Sbjct: 121 MSKSTVAENIIKPILDFMQTMPGFVYLIPAVAFFGIGIVPGVFASVIFALPPTVRMTNLG 180

Query: 178 IISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNG 237
           I   P  L EAA ++G+T  Q   KVE+P A   I+A + QT+MLSLSMVV+ +++G+ G
Sbjct: 181 IRQVPKELVEAADSYGSTASQKLFKVEIPLAKSTIMAGINQTVMLSLSMVVIASMIGAPG 240

Query: 238 LGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           LG  VL AL    +G GF +GL +VI AII+DRL    + + 
Sbjct: 241 LGREVLTALQRTQVGNGFVAGLGLVIFAIIIDRLTQSFNKKK 282


>gi|323357872|ref|YP_004224268.1| glycine/betaine ABC transporter permease [Microbacterium testaceum
           StLB037]
 gi|323274243|dbj|BAJ74388.1| ABC-type proline/glycine betaine transport system, permease
           component [Microbacterium testaceum StLB037]
          Length = 326

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 113/271 (41%), Positives = 175/271 (64%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G ++      L  N   F ++++  +   V  +  VL   P +V + V +LL  ++
Sbjct: 5   RIPVGSWVDAGVDWLRDNLSGFFDVIAVTVRFLVGGLSDVLLAAPIIVVIVVAALLAWLL 64

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            RS  +A+GT +G  LI+  G W    +TL+LVLV+T +++ I VPLG+ +A  P   ++
Sbjct: 65  -RSWKLALGTVVGFALILAMGQWVTAMQTLALVLVATVVAVAISVPLGIWSARNPTVRAV 123

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  F +G+VPG+V+T++F++P  VRLT LGI        E
Sbjct: 124 LKPILDFMQTMPAFVYLIPAITFFSIGVVPGVVSTVIFALPPGVRLTELGIRGVDSETVE 183

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGATP Q+ R ++LP A+P I+A + Q IML+LSM VV  +VG++GLG  V+++++
Sbjct: 184 AGHAFGATPGQILRGIQLPLAMPTIMAGVNQVIMLALSMAVVAGIVGADGLGKEVVQSIS 243

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           TV++ +G E+GL +VILA+ LDRL +    R
Sbjct: 244 TVNLPKGVEAGLSVVILAVYLDRLTAALGNR 274


>gi|46580703|ref|YP_011511.1| glycine/betaine/L-proline ABC transporter permease [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120602005|ref|YP_966405.1| glycine/betaine ABC transporter permease [Desulfovibrio vulgaris
           DP4]
 gi|46450122|gb|AAS96771.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|120562234|gb|ABM27978.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio vulgaris DP4]
 gi|311234422|gb|ADP87276.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio vulgaris RCH1]
          Length = 283

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 112/281 (39%), Positives = 165/281 (58%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IPLG +L+ F   + +         S +    ++++  +L  +PP  F+ VV
Sbjct: 1   MMSVQIPRIPLGAWLEAFTDNMVEWCSGATRAFSTVAGNGIDMLESLLGSIPPWAFIPVV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL     R   I     +G  LI   G W+ T  T++LVLV+T +++  GVPLG+ AA 
Sbjct: 61  ALLAWRATRKPGIGAFALLGFGLIWNLGLWEATMSTIALVLVATALAVVTGVPLGIAAAV 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 ++   LD MQT+P FVYLIPA+  FGLG V  + AT+VF++P ++R T LGI  
Sbjct: 121 NVTVRKVLMPVLDLMQTMPAFVYLIPAIPFFGLGKVAAVFATVVFAMPPAIRFTCLGIRQ 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L E A AFG + +Q   K+ELP A P I+A + QTIML+LSMVV+ A++G+ GLG 
Sbjct: 181 VPDDLVECAEAFGTSRWQRLVKLELPLAAPTILAGVNQTIMLALSMVVIAAMIGARGLGG 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            V +A+  +++G GFE+G+ IVI+AI LDR+      R  +
Sbjct: 241 EVWKAIQRLELGSGFEAGIGIVIVAICLDRVLQHIGRRSSV 281


>gi|146305523|ref|YP_001185988.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas mendocina ymp]
 gi|145573724|gb|ABP83256.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas mendocina ymp]
          Length = 294

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 112/276 (40%), Positives = 169/276 (61%), Gaps = 1/276 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    + LG ++ +    L  N     + +  ++      +  +L   P  + + +   L
Sbjct: 1   MSDKKLDLGSWVNDVVQHLLDNYSGAFDSIGKLVSGFSEGIENLLMLPPAWLLIAIFVGL 60

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
            L  +  +  AV TA+  +LI+  G+W++T  TL L   ST IS+ +G+PLG+ AA   R
Sbjct: 61  GLW-RIGMRFAVFTAVAFILIVMTGFWEQTVVTLGLTFSSTLISLLLGIPLGIWAAKSER 119

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
             +IIR  LD MQT+P FVYLIPA +LFGLG VPGI+AT++F++P +VRLT LGI     
Sbjct: 120 VATIIRPVLDFMQTMPAFVYLIPAAMLFGLGRVPGIIATVIFAMPPAVRLTSLGIRQVNK 179

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            + EA  +FG T  Q+  KV+LP A+P I+A + QTIM++LSMV++ ++VG+ GLG  VL
Sbjct: 180 EIVEAGQSFGCTSRQLLFKVQLPNAMPSIMAGVNQTIMMALSMVIIASMVGAGGLGNDVL 239

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            ++  +DIG GFESG+ +V+LAIILDR+      + 
Sbjct: 240 ASIQRLDIGLGFESGMAVVLLAIILDRITESFGTKQ 275


>gi|124485881|ref|YP_001030497.1| hypothetical protein Mlab_1061 [Methanocorpusculum labreanum Z]
 gi|124363422|gb|ABN07230.1| binding-protein-dependent transport systems inner membrane
           component [Methanocorpusculum labreanum Z]
          Length = 280

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 117/272 (43%), Positives = 171/272 (62%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+GD ++     +     W  + +S  L   VN +  +L  +P  V + +  ++V  V
Sbjct: 5   KIPIGDAVEAIVDWIETYFSWLLDAISDGLRVLVNGLEDILLAVPAPVLIALTGVIVWFV 64

Query: 68  KRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            R  I + + T +GL+LI   G W  +  T+ LVL++T I++ + +P+G+ AA      +
Sbjct: 65  TRHDIKMTILTMLGLVLIWDLGLWDLSMLTVVLVLIATVIALALSIPIGIGAARSDTLNA 124

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
            +R  LD MQT+P+FVYLIPA++ FGLG VPGI+AT++F++P ++RLT LGI   P  L 
Sbjct: 125 ALRPILDFMQTMPSFVYLIPAVIFFGLGSVPGIIATVIFAMPPALRLTTLGIRQVPVELI 184

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           E A AFGATP Q   KV+LP A+P I+A + Q IML+LSM V+ +++G+ GLG  VL  +
Sbjct: 185 EVADAFGATPRQKLFKVQLPVALPTIMAGVNQCIMLALSMTVIASMIGAGGLGYQVLVGI 244

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VDIG GFE+GL IVILAII DR+     P+
Sbjct: 245 QRVDIGMGFEAGLAIVILAIIFDRITQNLVPK 276


>gi|91772543|ref|YP_565235.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Methanococcoides burtonii DSM 6242]
 gi|91711558|gb|ABE51485.1| Glycine betaine ABC transporter permease protein [Methanococcoides
           burtonii DSM 6242]
          Length = 276

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 120/272 (44%), Positives = 176/272 (64%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+G+ +++    +  +     +I S +    ++     L    P+VF  ++ +    +
Sbjct: 5   KLPIGEGIEKVVNWIEDDFGILLDIFSDVTDYIISGFNDTLLLFHPIVFALIIGIAAYFI 64

Query: 68  KR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            R  + +A+G+ +GLLLI   G W  + ET+SLV+ S  +++ I +PLG+++A     Y 
Sbjct: 65  GRKDLKLAIGSTVGLLLIDNMGLWVLSMETISLVITSASLALLIAIPLGIVSAKNEFAYH 124

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           II+  LD MQT+P+FVYLIPA++ FGLG VPG+VATIVF++P ++RLT LGI   P  L 
Sbjct: 125 IIKPLLDLMQTMPSFVYLIPAVIFFGLGNVPGLVATIVFAMPPAIRLTTLGIQQVPKELT 184

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           E A AFG+TP+Q   KVELP A+P I+A + Q IMLSLSMVV+ A++G+ GLG  VL  +
Sbjct: 185 EVADAFGSTPWQKLTKVELPTALPSIMAGVNQCIMLSLSMVVIAAMIGARGLGYQVLIGI 244

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VDIG+GFE+GL IVI+AIILDR      P+
Sbjct: 245 QRVDIGQGFEAGLGIVIIAIILDRFTQHLTPK 276


>gi|134301039|ref|YP_001114535.1| binding-protein-dependent transport systems inner membrane
           component [Desulfotomaculum reducens MI-1]
 gi|134053739|gb|ABO51710.1| binding-protein-dependent transport systems inner membrane
           component [Desulfotomaculum reducens MI-1]
          Length = 278

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 118/271 (43%), Positives = 174/271 (64%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL  ++++F   L  +     +I+S ++   V+L  F+   +P  VF+ +++LL    
Sbjct: 7   KVPLDKWVEKFVDYLGAHLGGLFDIISAVIAGWVDLFSFLFNGVPAGVFIPILTLLAWKF 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +  +IA+ T  GLLLI   GYW+ T ETL+LVL +  IS+ +G+P G+L A       +
Sbjct: 67  SKR-SIALFTLAGLLLISNLGYWENTMETLALVLTAALISIIVGIPTGILCARKDTARDL 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG VPG++A+++F++P ++RLT LGI   P  L E
Sbjct: 126 VMPLLDFMQTMPAFVYLIPAIFFFGLGKVPGVIASVIFAMPPTIRLTNLGIRQVPAELIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+TP Q   KV+LP A   I+A + Q IML+LSMVV+ +++G+ GLG  V RA+ 
Sbjct: 186 AADAFGSTPTQKLLKVQLPLAKQTIMAGINQCIMLALSMVVIASMIGAKGLGADVYRAVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            + IG GFE+GL IV+LAIILDR+      +
Sbjct: 246 QIKIGVGFEAGLAIVVLAIILDRMTQNIGRK 276


>gi|114326749|ref|YP_743906.1| glycine betaine/L-proline transport system permease proW
           [Granulibacter bethesdensis CGDNIH1]
 gi|114314923|gb|ABI60983.1| glycine betaine/L-proline transport system permease protein proW
           [Granulibacter bethesdensis CGDNIH1]
          Length = 283

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 136/272 (50%), Positives = 185/272 (68%)

Query: 2   SPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
             I    IP+G ++      L  + +   + +S  +   +N    +L  +P  + + +++
Sbjct: 6   DWISDRKIPVGAWIARLIDLLKHHSQGLFDAISVAVSAVINGFSSLLLSVPGPLMIVLLA 65

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
           +L  +++RS++IAV TA  LL I+ QGYW ET +TL+LVL S  +S  IGVPLG+ AA  
Sbjct: 66  VLAYVMRRSVSIAVFTAAALLFILNQGYWDETMQTLALVLSSALVSTLIGVPLGIAAAHR 125

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
           P     +R  LD MQT+PTFVYLIP LVLFGLG VPG+++T++F++P  +RLT+LGI S 
Sbjct: 126 PWLAQGMRPVLDLMQTLPTFVYLIPTLVLFGLGAVPGLISTVIFALPAPIRLTQLGISSV 185

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA  AFGAT +Q+  KVELP A   I+A LTQ IMLSLSMVV+ ALVG+ GLGVP
Sbjct: 186 PRPLIEAGEAFGATRWQLLWKVELPGAKTMILAGLTQCIMLSLSMVVIAALVGAGGLGVP 245

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           V+RALNTV +  GFE+GL IV+LAI+LDR+F 
Sbjct: 246 VVRALNTVRVDTGFEAGLAIVLLAIMLDRVFR 277


>gi|218779567|ref|YP_002430885.1| binding-protein-dependent transport systems inner membrane
           component [Desulfatibacillum alkenivorans AK-01]
 gi|218760951|gb|ACL03417.1| binding-protein-dependent transport systems inner membrane
           component [Desulfatibacillum alkenivorans AK-01]
          Length = 277

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 106/276 (38%), Positives = 163/276 (59%), Gaps = 1/276 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
                IPL  ++ +    L  N   F   + + +   ++     L  + P++ +  + L 
Sbjct: 2   FEDKIIPLDSWVSQAVEWLVDNYRPFFQAIKWPVETTLSGFDNGLNAIHPIIIIIAIGLA 61

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                  I +++ + + ++ I   G W +   TL++VL +      +G PLG+LA    +
Sbjct: 62  AWKFSG-IKLSIFSVVTMVFIGMLGLWADAMTTLAMVLSAVIFCTLVGAPLGILAGRSDK 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           F S +R FLD+MQT P FVYL+P ++LF +G V G+++TIVF++P  +RLT LGI    P
Sbjct: 121 FESWLRPFLDAMQTTPAFVYLVPIVMLFSVGNVAGVLSTIVFAMPPIIRLTSLGIRGVHP 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA AFGAT +QV  +V++P A+P I+A L QTIM++LSMVV+ AL+G+ GLG PV+
Sbjct: 181 ELVEAAQAFGATNWQVLVRVQIPLALPTILAGLNQTIMMALSMVVIAALIGAGGLGSPVI 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
             LNT+DIG+    GL IV++AIILDR+      + 
Sbjct: 241 LGLNTLDIGQAVIGGLGIVLMAIILDRITQSMAQKK 276


>gi|160875189|ref|YP_001554505.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS195]
 gi|160860711|gb|ABX49245.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS195]
 gi|315267385|gb|ADT94238.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS678]
          Length = 283

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 163/279 (58%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M    +  IPL  ++      L +   WF  ++ + +   ++ V   L    PL+ + + 
Sbjct: 1   MFSFDERVIPLDVWITNVVNWLVEGYRWFFQLIKWPVDFILSGVSDGLLATSPLLVIALF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             +   V     +A+ T + L+LI   G+W ET  TL++V  S      +GVP G+ A  
Sbjct: 61  GAIAWRVSGL-KLAIFTLLSLVLIGLLGFWSETMITLAMVFSSVVFCTLVGVPFGIWAGR 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  +++R  LD+MQT P FVYL+P ++LF +G   G++ATI+F++P  VRLT LGI  
Sbjct: 120 SDRVNNVLRPILDAMQTTPAFVYLVPIVMLFSIGNTAGVLATIIFALPPLVRLTSLGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P L EAA AFGAT  QV  KV++P A+P I+A L QTIM+SLSMVV+ A++G+ GLG 
Sbjct: 180 VHPELVEAALAFGATSSQVLLKVQIPLALPTIMAGLNQTIMMSLSMVVIAAMIGAGGLGA 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+  LNT+DIG     GL IV+LAIILDR+      + 
Sbjct: 240 PVVLGLNTLDIGLATVGGLAIVLLAIILDRITQSMATKK 278


>gi|84515313|ref|ZP_01002675.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Loktanella vestfoldensis SKA53]
 gi|84510596|gb|EAQ07051.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Loktanella vestfoldensis SKA53]
          Length = 277

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 129/277 (46%), Positives = 187/277 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G + +  F  + +N  +  +I+S  +   ++ +L+ L+   P + + V 
Sbjct: 1   MDWLTGTKIPVGAWAKSVFDAMNRNLGFVFDIISDAMEAMIDGILWTLETPHPFIVIAVF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L  +++R+    +   +G   I+ QGYW+ET ++L+LVL +  + M +GVP+G+ AA 
Sbjct: 61  AGLTWVMQRNWKTPLLIVLGFFFILNQGYWRETMQSLTLVLSACVVCMGVGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P+ Y  +   LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LG+ S
Sbjct: 121 RPKLYRAMVPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTYLGVAS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EAA AFGAT  Q+  KVELP A PQI+A L QTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPTALLEAAQAFGATKRQILFKVELPSATPQIMAGLNQTIMLSLSMVVIAALVGASGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           PV+RALNTV+   GFESG  IV++AI+LDR+  +   
Sbjct: 241 PVVRALNTVNTSLGFESGFVIVVVAIMLDRMLRVKQK 277


>gi|152975672|ref|YP_001375189.1| binding-protein-dependent transport systems inner membrane
           component [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152024424|gb|ABS22194.1| binding-protein-dependent transport systems inner membrane
           component [Bacillus cytotoxicus NVH 391-98]
          Length = 279

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 183/280 (65%), Gaps = 2/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG+++  F   L ++ E      S+++   V+L+   L ++P  + + +V
Sbjct: 1   MNNI--PRIPLGEWVDTFVASLYEHFENIFRGFSYVIGGFVDLLTNFLTFIPAFLMIVIV 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L+    R +++ + T +GLL I+   YW++T +TL+LVL S  IS+ +G+P+G+LA+ 
Sbjct: 59  CFLIWYTARKVSLLIFTLIGLLFILNINYWEQTMQTLALVLTSVIISIIVGIPIGILASQ 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF   ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI  
Sbjct: 119 NERFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQ 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV
Sbjct: 179 VPEDLIEAADAFGSTASQKLFKVQLPLATGTIMAGINQSIMLSLSMVVTASLVGAPGLGV 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V R++  V+IG GFE+GL IV++AIILDR+      R R
Sbjct: 239 DVYRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFHRRKR 278


>gi|332687053|ref|YP_004456827.1| glycine betaine ABC transporter permease OpuAB/ glycine betaine ABC
           transporter glycine betaine-binding protein OpuAC
           [Melissococcus plutonius ATCC 35311]
 gi|332371062|dbj|BAK22018.1| glycine betaine ABC transport system, permease protein OpuAB/
           glycine betaine ABC transport system, glycine
           betaine-binding protein OpuAC [Melissococcus plutonius
           ATCC 35311]
          Length = 293

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 113/276 (40%), Positives = 174/276 (63%), Gaps = 1/276 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           ++   +P+  +++     +T         L      ++N +  +L  +PPLVF+ ++++ 
Sbjct: 1   MLNYQLPVATWIESLTDWMTTTFSGLFGFLQSTGQASMNSITTLLTAIPPLVFIVLLTIA 60

Query: 64  VLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
             +V +    +++ T +GLL I  Q  W +  +TL+LVLVS+FIS+ IGVPLG+L A Y 
Sbjct: 61  AFIVSKKKFGLSLFTFIGLLFIYNQNLWPDLMDTLTLVLVSSFISIVIGVPLGILMAKYN 120

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
           +  +II   LD MQT+P FVYLIPA+  FG+G+VPG+ A+I+F++P +VR T LGI   P
Sbjct: 121 KVQTIITPILDFMQTMPGFVYLIPAVAFFGIGIVPGVFASIIFALPPTVRFTNLGIRQVP 180

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L EA+ +FG+T +Q   K+ELP A   I+A + QT ML+LSMVV+ +++G+ GLG  V
Sbjct: 181 KELVEASDSFGSTNWQKLFKLELPLAKSTIMAGVNQTTMLALSMVVIASMIGAPGLGRGV 240

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           L AL    +G GF +G+ +VILAII+DR     + R
Sbjct: 241 LSALQRAQVGNGFVNGVALVILAIIIDRFVQYLNKR 276


>gi|254392834|ref|ZP_05008004.1| glycine betaine ABC transport system permease protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|294811675|ref|ZP_06770318.1| Glycine betaine ABC transport system permease protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|326440141|ref|ZP_08214875.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces clavuligerus ATCC
           27064]
 gi|197706491|gb|EDY52303.1| glycine betaine ABC transport system permease protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|294324274|gb|EFG05917.1| Glycine betaine ABC transport system permease protein [Streptomyces
           clavuligerus ATCC 27064]
          Length = 598

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 119/271 (43%), Positives = 163/271 (60%), Gaps = 1/271 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++      L    EW  + +S ++    + V  VL    PL+   ++++L   +
Sbjct: 3   RIPLGEWVDRTVDALQIRLEWLFDAISAVVTGMYDAVDAVLSAPEPLLLAGILAVLAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   V +  GL LI     W E   TLSLVLVST  ++ I VPLGV AA   R  ++
Sbjct: 63  -RGLLAGVLSFAGLALIDSVELWGEAMATLSLVLVSTLSTLVIAVPLGVWAARSRRVSAV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P  VYLIP ++ FG+G+VPGI+ATI+F++P  VR+T LGI      L E
Sbjct: 122 VRPVLDFMQTMPAMVYLIPGIIFFGVGVVPGIIATIIFALPPGVRMTELGIRQVDGELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG TP     +V+LP A+P I+A + Q IML LSMVV+  +VG  GLG  V RA+ 
Sbjct: 182 AAEAFGTTPRDTLLRVQLPLAVPTIMAGVNQVIMLGLSMVVIAGMVGGGGLGGAVYRAIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            VDIG GFE+G+ IVILA+ LDR+      +
Sbjct: 242 NVDIGLGFEAGVSIVILAMYLDRITGELGRQ 272


>gi|254780341|ref|YP_003064754.1| proline/glycine betaine ABC transporter, permease protein
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040018|gb|ACT56814.1| proline/glycine betaine ABC transporter, permease protein
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 281

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV
Sbjct: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW
Sbjct: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS
Sbjct: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV
Sbjct: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
           PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI
Sbjct: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281


>gi|90418329|ref|ZP_01226241.1| permease protein ABC-type glycine/betaine/proline transporter
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90338001|gb|EAS51652.1| permease protein ABC-type glycine/betaine/proline transporter
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 282

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 157/275 (57%), Positives = 203/275 (73%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            ++  P+P+GDY + F   LT N  +  + +   L   +  +LF+LQ+  PL+ V V + 
Sbjct: 5   WLVDHPLPIGDYAEAFVDWLTANFTFLFDAIRDGLGAFIEAILFILQWPHPLIVVAVFAA 64

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           +    +RSI I + T  GLLLII  G+W+ETTETL+LVL ST + M IGVP+GV AA   
Sbjct: 65  IAYAARRSIPIVIFTVAGLLLIINLGFWEETTETLALVLASTAVCMLIGVPVGVAAARRE 124

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
             Y+I+R  LD MQTIPTFVYLIPAL+LFGLG+VPG+VAT++F++P+ +RLTRLGI STP
Sbjct: 125 WLYAILRPILDLMQTIPTFVYLIPALILFGLGLVPGLVATVIFALPSPIRLTRLGIASTP 184

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L EA  AFGATP Q    +E+P+A+PQI+A LTQTIMLSLSMVV+ ALVG+ GLGVPV
Sbjct: 185 RQLLEAGDAFGATPMQRLMTIEIPYALPQIMAGLTQTIMLSLSMVVIAALVGAPGLGVPV 244

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           LRALNT++IG+GFE+GL IV+LAIILDR F I + 
Sbjct: 245 LRALNTINIGQGFEAGLAIVLLAIILDRFFRIDEE 279


>gi|126174513|ref|YP_001050662.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS155]
 gi|153000552|ref|YP_001366233.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS185]
 gi|217973482|ref|YP_002358233.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS223]
 gi|304408624|ref|ZP_07390245.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS183]
 gi|307305453|ref|ZP_07585201.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica BA175]
 gi|125997718|gb|ABN61793.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS155]
 gi|151365170|gb|ABS08170.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS185]
 gi|217498617|gb|ACK46810.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS223]
 gi|304352445|gb|EFM16842.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica OS183]
 gi|306911756|gb|EFN42181.1| binding-protein-dependent transport systems inner membrane
           component [Shewanella baltica BA175]
          Length = 283

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 163/279 (58%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M    +  IPL  ++      L +   WF  ++ + +   ++ V   L    PL+ + + 
Sbjct: 1   MFSFDERVIPLDVWITNIVNWLVEGYRWFFQLIKWPVDFILSGVSDGLLATSPLLVIALF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             +   V     +A+ T + L+LI   G+W ET  TL++V  S      +GVP G+ A  
Sbjct: 61  GAIAWRVSGL-KLAIFTLLSLVLIGLLGFWSETMITLAMVFSSVVFCTLVGVPFGIWAGR 119

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             R  +++R  LD+MQT P FVYL+P ++LF +G   G++ATI+F++P  VRLT LGI  
Sbjct: 120 SDRVNNVLRPILDAMQTTPAFVYLVPIVMLFSIGNTAGVLATIIFALPPLVRLTSLGIRQ 179

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
             P L EAA AFGAT  QV  KV++P A+P I+A L QTIM+SLSMVV+ A++G+ GLG 
Sbjct: 180 VHPELVEAALAFGATSSQVLLKVQIPLALPTIMAGLNQTIMMSLSMVVIAAMIGAGGLGA 239

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+  LNT+DIG     GL IV+LAIILDR+      + 
Sbjct: 240 PVVLGLNTLDIGLATVGGLAIVLLAIILDRITQSMATKK 278


>gi|150006771|ref|YP_001301514.1| glycine betaine/L-proline transport system permease
           [Parabacteroides distasonis ATCC 8503]
 gi|298377733|ref|ZP_06987684.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 3_1_19]
 gi|301309036|ref|ZP_07214981.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 20_3]
 gi|149935195|gb|ABR41892.1| glycine betaine/L-proline transport system permease
           [Parabacteroides distasonis ATCC 8503]
 gi|298265436|gb|EFI07098.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 3_1_19]
 gi|300833062|gb|EFK63687.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 20_3]
          Length = 277

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 120/269 (44%), Positives = 168/269 (62%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT++   F ++++  +   ++     L ++P  V +  ++LL     
Sbjct: 2   INIGKYIEIAINWLTEHFARFFDVINDGVGGFIDAFQDGLTWIPFYVMILGLALLAWFKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               + V TA+GLLLI   G+W ET +TL+LVL ST I++ IGVPLG+  A   R   II
Sbjct: 62  GK-GVGVFTALGLLLIYGMGFWVETMQTLALVLSSTIIALMIGVPLGIWTARSDRADKII 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + EA
Sbjct: 121 HPVLDLMQTMPAFVYLIPAVLFFGLGPVPGAFATVIFAMPPVVRLTDLGIRQVPADIVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             +FGAT  Q+  KV+LP A+P I+  + QTIMLSLSMVV+ A++ + GLG  VLR +  
Sbjct: 181 TRSFGATSSQLLYKVQLPLALPTIMTGVNQTIMLSLSMVVIAAMISAGGLGEIVLRGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           + IG GFE G+ +VILAIILDR+      
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGWAK 269


>gi|150010418|ref|YP_001305161.1| glycine betaine/L-proline transport system permease
           [Parabacteroides distasonis ATCC 8503]
 gi|237708446|ref|ZP_04538927.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 9_1_42FAA]
 gi|149938842|gb|ABR45539.1| glycine betaine/L-proline transport system permease
           [Parabacteroides distasonis ATCC 8503]
 gi|229457667|gb|EEO63388.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 9_1_42FAA]
          Length = 271

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 119/271 (43%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT+ G  F + L+  +   ++     L  +P  VF+ +  LL     
Sbjct: 2   IDIGCYIEAAIEWLTEEGAVFFDALNVGVESFIDSFQLALYAIPFYVFIPLTVLLAWWKV 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +   T +GLLLI   G+W+ET +TL+LVL ST +++ IG+PLG+ A    R   ++
Sbjct: 62  GK-GMGAFTLLGLLLIWGMGFWEETMQTLALVLSSTCMALLIGIPLGIWAGKSERCNRML 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDCMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPENVIEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A +FGATP Q+  KV+LP A+P I+  + QTIM++LSMVVV+A++ + GLG  VL+ +  
Sbjct: 181 ARSFGATPRQLLFKVQLPLALPTILTGINQTIMMALSMVVVSAMISAGGLGEVVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      + 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGIAQKK 271


>gi|256842287|ref|ZP_05547791.1| choline ABC transporter, permease [Parabacteroides sp. D13]
 gi|262384806|ref|ZP_06077938.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 2_1_33B]
 gi|256736171|gb|EEU49501.1| choline ABC transporter, permease [Parabacteroides sp. D13]
 gi|262293522|gb|EEY81458.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 2_1_33B]
          Length = 277

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 120/269 (44%), Positives = 168/269 (62%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT++   F ++++  +   ++     L ++P  V +  ++LL     
Sbjct: 2   INIGKYIEIAINWLTEHFARFFDVINDGVGGFIDTFQDGLTWIPFYVMILGLALLAWFKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               + V TA+GLLLI   G+W ET +TL+LVL ST I++ IGVPLG+  A   R   II
Sbjct: 62  GK-GVGVFTALGLLLIYGMGFWVETMQTLALVLSSTIIALMIGVPLGIWTARSDRADKII 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + EA
Sbjct: 121 HPVLDLMQTMPAFVYLIPAVLFFGLGPVPGAFATVIFAMPPVVRLTDLGIRQVPADIVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             +FGAT  Q+  KV+LP A+P I+  + QTIMLSLSMVV+ A++ + GLG  VLR +  
Sbjct: 181 TRSFGATSSQLLYKVQLPLALPTIMTGVNQTIMLSLSMVVIAAMISAGGLGEIVLRGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           + IG GFE G+ +VILAIILDR+      
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGWAK 269


>gi|88799547|ref|ZP_01115123.1| ABC-type proline/glycine betaine transport system, permease
           component [Reinekea sp. MED297]
 gi|88777632|gb|EAR08831.1| ABC-type proline/glycine betaine transport system, permease
           component [Reinekea sp. MED297]
          Length = 275

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 133/273 (48%), Positives = 179/273 (65%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MS I    +P+G + +     L      F + +S  L   +  ++ VL  LPP +F+ +V
Sbjct: 1   MSLITDNKLPVGSWAETLIDGLIDVSGGFFDAISGALEVMIESLVDVLTLLPPWLFIGIV 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + LV   +R+  +     + LLLI   GYW+ET ET SL++ +T + + +GVPLG+ AA 
Sbjct: 61  AALVFWRQRNKGVTAFFVLSLLLIWNLGYWEETIETFSLIVYATGLCVLLGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  + ++R  LD MQTIP FVYLIPAL LFGLG+VPG+V+TIVF+I   +RLT LGI  
Sbjct: 121 RPWLFRLLRPILDLMQTIPPFVYLIPALTLFGLGVVPGLVSTIVFAIAAPIRLTYLGISE 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFG T   +  KVE+P A+  I A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPEELLEAGRAFGCTKRSLLLKVEIPAAMSSIRAGITQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           PV+RALNTVDI  GFE+GL IV++AI+LDR+F 
Sbjct: 241 PVVRALNTVDIATGFEAGLAIVLVAIMLDRIFK 273


>gi|255016499|ref|ZP_05288625.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 2_1_7]
          Length = 277

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 120/269 (44%), Positives = 168/269 (62%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT++   F ++++  +   ++     L ++P  V +  ++LL     
Sbjct: 2   INIGKYIEIAINWLTEHFARFFDVINDGVGGFIDTFQDGLTWIPFYVMILGLALLAWFKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               + V TA+GLLLI   G+W ET +TL+LVL ST I++ IGVPLG+  A   R   II
Sbjct: 62  GK-GVGVFTALGLLLIYGMGFWVETMQTLALVLSSTIIALMIGVPLGIWTARSDRADKII 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + EA
Sbjct: 121 HPVLDLMQTMPAFVYLIPAVLFFGLGPVPGAFATVIFAMPPVVRLTDLGIRQVPADIVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             +FGAT  Q+  KV+LP A+P I+  + QTIMLSLSMVV+ A++ + GLG  VLR +  
Sbjct: 181 TRSFGATSTQLLYKVQLPLALPTIMTGVNQTIMLSLSMVVIAAMISAGGLGEIVLRGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           + IG GFE G+ +VILAIILDR+      
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGWAK 269


>gi|312961054|ref|ZP_07775559.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens WH6]
 gi|311284712|gb|EFQ63288.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens WH6]
          Length = 282

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 129/278 (46%), Positives = 181/278 (65%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I Q  +PLG+++  +   LTQ+G    + +S  L   + +    L +  PL  + + +L
Sbjct: 2   WITQEKLPLGEHIARYVDWLTQHGAGVFDSISLSLSGIITVFTSALLWFNPLALIALFAL 61

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           L   ++R +++ +  A   LLI   GYWQET ETL+ V  +T + + +GVPLG++AA  P
Sbjct: 62  LAYYIQRKVSLTLFVAFSFLLIFNLGYWQETMETLAQVTFATLVCVIVGVPLGIVAAHRP 121

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
            FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T+VF+I   +RLT LGI   P
Sbjct: 122 WFYAALRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGICDVP 181

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L +A  AFG +  Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV
Sbjct: 182 EELMDAGKAFGCSRRQLLARIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV 241

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           + ALNT DI  GFE+GL IV+LAI LDR+    +   R
Sbjct: 242 VNALNTADIAMGFEAGLAIVLLAITLDRICKQRETVRR 279


>gi|220904097|ref|YP_002479409.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868396|gb|ACL48731.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 280

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 116/272 (42%), Positives = 161/272 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL  Y+      L +         S I+L  ++     L   PP +F+ +++ L   V
Sbjct: 4   RLPLAGYIDSGVEFLVEQFSGVTRAGSAIMLALLDRFEEFLLLPPPWLFILLLAALAWWV 63

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   + V  A+G  L+   G W  T  TL+LVL +T +S+ +GVP G+LAA  P    I
Sbjct: 64  TRRPGLPVFVALGFALLWNLGLWTPTISTLALVLSATLLSVLVGVPCGILAAMSPVARKI 123

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FG+G V  +VAT++FS+P ++R T LGI   P  L E
Sbjct: 124 VMPVLDVMQTMPAFVYLIPAIPFFGIGKVSAVVATVIFSVPPAIRFTCLGIQQVPRDLVE 183

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
              AFGAT  Q   K+ELP A+P IVA + QTIML+LSM V+ A++G+ GLG  V +A+ 
Sbjct: 184 CTEAFGATRMQRLYKLELPLAMPTIVAGVNQTIMLALSMAVIAAMIGARGLGGEVWKAIQ 243

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            ++IG GFE+GL IVI+AI LDRLF     + 
Sbjct: 244 RLNIGMGFEAGLGIVIVAITLDRLFRALAQKS 275


>gi|218886146|ref|YP_002435467.1| glycine/betaine ABC transporter permease [Desulfovibrio vulgaris
           str. 'Miyazaki F']
 gi|218757100|gb|ACL07999.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 280

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 113/271 (41%), Positives = 164/271 (60%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG +L+     L  +        S +    +NL+   L  LPPL+ +  V L+   V
Sbjct: 7   RIPLGQWLEAAIDFLVTHLAPATRAFSAVTESGLNLLEAGLDALPPLLVIAFVGLVAWRV 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R + + V    GL L+   G WQ T  TL+LVLV+T +++ +G+PLG+ AA   R  ++
Sbjct: 67  TRQVALGVFAVAGLALVWNMGLWQATMSTLALVLVATLLAVLVGIPLGIAAAMSDRARAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG V  + AT++F++P ++R T LGI   P  L E
Sbjct: 127 VMPVLDVMQTMPAFVYLIPAIPFFGLGKVAAVFATVIFAMPPAIRFTCLGIRQVPAELVE 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
            A AFG   FQ   K+ELP A P ++A + QT+ML+LSMVV+ A++G+ GLG  V +A+ 
Sbjct: 187 CAEAFGTGRFQRLVKLELPLAAPTMLAGVNQTVMLALSMVVIAAMIGARGLGGEVWKAIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            +++G GFE+G+ IVI+AI LDR+      R
Sbjct: 247 RLEMGNGFEAGIGIVIVAICLDRILQHVGKR 277


>gi|78355721|ref|YP_387170.1| glycine/betaine/L-proline ABC transporter permease [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78218126|gb|ABB37475.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 279

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 115/276 (41%), Positives = 165/276 (59%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +I   IP+G  L+     L  +        S +   A++++   L ++P  +F+  V+LL
Sbjct: 1   MIDYRIPVGATLESVIDFLVVHCSGATRAFSAVTDAALSVLEHGLAFIPWWLFIPAVALL 60

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
                 S  + +   +GL L+   G W  T  T++LVLV+T +++ IG+PLGV AA    
Sbjct: 61  TWRGTGSRGLGLFALLGLGLVYNMGLWPATVSTIALVLVATLLAVLIGLPLGVFAAINKV 120

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y  I   LD MQT+P FVYLIPA+  FGLG V  I +T+VF++P  +RLT LGI   P 
Sbjct: 121 AYRAIMPVLDVMQTMPAFVYLIPAIPFFGLGKVAAIFSTVVFAMPPVIRLTCLGIRQVPV 180

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L E A AFG   +Q  RK+ELP A P I+A + QT+ML+LSMVV+ A++G+ GLG  V 
Sbjct: 181 ELVECAEAFGTNRWQRLRKLELPLAAPTIMAGVNQTVMLALSMVVIAAMIGAKGLGGEVW 240

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           +A+  +++GRGFE+G+ IVI+AI LDRL      R 
Sbjct: 241 KAIQRLEMGRGFEAGIGIVIVAICLDRLLQKIGSRS 276


>gi|88855181|ref|ZP_01129846.1| ABC-type glycine betaine transport, permease protein [marine
           actinobacterium PHSC20C1]
 gi|88815709|gb|EAR25566.1| ABC-type glycine betaine transport, permease protein [marine
           actinobacterium PHSC20C1]
          Length = 322

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 111/276 (40%), Positives = 177/276 (64%), Gaps = 3/276 (1%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+      +PLG ++++    +T     F +++ F++    + + F+    P  V + + 
Sbjct: 1   MNDF--PRLPLGQWVEDGIDYITATFGVFFDVIKFMIASVADGMNFLFTSPPFWVMLIIF 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++   V R    + GT +G LLI+    W+   +TL+LVLV+  I++ + VPLG+LAA 
Sbjct: 59  AVIAF-VARGWLFSAGTTVGFLLILSLDQWENAMDTLALVLVAAAIAVLVSVPLGILAAK 117

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           Y    +I++  LD +QT+P FVYLIPAL+LF +G VPGIVAT++F++   VRLT LGI  
Sbjct: 118 YQTVSTIVKPVLDFLQTMPAFVYLIPALILFRIGDVPGIVATVLFALAPGVRLTELGIRG 177

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
               + EA  AFG++P ++ R+++LP A+P I+A + Q IMLSLSMVV+ ++VG+ GLG 
Sbjct: 178 VDKEVVEAGQAFGSSPSRILRQIQLPLALPSIMAGINQVIMLSLSMVVIASMVGAGGLGK 237

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           PV+++L+  D+  GFE+GL +V+LAI LDRL +   
Sbjct: 238 PVIQSLSRADVSLGFEAGLSVVLLAIFLDRLTASFG 273


>gi|330998254|ref|ZP_08322079.1| glycine betaine transport system permease protein opuAB
           [Paraprevotella xylaniphila YIT 11841]
 gi|329568643|gb|EGG50444.1| glycine betaine transport system permease protein opuAB
           [Paraprevotella xylaniphila YIT 11841]
          Length = 271

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 118/271 (43%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     L + G +F + L+  +   ++     L  +P  VF+ +   L     
Sbjct: 2   IDIGCYIEAAIEWLAEEGAFFFDALNVGVESFIDSFQLALYAIPFYVFIPLTVSLAWWKV 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               + V T +GLLLI   G+W+ET +TL+LVL ST +++ IG+PLG+ A    R   ++
Sbjct: 62  GK-GMGVFTLLGLLLIWGMGFWEETMQTLALVLSSTCMALLIGIPLGIWAGKSERCNRML 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG  ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDCMQTMPAFVYLIPAVLFFGLGTVPGAFATIIFAMPPVVRLTGLGIRQVPKNVIEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A +FGATP Q+  KV+LP A+P I   + QTIM++LSMVVV+A++ + GLG  VL+ +  
Sbjct: 181 ARSFGATPRQLLFKVQLPLALPTIQTGINQTIMMALSMVVVSAMISAGGLGEVVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      + 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGIAQKK 271


>gi|159185138|ref|NP_355236.2| ABC transporter, membrane spanning protein (proline/glycine
           betaine) [Agrobacterium tumefaciens str. C58]
 gi|159140409|gb|AAK88021.2| ABC transporter, membrane spanning protein (proline/glycine
           betaine) [Agrobacterium tumefaciens str. C58]
          Length = 343

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 169/271 (62%), Positives = 210/271 (77%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           +  +P+G Y +E    LT N  +F + LSFI    +N +L+VLQ   PL+ V +V+ L  
Sbjct: 68  ENRLPIGRYAKEAIDWLTGNLAFFFDWLSFIFQSVINALLYVLQAPHPLIIVAIVTALSA 127

Query: 66  MVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFY 125
             +RS  + + TA+GLLLII  GYW+ TTETL+LV+ ++ + M IG+PLG+LAA     Y
Sbjct: 128 WTRRSAGMPIFTALGLLLIINLGYWKATTETLALVIAASAVCMIIGIPLGILAARRKWIY 187

Query: 126 SIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPIL 185
           + +R  LD MQTIPTFVYLIPALVLFGLGMVPG++AT++F+IP  VRLTRLGI+STPP L
Sbjct: 188 AGMRPALDLMQTIPTFVYLIPALVLFGLGMVPGLIATVIFAIPAPVRLTRLGIVSTPPAL 247

Query: 186 KEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRA 245
            EAA AFGATP QV RKVELPFA PQI+A LTQTIMLSLSMVV++ALVG+NGLGVPV+RA
Sbjct: 248 VEAAVAFGATPSQVLRKVELPFAAPQIMAGLTQTIMLSLSMVVISALVGANGLGVPVVRA 307

Query: 246 LNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           LNTV+I  GFE+GLCIVILAI+LDRLF +P 
Sbjct: 308 LNTVNIAMGFEAGLCIVILAIVLDRLFRLPG 338


>gi|329939067|ref|ZP_08288441.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces griseoaurantiacus M045]
 gi|329301952|gb|EGG45845.1| putative glycine betaine ABC transporter substrate-binding and
           permease component [Streptomyces griseoaurantiacus M045]
          Length = 604

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 110/269 (40%), Positives = 158/269 (58%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            I LGD + +    L  +  W  + +  ++    + V  VL    PL+   ++++L   +
Sbjct: 3   RIHLGDRVDDGVSWLVDHMSWLFDAIKTVVEGMYDGVDAVLGAPSPLLMAGILAVLAWWL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   V T  G  LI     W  +  TLSLVLV+T I++ IGVP+G+ AA      S+
Sbjct: 63  -RGLAAGVLTFAGFALIDSLALWDRSMSTLSLVLVATVIALVIGVPVGIWAARSKTVSSV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD +QT+P+ V LIPA++ FGLG+  G++AT++F+I   VR+T LGI      L E
Sbjct: 122 VRPVLDLLQTMPSMVLLIPAILFFGLGVPAGVIATLIFAIAPGVRMTELGIRQVDAELVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG +P     +V+LP A+P I+A + Q IML LSMVV+  +VG+ GLG  V  ++ 
Sbjct: 182 AAEAFGTSPRNTLLRVQLPLALPTIMAGVNQVIMLGLSMVVIAGMVGTGGLGGAVNESIG 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            +DIG GFESGL IVILAI LDR+     
Sbjct: 242 QLDIGLGFESGLGIVILAIYLDRVTGALG 270


>gi|298529248|ref|ZP_07016651.1| binding-protein-dependent transport systems inner membrane
           component [Desulfonatronospira thiodismutans ASO3-1]
 gi|298510684|gb|EFI34587.1| binding-protein-dependent transport systems inner membrane
           component [Desulfonatronospira thiodismutans ASO3-1]
          Length = 278

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 117/276 (42%), Positives = 163/276 (59%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
                IPLGD ++     L  +        S +  + +  +   L  + P++ + +V+ L
Sbjct: 3   FELPRIPLGDGIEAALDFLVDHLALATRAFSAVADQGLRFIETSLLGVHPVIVIVIVTAL 62

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
           V  + R   + V T +GL LI   G W  T  TLSLV+V+T I++ IG+PLG++A     
Sbjct: 63  VFFMTRKRGVTVFTFLGLGLIWNMGLWTATASTLSLVVVATLIAIAIGIPLGIIAGLSDW 122

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y I+R  LD MQT+P FVYLIPA+  FGLG V  I AT+VFS+P ++R T LGI   P 
Sbjct: 123 VYRIVRPILDFMQTLPAFVYLIPAIPFFGLGKVAAIFATVVFSMPPAIRFTNLGIRQVPK 182

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L E A AFGA  +Q   K++LP A   I+  + QT+ML+LSMVV+ A++G+ GLG  V 
Sbjct: 183 ELTECADAFGADRWQKLFKIQLPLAKTTIMGGVNQTVMLALSMVVIAAMIGAGGLGGEVW 242

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           RA+  +  G GFE+G+ IVILAIILDRL      +D
Sbjct: 243 RAIQRLQPGAGFEAGIGIVILAIILDRLLQSLASKD 278


>gi|254512933|ref|ZP_05124999.1| glycine betaine/L-proline ABC transporter, ATPase/permease fusion
           protein [Rhodobacteraceae bacterium KLH11]
 gi|221532932|gb|EEE35927.1| glycine betaine/L-proline ABC transporter, ATPase/permease fusion
           protein [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 93/264 (35%), Positives = 144/264 (54%), Gaps = 1/264 (0%)

Query: 16  QEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAV 75
              F  L  N     + ++  +   ++ +  +L   P  V + V  +L   +     +A+
Sbjct: 265 DAGFDWLANNFGDVFDGVTAGIRWVLDGLEILLIQTPWPVVMFVTVVLAFRLAGP-RVAI 323

Query: 76  GTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSM 135
            TA  L  +   G W+ +  T++L+    F+ + IG+PLG+      R Y+     LD M
Sbjct: 324 FTAASLAYLAFMGLWELSMITVALIGAGAFLCVLIGIPLGIWFGKSKRAYAFAEPVLDFM 383

Query: 136 QTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGAT 195
           QT+P FVYLIP +  FG G  PG++AT+VF++P  +RLT LG+   P   KEAA AFG +
Sbjct: 384 QTMPAFVYLIPIIAFFGTGKPPGVLATLVFAMPPVIRLTALGMRGVPETTKEAAIAFGCS 443

Query: 196 PFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGF 255
             Q+   VELP A+P I+  + QTI++SLSMVV+ +L+G+ GLG  +L AL     G+G 
Sbjct: 444 KRQLLFNVELPLALPSIMTGINQTILMSLSMVVIASLIGAEGLGALILEALQYAAKGQGL 503

Query: 256 ESGLCIVILAIILDRLFSIPDPRD 279
             GL I+  A+++DR+      R 
Sbjct: 504 LGGLAILFCAMVIDRIAQGVYRRK 527


>gi|257054195|ref|YP_003132027.1| ABC-type proline/glycine betaine transport system, permease
           component [Saccharomonospora viridis DSM 43017]
 gi|256584067|gb|ACU95200.1| ABC-type proline/glycine betaine transport system, permease
           component [Saccharomonospora viridis DSM 43017]
          Length = 298

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 112/281 (39%), Positives = 165/281 (58%), Gaps = 1/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           ++      IP+G++  +    L        + +S      V+ +  VLQ+ P  V   V 
Sbjct: 9   LNDWHMPRIPVGEWFSDGVDWLKDKLGAVFDAISEGTDSIVSGLADVLQWPPSWVMFLVF 68

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL L + R    A+ T +G  LI   G +    +TL+LVL++  IS+ + VPLGVLAA 
Sbjct: 69  ALLALWL-RGWKFALTTLLGFALIDALGAFDSAMQTLALVLLAAVISVILAVPLGVLAAR 127

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 II+  +D +QT+P FVYLIPA++ FG+G+ PG+VAT++F++   VRLT LGI  
Sbjct: 128 SDTASRIIKPIMDFLQTVPQFVYLIPAVIFFGIGVGPGVVATVMFALAPGVRLTELGIRQ 187

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
               + EA  AFG+ P ++ R+++LP A+P I+A + Q IMLSLSMVV+  +VG+ GLG 
Sbjct: 188 VDREMVEAGEAFGSPPMKILREIQLPLAMPSIMAGVNQIIMLSLSMVVIAGMVGAPGLGA 247

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            V  A   + +G GFE GL +VILAI LDRL +    R  +
Sbjct: 248 QVFEATTRLQLGVGFEYGLSVVILAIYLDRLTASLSDRSAV 288


>gi|83950286|ref|ZP_00959019.1| glycine betaine/proline ABC transporter, permease protein, putative
           [Roseovarius nubinhibens ISM]
 gi|83838185|gb|EAP77481.1| glycine betaine/proline ABC transporter, permease protein, putative
           [Roseovarius nubinhibens ISM]
          Length = 513

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 97/265 (36%), Positives = 151/265 (56%), Gaps = 1/265 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +   + +    LT    +  + ++ +L   +  +  V    P  + + V+  +       
Sbjct: 246 VSQSIDDGISYLTVFYGFLFDGITNVLRGMLGAITSVFVGTPWPITMAVLLFVAYR-TAG 304

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              A+     L  +   G+WQ   +T+SLV+ ++ I +  G+PLG+  +   R  +II  
Sbjct: 305 PRTAIFVGASLAYLALFGFWQTAMDTMSLVVAASIICVVFGLPLGIWVSKSRRGKAIITP 364

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQTIP+FVYL+PA+  F +G  PGI+AT++F++P  VRLT LGI+  P   KEAA 
Sbjct: 365 ILDVMQTIPSFVYLLPAIAFFSIGKPPGILATVIFAMPPMVRLTALGILQVPENTKEAAL 424

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFGA P Q+  KVELP A+P I+  + Q +M+SLSMVVV AL+G+ G+G  V  AL   +
Sbjct: 425 AFGANPRQLLTKVELPLAMPSIMTGINQVVMMSLSMVVVAALIGAGGMGYIVTEALENTE 484

Query: 251 IGRGFESGLCIVILAIILDRLFSIP 275
            GRG  +G+ I +LA+++DR+    
Sbjct: 485 TGRGVLAGIGIALLAMMIDRVVQKA 509


>gi|159039027|ref|YP_001538280.1| binding-protein-dependent transport systems inner membrane
           component [Salinispora arenicola CNS-205]
 gi|157917862|gb|ABV99289.1| binding-protein-dependent transport systems inner membrane
           component [Salinispora arenicola CNS-205]
          Length = 292

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 103/268 (38%), Positives = 162/268 (60%), Gaps = 1/268 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G+  +       +      + ++  +   V  +  +L   P +V + + + L   + RS
Sbjct: 13  VGEAFKTGVDWAREQFSPLFDRIAAFVDALVEPLTDLLTAPPAIVVILIFAGLGWWL-RS 71

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
               +GTA+GL L+    +W+ET  TL+LVLV++ +++ I VPLG+L A   R  ++ R 
Sbjct: 72  WKFGLGTAVGLSLVAGMPFWEETMSTLALVLVASGLALLIAVPLGILVAENRRASALARP 131

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA+  F +G VPG++AT+VFS+P  VRLT LG+      + EA  
Sbjct: 132 VLDLMQTMPAFVYLIPAVSFFSIGAVPGVLATVVFSMPPGVRLTELGLRQVDREVIEAGE 191

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFGA+P  +  + +LP A+P I+  + Q IML+LSMVV+  +VG+ GLG  +++A + V+
Sbjct: 192 AFGASPSTILLRTKLPLALPTIMTGVNQVIMLALSMVVIAGMVGAGGLGDVIIKAFSRVE 251

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPR 278
           +  GFE G+ +VILA++LDRL      R
Sbjct: 252 VDTGFEGGIAVVILAVVLDRLTDSLGAR 279


>gi|107104191|ref|ZP_01368109.1| hypothetical protein PaerPA_01005264 [Pseudomonas aeruginosa PACS2]
 gi|116053242|ref|YP_793565.1| ABC transporter permease [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894194|ref|YP_002443063.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
 gi|254238198|ref|ZP_04931521.1| hypothetical protein PACG_04324 [Pseudomonas aeruginosa C3719]
 gi|254244024|ref|ZP_04937346.1| hypothetical protein PA2G_04857 [Pseudomonas aeruginosa 2192]
 gi|296391943|ref|ZP_06881418.1| putative permease of ABC transporter [Pseudomonas aeruginosa PAb1]
 gi|313110133|ref|ZP_07796035.1| putative amino acid transporter permease protein [Pseudomonas
           aeruginosa 39016]
 gi|115588463|gb|ABJ14478.1| putative amino acid transporter permease protein [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126170129|gb|EAZ55640.1| hypothetical protein PACG_04324 [Pseudomonas aeruginosa C3719]
 gi|126197402|gb|EAZ61465.1| hypothetical protein PA2G_04857 [Pseudomonas aeruginosa 2192]
 gi|218774422|emb|CAW30239.1| probable permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
 gi|310882537|gb|EFQ41131.1| putative amino acid transporter permease protein [Pseudomonas
           aeruginosa 39016]
          Length = 283

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 163/270 (60%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V+ +    
Sbjct: 7   TFSIADWVNAWVDALVTNYGDLFRKISDTLLWAIVNLEGLLRATPWWLLLAIVAAIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   +     L L+   G W +  +TL+L+LV+TFIS+ IG+PLG+LAA   R  ++
Sbjct: 67  TRRLLPTLVITGLLFLVGAVGLWDKLMQTLALMLVATFISVLIGIPLGILAARSNRLRAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDSEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AVNAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++G+G E+GL IVILA+++DR+      
Sbjct: 247 TLNVGKGLEAGLAIVILAVVIDRITQAYGR 276


>gi|21226143|ref|NP_632065.1| glycine betaine transporter, permease [Methanosarcina mazei Go1]
 gi|20904368|gb|AAM29737.1| Glycine betaine transporter, permease protein [Methanosarcina mazei
           Go1]
          Length = 276

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 131/272 (48%), Positives = 181/272 (66%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+GDY++     +  N  W  +I+S  L   +      L   PPL+F  +++ L    
Sbjct: 5   KIPIGDYVEIAVYWIELNLGWLLDIISDFLGFMITGFRDFLMLFPPLIFALLIAALAYFT 64

Query: 68  KRSI-TIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            +    +AVGT +GLLLI     W  + ETLSLV+ S F+++ IG+PLG+LAA    F++
Sbjct: 65  GKKNLKLAVGTFVGLLLIENLRLWTLSMETLSLVISSAFLALVIGIPLGILAAKSDFFFN 124

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           +++  LD MQT+P+FVYLIPAL+ FGLG VPG++AT+VF++P ++RLT LGI   P  LK
Sbjct: 125 VLKPILDLMQTMPSFVYLIPALIFFGLGNVPGMIATLVFAMPPTIRLTNLGIRQVPRELK 184

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           E A AFG+TP+Q   KVELP A+P I+A + Q IMLSLSMVV+ A++G+ GLG  VL  +
Sbjct: 185 EVADAFGSTPWQKLVKVELPAALPTIMAGVNQCIMLSLSMVVIAAMIGARGLGYQVLFGI 244

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VDIG GFE+GL IVILA+ILDR+     P+
Sbjct: 245 QRVDIGLGFEAGLGIVILAVILDRITQNLSPK 276


>gi|330501438|ref|YP_004378307.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas mendocina NK-01]
 gi|328915724|gb|AEB56555.1| binding-protein-dependent transport systems inner membrane
           component [Pseudomonas mendocina NK-01]
          Length = 292

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 111/276 (40%), Positives = 169/276 (61%), Gaps = 1/276 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    + LG ++ +    L  N     + +  ++      +  +L   P  + + +   L
Sbjct: 1   MSDKKLDLGSWVNDVVQHLLDNYSGVFDSIGKLVSGFSEGIEALLMLPPAWLLIAIFVGL 60

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
            L  +  +  A+ TA+  +LI+  G+W++T  TL L   ST IS+ +G+PLG+ AA   R
Sbjct: 61  GLW-RIGVRFAIFTAVAFVLIVMTGFWEQTVVTLGLTFSSTLISLLLGIPLGIWAARSER 119

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
             +IIR  LD MQT+P FVYLIPA +LFGLG VPGI+AT++F++P +VRLT LGI     
Sbjct: 120 VATIIRPILDFMQTMPAFVYLIPAAMLFGLGRVPGIIATVIFAMPPAVRLTSLGIRQVNK 179

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            + EA  +FG T  Q+  KV+LP A+P I+A + QTIM++LSMV++ ++VG+ GLG  VL
Sbjct: 180 EIVEAGQSFGCTSRQLLFKVQLPNAMPSIMAGVNQTIMMALSMVIIASMVGAGGLGNDVL 239

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            ++  +DIG GFESG+ +V+LAIILDR+      + 
Sbjct: 240 ASIQRLDIGLGFESGMAVVLLAIILDRITESFGTKQ 275


>gi|260462558|ref|ZP_05810765.1| choline ABC transporter, permease protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259031754|gb|EEW33023.1| choline ABC transporter, permease protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 284

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 130/277 (46%), Positives = 184/277 (66%), Gaps = 4/277 (1%)

Query: 1   MSPI----IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVF 56
           M PI    +   IP+G + + FF  LT N +      S  L   ++ ++ +L  +PP++ 
Sbjct: 1   MDPISKFMVDHKIPIGAWGKAFFGFLTDNFDTVFRAFSNGLNFLLDGLVNILLMVPPVLL 60

Query: 57  VCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGV 116
             V++++  +++RS  +A+G  +GL+ II Q  W++T +TL LV+ +  ++M IGVPLG+
Sbjct: 61  ALVIAVIAWLLQRSRPLAIGVFLGLIFIINQNLWKQTVQTLVLVVAAAAMAMAIGVPLGI 120

Query: 117 LAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRL 176
            AA  P+ Y I+   LD MQT+PTFVYLIP L LFGLG  PG++ TI+F IPT+VRLT L
Sbjct: 121 WAAHKPKVYRIMLPVLDLMQTLPTFVYLIPVLTLFGLGNAPGLIVTIIFVIPTAVRLTHL 180

Query: 177 GIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSN 236
           G++S P  + EA  AFGAT  Q+  KVELP A+P I+A LTQ+IMLSLSMVV  AL+G+ 
Sbjct: 181 GVVSVPKSIIEAGEAFGATKSQLLWKVELPSALPTIMAGLTQSIMLSLSMVVFAALIGAG 240

Query: 237 GLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           GLG  + RAL +  I  G E+GL IV+LAI+LDR+  
Sbjct: 241 GLGTEINRALGSRRIDLGLEAGLAIVVLAIVLDRMTR 277


>gi|163790850|ref|ZP_02185275.1| glycine betaine ABC transporter permease [Carnobacterium sp. AT7]
 gi|159873918|gb|EDP67997.1| glycine betaine ABC transporter permease [Carnobacterium sp. AT7]
          Length = 283

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 172/281 (61%), Gaps = 3/281 (1%)

Query: 1   MSPIIQA--PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVC 58
           MS ++ A   +P+ D ++ F   LT    +  + +      A+  V   L  +PPL+F+ 
Sbjct: 3   MSSLLDAIPKLPVADGVENFTSWLTDTFAFLFDPIQKYSEIAMEFVTETLLLVPPLLFIL 62

Query: 59  VVSLLVLMVKRS-ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVL 117
           +V+++  +  R    +A  + +GL  I  QG W +   TL+LVLV++ +S+ IGVP G+L
Sbjct: 63  IVAVIAFIASRKKFGLAAFSIVGLWFIYNQGLWSDLMNTLTLVLVASLLSVIIGVPFGIL 122

Query: 118 AAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLG 177
            A      +II   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F+IP +VR T LG
Sbjct: 123 MAKNKVANTIIAPVLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASLIFAIPPTVRFTNLG 182

Query: 178 IISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNG 237
           I      L EAA +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV+ +++G+ G
Sbjct: 183 IRQVSDELVEAAESFGSTGAQKLFKVELPLAKSTIMAGINQTVMLALSMVVIASMIGAPG 242

Query: 238 LGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           LG  VL +L    +G GF SGL +V+LAII+DRL    + +
Sbjct: 243 LGREVLSSLQRAQVGTGFVSGLGLVVLAIIIDRLTQKLNKK 283


>gi|152984113|ref|YP_001351148.1| ABC transporter permease [Pseudomonas aeruginosa PA7]
 gi|150959271|gb|ABR81296.1| probable permease of ABC transporter [Pseudomonas aeruginosa PA7]
          Length = 283

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 163/270 (60%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V+ +    
Sbjct: 7   TFSIADWVNGWVDALVTNYGDLFRKISDTLLWAIVNLEGLLRATPWWLLLAIVAAIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   +     L L+   G W +  +TL+L+LV+TFIS+ IG+PLG+LAA   R  ++
Sbjct: 67  TRRLLPTLVITGLLFLVGAVGLWDKLMQTLALMLVATFISVLIGIPLGILAARSNRLRAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDNEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AVNAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++G+G E+GL IVILA+++DR+      
Sbjct: 247 TLNVGKGLEAGLAIVILAVVIDRITQAYGR 276


>gi|50954648|ref|YP_061936.1| ABC-type glycine betaine transport, permease protein [Leifsonia
           xyli subsp. xyli str. CTCB07]
 gi|50951130|gb|AAT88831.1| ABC-type glycine betaine transport, permease protein [Leifsonia
           xyli subsp. xyli str. CTCB07]
          Length = 571

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 116/275 (42%), Positives = 166/275 (60%), Gaps = 3/275 (1%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWF--CNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
            +PLGD        +T         + +  +       V +VLQ  P    + + ++L +
Sbjct: 4   RLPLGDVASHAVDVVTVALGGLGEFDAVRAVFGGLYAGVDWVLQTPPFWGVILLFAILGV 63

Query: 66  MVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFY 125
            + R      GT   LLLI   G W    +TL+LVLVS   ++ + +PLG+LAA      
Sbjct: 64  WL-RGSVFGAGTTARLLLIASVGQWANAMDTLALVLVSAAAAIALSLPLGILAARSKTAS 122

Query: 126 SIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPIL 185
           +IIR  LD MQT+  FVYLIPAL+LF +G+VPG+VATIVF++   VRLT LGI      L
Sbjct: 123 AIIRPVLDLMQTMSAFVYLIPALILFRIGVVPGMVATIVFAMAPGVRLTELGIRGVDHEL 182

Query: 186 KEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRA 245
            EA  AFG++P ++ R+++LP A+P I+A + Q IMLSLSMVV+  +VG+ GLG  +++A
Sbjct: 183 VEAGRAFGSSPSRILRQIQLPLALPSILAGVNQVIMLSLSMVVIAGMVGAGGLGRDIVQA 242

Query: 246 LNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           L+ VD+G GFE+G+ +VILAI+LDRL +      R
Sbjct: 243 LSRVDVGLGFEAGVAVVILAIVLDRLTAAMGNARR 277


>gi|319781844|ref|YP_004141320.1| choline ABC transporter permease protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317167732|gb|ADV11270.1| choline ABC transporter, permease protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 284

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 129/279 (46%), Positives = 185/279 (66%), Gaps = 4/279 (1%)

Query: 1   MSPI----IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVF 56
           M PI    +   IP+G + + FF  LT N +      S  L   ++ ++ +L  +PP++ 
Sbjct: 1   MDPISKFMVDHKIPIGAWGKAFFGFLTDNFDTVFRAFSNGLNFLLDGLVGILLMVPPVLL 60

Query: 57  VCVVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGV 116
             +++++  +++RS  +A+G  +GL+ II Q  W++T +TL LV+ +  ++M IGVPLG+
Sbjct: 61  ALIIAVIAWLLQRSRPLAIGVFLGLIFIINQNLWKQTVQTLVLVVAAAAMAMAIGVPLGI 120

Query: 117 LAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRL 176
            AA  P+ Y ++   LD MQT+PTFVYLIP L LFGLG  PG++ TI+F IPT+VRLT L
Sbjct: 121 WAAHKPKVYRVMLPVLDLMQTLPTFVYLIPVLTLFGLGNAPGLIVTIIFVIPTAVRLTHL 180

Query: 177 GIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSN 236
           G++S P  + EA  AFGAT  Q+  KVELP A+P I+A LTQ+IMLSLSMVV  AL+G+ 
Sbjct: 181 GVVSVPKSIVEAGEAFGATKSQLLWKVELPSALPTIMAGLTQSIMLSLSMVVFAALIGAG 240

Query: 237 GLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIP 275
           GLG  + RAL +  I  G E+GL IV+LAI+LDR+  I 
Sbjct: 241 GLGTEINRALGSRRIDLGLEAGLAIVVLAIVLDRMTRIA 279


>gi|110634883|ref|YP_675091.1| binding-protein-dependent transport systems inner membrane
           component [Mesorhizobium sp. BNC1]
 gi|110285867|gb|ABG63926.1| binding-protein-dependent transport systems inner membrane
           component [Chelativorans sp. BNC1]
          Length = 300

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 106/270 (39%), Positives = 165/270 (61%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +   + +F   L ++       +S  +L  +  + +VL+ LP    + +   +  +  R+
Sbjct: 29  ISQPINDFVAFLIESYGETFRAISNFILSGLLQIEWVLRALPWWGTILIFMAVAYLCVRN 88

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
             + +     L+L    G W  T +TL+L+L++T IS  +G+P GVL A      +I+  
Sbjct: 89  YKLPLLVGGLLMLAGMLGLWDLTMQTLALMLMATLISCLVGIPTGVLVAKVRVMRNILIP 148

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P+FVYLIPA++LFGLG VP ++ATI++ +P  +RLT LGI      + EAA 
Sbjct: 149 MLDIMQTMPSFVYLIPAIMLFGLGKVPAVLATIIYGVPPLIRLTSLGIRQVDQEVVEAAL 208

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG++  Q+   VELP A+P I+A L QTIM+SLSMVVV++++G+ GLG  VL  + T+D
Sbjct: 209 AFGSSSRQILFGVELPLAVPTILAGLNQTIMMSLSMVVVSSMIGARGLGQQVLEGIQTLD 268

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +G+G E+G+ IVILA++LDR+        R
Sbjct: 269 VGKGLEAGVGIVILAVVLDRITQGLGQSQR 298


>gi|302524982|ref|ZP_07277324.1| choline ABC transporter, permease [Streptomyces sp. AA4]
 gi|302433877|gb|EFL05693.1| choline ABC transporter, permease [Streptomyces sp. AA4]
          Length = 294

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 111/274 (40%), Positives = 163/274 (59%), Gaps = 1/274 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G + +     L  N   F + +  I+  AV+ +   L +LP  V V V + L   +
Sbjct: 12  QIPVGSWFKAVIDWLQGNIGPFFDFVDKIVNGAVDGLTAGLTWLPWPVLVVVFAGLGWWL 71

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     +G+A+G  LI     +    +TLS VL+S  +++ I VP+G+ AA       I
Sbjct: 72  -RGWKFGLGSAIGFALIDSLREFPSAMQTLSQVLISGVVAVAIAVPVGIAAARNETVSRI 130

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIP +  F +G VPG+VAT+VFS+P  VRLT LGI    P + E
Sbjct: 131 VRPVLDFMQTLPAFVYLIPVIFFFSIGPVPGVVATVVFSLPPGVRLTELGIRQVDPEMVE 190

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+ P ++ R++++P A+P I+A + Q IMLSLSMVV++ +VG+ GLG  V  A+ 
Sbjct: 191 AGEAFGSPPRRILREIQIPLAMPSIMAGINQIIMLSLSMVVISGMVGAPGLGAEVYAAVT 250

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
           ++ +  GF +GL +V+LAI LDRL S    R  +
Sbjct: 251 SLKLDLGFNAGLGVVVLAIYLDRLTSALGARSAV 284


>gi|114705345|ref|ZP_01438253.1| Binding-protein-dependent transport systems inner membrane
           component [Fulvimarina pelagi HTCC2506]
 gi|114540130|gb|EAU43250.1| Binding-protein-dependent transport systems inner membrane
           component [Fulvimarina pelagi HTCC2506]
          Length = 305

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 108/273 (39%), Positives = 161/273 (58%), Gaps = 2/273 (0%)

Query: 9   IPLGDYLQEFFV-CLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
           IP  D++ +F    L          +   +   +  +   L  +P L+F  V+ L+    
Sbjct: 4   IPFADWVDDFVRGFLVPTFRPVFRAMQEPVDFLMQNLDAFLNAVPWLIFAAVLGLIAWR- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                +A+ T + L  I   G W ET  TLS+++ +    + +GVPLG+ AA   +F SI
Sbjct: 63  TAGRGMAIFTVLALAFIDMIGLWSETMTTLSMIITAVVFCIVLGVPLGIAAARSDKFLSI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQTIP+FVYL+P ++LFG+G VPG++ATI+F++P  +RLT LGI +    L E
Sbjct: 123 LRPILDIMQTIPSFVYLVPIVMLFGVGTVPGVIATIIFALPPIIRLTNLGIRNVRGDLIE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+TP Q+  +V+LP A+  I+A L QT+ML+LSMVV+ AL+G+ GLG+ V   L 
Sbjct: 183 AAKAFGSTPRQILWEVQLPLALRTIMAGLNQTLMLALSMVVIAALIGAGGLGLTVNTGLG 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            + +G     G+ IV+LAIILDR+        +
Sbjct: 243 RLAVGTATAGGVGIVLLAIILDRITQGLGEAKK 275


>gi|326796543|ref|YP_004314363.1| choline ABC transporter permease [Marinomonas mediterranea MMB-1]
 gi|326547307|gb|ADZ92527.1| choline ABC transporter, permease protein [Marinomonas mediterranea
           MMB-1]
          Length = 281

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 133/279 (47%), Positives = 189/279 (67%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IPLGD ++ F   L      F + ++  L   +  ++ V +++PPL  + ++
Sbjct: 1   MDWLTDNKIPLGDVMETFVNWLVDAAAVFFDFIAITLETIIMALVDVFEWIPPLALIAMI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           ++    + RS+ + V     LLLII  GYW ET +TL LV+ +TF+S+ IGVP+G+ AA 
Sbjct: 61  AVGAWFLHRSVGLVVFIVAALLLIINLGYWLETIQTLVLVVSATFVSVLIGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+I+R  LD MQTIPTFVYLIP L+LFGLG VPG+++TI+F+I   +RLT LG+  
Sbjct: 121 RPWLYTILRPVLDLMQTIPTFVYLIPTLILFGLGYVPGLISTIIFAIAAPIRLTYLGVSK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFG T  ++  +VELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 181 VPSELLEAGLAFGCTKSKLLYRVELPAAMPSIMAGVTQCIMLSLSMVVIAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+G+ IV++AIILDR+   P  ++
Sbjct: 241 PVVRALNTVNISQGFEAGVAIVLVAIILDRICKTPSSKN 279


>gi|94498974|ref|ZP_01305512.1| ABC-type proline/glycine betaine transport system, permease
           component [Oceanobacter sp. RED65]
 gi|94428606|gb|EAT13578.1| ABC-type proline/glycine betaine transport system, permease
           component [Oceanobacter sp. RED65]
          Length = 276

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 133/273 (48%), Positives = 178/273 (65%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MS I +  IP+G++ +     L  +G  F + +S +L   +  ++ +L  +PP +F+ +V
Sbjct: 2   MSFITENKIPIGEWAESMMDFLIDHGGSFFDWVSIVLDTMIVGLVDLLSVMPPWLFILIV 61

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
                  +R     +     LLLI   GYWQET ET+SLV+ +T   + IGVP+G+ AA 
Sbjct: 62  GAFAFWYQRRWGTPIFIVASLLLIWNLGYWQETIETISLVIFATGFCVLIGVPIGIAAAH 121

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y ++R  LD MQTIP FVYLIP L LFGLG+VPG+++TIVF+I   +RLT LGI  
Sbjct: 122 RPWLYRVLRPVLDLMQTIPPFVYLIPTLTLFGLGVVPGLISTIVFAIAAPIRLTYLGISE 181

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFG T   +  K+E+P A+  I A +TQ IMLSLSMVV+ ALVG++GLG 
Sbjct: 182 VPKELLEAGKAFGCTKQNLLVKIEIPAAMSSIRAGITQCIMLSLSMVVIAALVGADGLGK 241

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           PV+RALNTVDI  GFE+GL IV++AIILDRLF 
Sbjct: 242 PVVRALNTVDIASGFEAGLAIVLVAIILDRLFK 274


>gi|256061630|ref|ZP_05451769.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella neotomae 5K33]
 gi|261325637|ref|ZP_05964834.1| glycine betaine/L-proline ABC transporter permease [Brucella
           neotomae 5K33]
 gi|261301617|gb|EEY05114.1| glycine betaine/L-proline ABC transporter permease [Brucella
           neotomae 5K33]
          Length = 278

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 137/278 (49%), Positives = 197/278 (70%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG+ GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGAGGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|49083280|gb|AAT50991.1| PA5095 [synthetic construct]
          Length = 284

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 164/270 (60%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++  +F  L  N       +S  LL A+  +  +L+  P  + + +V+ +    
Sbjct: 7   TFSIANWVNAWFDALVTNYGDLFRKISDTLLWAIVNLEGLLRATPWWLLLAIVAAIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   +     L L+   G W +  +TL+L+LV+TFIS+ IG+PLG+LAA   R  ++
Sbjct: 67  TRRLLPTLVITGLLFLVGAVGLWDKLMQTLALMLVATFISVLIGIPLGILAARSNRLRAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDSEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AVNAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++G+G E+GL IVILA+++DR+      
Sbjct: 247 TLNVGKGLEAGLAIVILAVVIDRITQAYGR 276


>gi|312958480|ref|ZP_07773000.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens WH6]
 gi|311287023|gb|EFQ65584.1| glycine betaine/L-proline ABC transporter, permease protein
           [Pseudomonas fluorescens WH6]
          Length = 283

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 103/270 (38%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIADWVNGWVDSLVTNYGDVFRQISDTLLWAIVNLEGLLRAAPWWLMLAIVGAVAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +         L L+   G W +  +TL+L++V+T IS+ IG+PLG+L+A   R  S+
Sbjct: 67  TRKVVTTTVIVGLLFLVGAVGLWDKLMQTLALMMVATVISVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|15966454|ref|NP_386807.1| histidine transport system permease ABC transporter protein
           [Sinorhizobium meliloti 1021]
 gi|307300509|ref|ZP_07580289.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium meliloti BL225C]
 gi|307318374|ref|ZP_07597809.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium meliloti AK83]
 gi|15075725|emb|CAC47280.1| Histidine ABC transporter, permease [Sinorhizobium meliloti 1021]
 gi|306896056|gb|EFN26807.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium meliloti AK83]
 gi|306904675|gb|EFN35259.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium meliloti BL225C]
          Length = 285

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 167/269 (62%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           + +   + +F   L  N  W    +S ++LKAV  + ++L+ LP  + +     L     
Sbjct: 8   LSIRAPVNDFIQALVTNYGWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALAWRSS 67

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
           R  ++ +     L+ +   G W  T +TL+L+L++T +S+ IGVP+G+L A      +I 
Sbjct: 68  RRWSLTLAVGALLVTVGVLGLWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNIT 127

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P+FVYLIPAL+LFGLG VP I+ATI++++P  +RLT LGI      + EA
Sbjct: 128 LPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEA 187

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A AFG +P Q+   VELP A P I+A L QTIM++LSMVVV +++G+ GLG  VL  + T
Sbjct: 188 ATAFGGSPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQT 247

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +D+G+G E+G+ IVILA++LDR+      
Sbjct: 248 LDVGKGLEAGIGIVILAVVLDRITQGFGK 276


>gi|15600288|ref|NP_253782.1| permease of ABC transporter [Pseudomonas aeruginosa PAO1]
 gi|9951390|gb|AAG08480.1|AE004922_5 probable permease of ABC transporter [Pseudomonas aeruginosa PAO1]
          Length = 283

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 103/270 (38%), Positives = 163/270 (60%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++  +   L  N       +S  LL A+  +  +L+  P  + + +V+ +    
Sbjct: 7   TFSIANWVNAWVDALVTNYGDLFRKISDTLLWAIVNLEGLLRATPWWLLLAIVAAIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +   +     L L+   G W +  +TL+L+LV+TFIS+ IG+PLG+LAA   R  ++
Sbjct: 67  TRRLLPTLVITGLLFLVGAVGLWDKLMQTLALMLVATFISVLIGIPLGILAARSNRLRAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDSEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AVNAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++G+G E+GL IVILA+++DR+      
Sbjct: 247 TLNVGKGLEAGLAIVILAVVIDRITQAYGR 276


>gi|225181346|ref|ZP_03734790.1| binding-protein-dependent transport systems inner membrane
           component [Dethiobacter alkaliphilus AHT 1]
 gi|225167927|gb|EEG76734.1| binding-protein-dependent transport systems inner membrane
           component [Dethiobacter alkaliphilus AHT 1]
          Length = 280

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 124/273 (45%), Positives = 169/273 (61%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLGD ++     +  N       +S IL   V+ ++ +L  + PL+ + ++SLLV  +
Sbjct: 4   KIPLGDAVEWLIAMIRTNFRPVLRGMSDILSSIVSGLINLLGSVHPLILILLLSLLVWKL 63

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +   A+ T  G LLI   G W +   T  LVLV+TFIS+ IG+PLG+  A   R  S 
Sbjct: 64  T-NRKTALLTLFGFLLIENLGLWPDLLITFVLVLVATFISLVIGIPLGIACARSNRINSY 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA++ F +G VP IVAT +FS+P ++RLT LGI   P  L E
Sbjct: 123 VTPVLDLMQTMPAFVYLIPAVMFFRVGSVPAIVATFIFSVPPTIRLTNLGIRQVPTELIE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA +FGATP Q   KV+LP A+P I+A + Q IML+LSM V+ A+VG+ GLG  V   + 
Sbjct: 183 AADSFGATPRQKLIKVQLPLALPTIMAGVNQCIMLALSMAVIAAMVGAGGLGRVVWSGIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           T+D+G GFE GL +VILAIILDR+      R +
Sbjct: 243 TLDVGLGFEGGLAVVILAIILDRISHGLINRSK 275


>gi|239832460|ref|ZP_04680789.1| choline ABC transporter, permease protein [Ochrobactrum intermedium
           LMG 3301]
 gi|239824727|gb|EEQ96295.1| choline ABC transporter, permease protein [Ochrobactrum intermedium
           LMG 3301]
          Length = 278

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 140/278 (50%), Positives = 199/278 (71%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ I+   ++ +L++LQ   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAIMQGLIDGLLYLLQLPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTVLGFLFIINQGYWEPTLKTLTLVLSSCFVCMAIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPSSLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AIILDR+F   + +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIILDRIFRAGNEK 278


>gi|17986723|ref|NP_539357.1| glycine betaine/L-proline transport system permease protein proW
           [Brucella melitensis bv. 1 str. 16M]
 gi|225853055|ref|YP_002733288.1| choline ABC transporter permease [Brucella melitensis ATCC 23457]
 gi|254694250|ref|ZP_05156078.1| choline ABC transporter, permease protein [Brucella abortus bv. 3
           str. Tulya]
 gi|256045197|ref|ZP_05448096.1| choline ABC transporter, permease protein [Brucella melitensis bv.
           1 str. Rev.1]
 gi|256114149|ref|ZP_05454903.1| choline ABC transporter, permease protein [Brucella melitensis bv.
           3 str. Ether]
 gi|256263464|ref|ZP_05465996.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 2 str. 63/9]
 gi|260565203|ref|ZP_05835687.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. 16M]
 gi|261214558|ref|ZP_05928839.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 3 str. Tulya]
 gi|265991631|ref|ZP_06104188.1| glycine betaine/L-proline ABC transporter permease [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265995468|ref|ZP_06108025.1| glycine betaine/L-proline ABC transporter permease [Brucella
           melitensis bv. 3 str. Ether]
 gi|17982347|gb|AAL51621.1| glycine betaine/l-proline transport system permease protein prow
           [Brucella melitensis bv. 1 str. 16M]
 gi|225641420|gb|ACO01334.1| choline ABC transporter, permease protein [Brucella melitensis ATCC
           23457]
 gi|260151271|gb|EEW86365.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. 16M]
 gi|260916165|gb|EEX83026.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 3 str. Tulya]
 gi|262766581|gb|EEZ12370.1| glycine betaine/L-proline ABC transporter permease [Brucella
           melitensis bv. 3 str. Ether]
 gi|263002415|gb|EEZ14990.1| glycine betaine/L-proline ABC transporter permease [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093471|gb|EEZ17521.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 2 str. 63/9]
 gi|326409597|gb|ADZ66662.1| choline ABC transporter permease [Brucella melitensis M28]
 gi|326539301|gb|ADZ87516.1| choline ABC transporter, permease protein [Brucella melitensis
           M5-90]
          Length = 278

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 136/278 (48%), Positives = 197/278 (70%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+L I S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLSISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|148560547|ref|YP_001259451.1| putative glycine betaine/L-proline ABC transporter permease
           [Brucella ovis ATCC 25840]
 gi|225628017|ref|ZP_03786053.1| choline ABC transporter, permease protein [Brucella ceti str. Cudo]
 gi|254702297|ref|ZP_05164125.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella suis bv. 5 str. 513]
 gi|254710612|ref|ZP_05172423.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella pinnipedialis B2/94]
 gi|254714795|ref|ZP_05176606.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella ceti M644/93/1]
 gi|254717856|ref|ZP_05179667.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella ceti M13/05/1]
 gi|256032106|ref|ZP_05445720.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella pinnipedialis M292/94/1]
 gi|256369995|ref|YP_003107506.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Brucella microti CCM 4915]
 gi|260169241|ref|ZP_05756052.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Brucella sp. F5/99]
 gi|261219703|ref|ZP_05933984.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti M13/05/1]
 gi|261318185|ref|ZP_05957382.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis B2/94]
 gi|261322592|ref|ZP_05961789.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti M644/93/1]
 gi|261752865|ref|ZP_05996574.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 5 str. 513]
 gi|261758754|ref|ZP_06002463.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. F5/99]
 gi|265989216|ref|ZP_06101773.1| glycine betaine/L-proline ABC transporter permease [Brucella
           pinnipedialis M292/94/1]
 gi|294852895|ref|ZP_06793568.1| choline ABC transporter [Brucella sp. NVSL 07-0026]
 gi|306843073|ref|ZP_07475696.1| choline ABC transporter, permease protein [Brucella sp. BO2]
 gi|306844580|ref|ZP_07477167.1| choline ABC transporter, permease protein [Brucella sp. BO1]
 gi|148371804|gb|ABQ61783.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella ovis ATCC 25840]
 gi|225617180|gb|EEH14226.1| choline ABC transporter, permease protein [Brucella ceti str. Cudo]
 gi|256000158|gb|ACU48557.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Brucella microti CCM 4915]
 gi|260924792|gb|EEX91360.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti M13/05/1]
 gi|261295282|gb|EEX98778.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti M644/93/1]
 gi|261297408|gb|EEY00905.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis B2/94]
 gi|261738738|gb|EEY26734.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. F5/99]
 gi|261742618|gb|EEY30544.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 5 str. 513]
 gi|264661413|gb|EEZ31674.1| glycine betaine/L-proline ABC transporter permease [Brucella
           pinnipedialis M292/94/1]
 gi|294821484|gb|EFG38483.1| choline ABC transporter [Brucella sp. NVSL 07-0026]
 gi|306275024|gb|EFM56787.1| choline ABC transporter, permease protein [Brucella sp. BO1]
 gi|306286752|gb|EFM58302.1| choline ABC transporter, permease protein [Brucella sp. BO2]
          Length = 278

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 137/278 (49%), Positives = 198/278 (71%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|28211936|ref|NP_782880.1| putative glycine-betaine binding permease protein [Clostridium
           tetani E88]
 gi|28204379|gb|AAO36817.1| putative glycine-betaine binding permease protein [Clostridium
           tetani E88]
          Length = 275

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 117/270 (43%), Positives = 173/270 (64%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              +G + +     L  N E F N++  I    +N +  +L + P +V + + +LL   +
Sbjct: 4   KFHVGPFFEFIVEWLKTNIEPFFNLIKVIHEALINGLEDILMFPPSIVVIILFALLAYKL 63

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                +A+ T +GL  I     W +T +TL+LVLVS  I++ IGVP G+++A   +   I
Sbjct: 64  A-DKRVAIFTFVGLFFIDSMQLWNQTMQTLALVLVSALIALLIGVPFGIMSARNEKANKI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA++ FG+G VPG +AT++FS+P +VRLT LGI   P  + E
Sbjct: 123 LRPILDFMQTMPAFVYLIPAVLFFGMGKVPGAIATVIFSMPPAVRLTNLGIRQVPDEVVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA +FG+TP Q+  KV+LP A+P I+A + QTIML+LSMVVV+A++G+ GLG  V + + 
Sbjct: 183 AAKSFGSTPKQMLYKVQLPIALPTILAGVNQTIMLALSMVVVSAMIGAGGLGREVYQGIT 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            + IG+GFESGL +VILA+ILDR+      
Sbjct: 243 QLKIGQGFESGLAVVILAMILDRMTQSLAN 272


>gi|323701553|ref|ZP_08113226.1| binding-protein-dependent transport systems inner membrane
           component [Desulfotomaculum nigrificans DSM 574]
 gi|323533562|gb|EGB23428.1| binding-protein-dependent transport systems inner membrane
           component [Desulfotomaculum nigrificans DSM 574]
          Length = 279

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 120/274 (43%), Positives = 171/274 (62%), Gaps = 1/274 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL  +++     L  +     + +S ++   V+L   V   LP    + + +L+   +
Sbjct: 7   KIPLDQWVEALVNYLGIHLGGLFDGISLLINSMVDLFGAVFTGLPSWSLILLFTLIAWRL 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   IA+ T  GL LI+  GYW+ T ETL+LVL +  IS+FIG+P G+L A      ++
Sbjct: 67  GRLP-IALFTCGGLFLILNMGYWENTMETLALVLTAAAISIFIGIPTGILCARKNSVCNL 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG VPG++A+++F++P ++RLT LGI   P  L E
Sbjct: 126 VTPALDFMQTMPAFVYLIPAIFFFGLGKVPGVIASVIFAMPPTIRLTNLGIRQVPAELVE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+TP Q   KV+LP A P I+A + Q IML+LSMVV+ +++G+ GLG  V RA+ 
Sbjct: 186 AADAFGSTPAQKLLKVQLPLAKPTIMAGINQCIMLALSMVVIASMIGAKGLGADVYRAVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
            + IG GFE+GL IVILAI+LDR+        RI
Sbjct: 246 QIKIGEGFEAGLAIVILAIMLDRMTQNIGKIKRI 279


>gi|229587925|ref|YP_002870044.1| putative histidine ABC transporter membrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229359791|emb|CAY46641.1| putative histidine ABC transport system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 283

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 103/270 (38%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIADWVNGWVDSLVTNYGDVFRHISDTLLWAIVNLEGLLRAAPWWLMLAIVGAVAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +         L L+   G W +  +TL+L++V+T IS+ IG+PLG+L+A   R  S+
Sbjct: 67  TRKVVTTAVIVGLLFLVGAVGLWDKLMQTLALMMVATVISVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|13378312|gb|AAK18747.1| ProW-like protein [Enterobacter amnigenus]
          Length = 295

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 108/272 (39%), Positives = 159/272 (58%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPL  ++ E    L  +       +   +   ++    +L  +P  + + + SL+   + 
Sbjct: 1   IPLDSWVTEGIGWLVLHFRPLFQGIRVPVDFILSGFQQLLLGMPAPIAIVLFSLIAWQIT 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
            S+ + V T + L+ I   G W +   TL+LVL + F  + IG+PLG+  A       +I
Sbjct: 61  -SLGMGVATLVSLVAIGAIGAWSQAMVTLALVLTALFFCILIGLPLGIWLARSKHAAKVI 119

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD+MQT P FVYL+P ++LFG+G VPG+V TI+F++P  VRLT LGI   P  L EA
Sbjct: 120 RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQVPEDLIEA 179

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A +FGA+P Q+  KV+LP A+P I+A + QT+ML+LSMVV+ +++   GLG  VLR +  
Sbjct: 180 AESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR 239

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +D+G     G+ IVILAIILDRL        R
Sbjct: 240 LDMGLAAVGGVGIVILAIILDRLTQSLGRDRR 271


>gi|251798477|ref|YP_003013208.1| binding-protein-dependent transporters inner membrane component
           [Paenibacillus sp. JDR-2]
 gi|247546103|gb|ACT03122.1| binding-protein-dependent transport systems inner membrane
           component [Paenibacillus sp. JDR-2]
          Length = 278

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 113/280 (40%), Positives = 178/280 (63%), Gaps = 3/280 (1%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    +PLG++++     L  +     + +  I+   V+ +  VL + P ++ + ++
Sbjct: 1   MNNI--PKLPLGNWIESLESWLENHFTPLFDFIRLIIGSIVDFLHNVLLFSPSILMILII 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L   + +   +A    +GLLLI   GYW+   ETLS+VL ++ +S+ IGVP G+L A 
Sbjct: 59  TALAWFLGK-WKVAAFALIGLLLIDNLGYWEHAMETLSIVLTASLLSIIIGVPTGILCAR 117

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
                 II   LD MQT+P FVYL+PA+  F LG+VPG++A+I+F++P ++RLT LGI  
Sbjct: 118 SSFLQGIITPLLDLMQTMPAFVYLLPAVSFFSLGVVPGVIASIIFAVPPTIRLTNLGIRQ 177

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+TP Q   K++LP A+P ++A + QTIMLSLSMVV+++++G+ GLG 
Sbjct: 178 VPVELVEAADAFGSTPNQKLFKLQLPMALPTMMAGINQTIMLSLSMVVISSMIGAQGLGA 237

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V RA+     G GFE+G+ IV+LAI+LDR+ +    +++
Sbjct: 238 DVYRAVTQTKTGIGFEAGISIVVLAILLDRMSNHIVKKNK 277


>gi|294339047|emb|CAZ87396.1| Glycine betaine transport system permease protein opuAB [Thiomonas
           sp. 3As]
          Length = 286

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 109/276 (39%), Positives = 172/276 (62%), Gaps = 5/276 (1%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL---- 62
            PIP+GD++      LT       + ++  +   ++ +   L ++P  VF+ +V++    
Sbjct: 5   QPIPIGDWVSNGVNNLTDRYAAAFDSITHAVHFLISGLQTGLAWIPVPVFIALVAVLALA 64

Query: 63  -LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
            +        ++A+ + +GL L+   GYW +  +TL+LVL +  + + IGVP G+L+A  
Sbjct: 65  AMGWKRPGGWSLAIFSVLGLGLVWNLGYWDDLIKTLALVLAAEVLVILIGVPTGILSAKS 124

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
                 +R  LD MQT+P FVYL+PA++ FGLG+VPG+++T +F++P  +RLT LGI   
Sbjct: 125 RLLEKTLRPVLDIMQTMPAFVYLVPAVIFFGLGLVPGVISTTIFALPPLIRLTTLGIRQV 184

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           P  L EA  +FGAT +Q+  KV++P A+P I+A + Q+IML LSMVV++A++G+ GLG  
Sbjct: 185 PHELVEATQSFGATWWQLLTKVQIPSALPSIMAGVNQSIMLGLSMVVISAMIGAGGLGNV 244

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           VL  +  +D+G+GF  GLC+VILAIILDRL      
Sbjct: 245 VLEGITQLDVGKGFVGGLCVVILAIILDRLTQSLGR 280


>gi|153953414|ref|YP_001394179.1| ProW [Clostridium kluyveri DSM 555]
 gi|219854039|ref|YP_002471161.1| hypothetical protein CKR_0696 [Clostridium kluyveri NBRC 12016]
 gi|146346295|gb|EDK32831.1| ProW [Clostridium kluyveri DSM 555]
 gi|219567763|dbj|BAH05747.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 274

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 121/273 (44%), Positives = 179/273 (65%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              +G + +     LT N E F ++++ I    +  +  VL  +P ++ + V SLL L +
Sbjct: 3   TFHVGPFFEFIVNWLTDNMEPFFHLITLINSTLIEGLETVLLSVPSIIVIIVFSLLALKL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                +AV TA+GLL I     W +T ETL+LV+VST IS+ IG+PLG+LA+    F  +
Sbjct: 63  SGK-KVAVFTAIGLLFIDCIELWPQTMETLALVIVSTLISLIIGIPLGILASRSEGFNRV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           IR  LD MQT+P FVYLIPA++ FG+G VPG ++T++FS+P +VRLT LGI   P  + E
Sbjct: 122 IRPILDFMQTMPAFVYLIPAVLFFGMGKVPGAISTVIFSMPPAVRLTNLGIRQVPEDVIE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA +FG+T  Q+  KV++P A+P I+A + QTIMLSLSMVV++A++G+ GLG  V   + 
Sbjct: 182 AARSFGSTKSQMLYKVQIPIALPTILAGVNQTIMLSLSMVVISAMIGAGGLGREVYNGIT 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            ++IG GFESG+ +VILA++LDR+      + +
Sbjct: 242 QMEIGSGFESGIAVVILAMVLDRITQSLGHKKK 274


>gi|62290461|ref|YP_222254.1| glycine betaine/L-proline ABC transporter permease [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700384|ref|YP_414958.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis biovar Abortus 2308]
 gi|189024691|ref|YP_001935459.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus S19]
 gi|237815970|ref|ZP_04594967.1| choline ABC transporter, permease protein [Brucella abortus str.
           2308 A]
 gi|254697906|ref|ZP_05159734.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730796|ref|ZP_05189374.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus bv. 4 str. 292]
 gi|260546994|ref|ZP_05822733.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus NCTC 8038]
 gi|260758515|ref|ZP_05870863.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 4 str. 292]
 gi|260762339|ref|ZP_05874682.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|62196593|gb|AAX74893.1| hypothetical glycine betaine/L-proline ABC transporter, permease
           protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616485|emb|CAJ11550.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis biovar Abortus 2308]
 gi|189020263|gb|ACD72985.1| Binding-protein-dependent transport systems inner membrane
           component [Brucella abortus S19]
 gi|237789268|gb|EEP63479.1| choline ABC transporter, permease protein [Brucella abortus str.
           2308 A]
 gi|260096044|gb|EEW79921.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus NCTC 8038]
 gi|260668833|gb|EEX55773.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 4 str. 292]
 gi|260672771|gb|EEX59592.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 2 str. 86/8/59]
          Length = 278

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 135/278 (48%), Positives = 196/278 (70%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+L I S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLSISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFG +  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGTSRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|42781872|ref|NP_979119.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus ATCC 10987]
 gi|42737796|gb|AAS41727.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus ATCC 10987]
          Length = 278

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 182/280 (65%), Gaps = 2/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++
Sbjct: 1   MNNI--PRIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIIL 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L+    R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+ 
Sbjct: 59  CFLIWYTTRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQ 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF   ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI  
Sbjct: 119 NERFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQ 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV
Sbjct: 179 VPEDLIEAANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGV 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V R++  V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 239 DVYRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|269794248|ref|YP_003313703.1| proline/glycine betaine ABC transporter permease [Sanguibacter
           keddieii DSM 10542]
 gi|269096433|gb|ACZ20869.1| ABC-type proline/glycine betaine transport system, permease
           component [Sanguibacter keddieii DSM 10542]
          Length = 294

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 110/272 (40%), Positives = 164/272 (60%), Gaps = 1/272 (0%)

Query: 10  PLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKR 69
           PLG+++  F   +T    WF +++  +L    + +  +L   P  V   V++ L     R
Sbjct: 15  PLGEWVDSFVGWVTSTFSWFFDLIKGVLTWFFDQLDTILSGPPFWVVALVLAGLAFWA-R 73

Query: 70  SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIR 129
              + +G  +G  +I   G W    +TL+LVL+++ I++ I +PLG+ AA       ++R
Sbjct: 74  GWKLGLGAFVGFAVIDMVGQWGNAMDTLALVLIASAIALIIAIPLGIWAARNDAVSHLLR 133

Query: 130 LFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAA 189
             LD MQT+P FVYLIP +V+F  G VPGIVAT++F++   VR T LGI      + EA 
Sbjct: 134 PVLDFMQTMPAFVYLIPTVVIFLTGEVPGIVATVIFALAPGVRFTELGIRQVDREVVEAG 193

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
            AFGAT  ++ R+++LP A+P I+A + Q IMLSLSMVV+  +VG+ GLG  V+RAL  V
Sbjct: 194 HAFGATEGRIMRQIQLPLALPTIMAGINQVIMLSLSMVVIAGMVGAAGLGSDVVRALQRV 253

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
           +I  GFE+GL +VILA+ LDR+ S    R  +
Sbjct: 254 NISLGFEAGLAVVILAMFLDRVTSALGDRAPV 285


>gi|239834174|ref|ZP_04682502.1| binding-protein-dependent transport systems inner membrane
           component [Ochrobactrum intermedium LMG 3301]
 gi|239822237|gb|EEQ93806.1| binding-protein-dependent transport systems inner membrane
           component [Ochrobactrum intermedium LMG 3301]
          Length = 301

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 113/267 (42%), Positives = 162/267 (60%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G++       +  +     ++++  +    + +   L  +PP+  V V++LL L  +  
Sbjct: 7   VGEWADVVVNYILDHFTPALDMIAATIGFVTDSIQNALLAVPPVGGVAVLALLSLW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              A+ TA+ L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAIFTALALGLIIHMDLWTGTMESLSLVLASTVIAVVIGIPLGIAMARSDTIASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 VLDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHSEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTSRQLLFKVQLPNAMPSIMAGINQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|257462370|ref|ZP_05626784.1| glycine betaine/proline ABC transporter, permease/substrate-binding
           protein [Fusobacterium sp. D12]
 gi|317060035|ref|ZP_07924520.1| glycine betaine/L-proline ABC transporter [Fusobacterium sp. D12]
 gi|313685711|gb|EFS22546.1| glycine betaine/L-proline ABC transporter [Fusobacterium sp. D12]
          Length = 329

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 104/275 (37%), Positives = 169/275 (61%), Gaps = 1/275 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   ++  +P+  +++     +T++ + F + +       +NL+  +L + PPLV + ++
Sbjct: 1   MFNFLEQRLPVAKWVEISVAWMTESFQDFFSFVQKYAENIMNLMKEILLFFPPLVLIILL 60

Query: 61  SLLV-LMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           + +   + K+     +   +GLL I  QG W E   TL LV +S+ +S+ IG+PLG+L+A
Sbjct: 61  TGVAIFLWKKKWKYPLLVFLGLLFIYNQGLWSELMNTLVLVGMSSLLSILIGIPLGILSA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
              +   I++  LD MQT+P+FVYLIPA+  FG+G+VPG+ A+I+FS+P +VR+T LGI 
Sbjct: 121 KSDQVEGILKPILDFMQTMPSFVYLIPAVAFFGIGIVPGVFASIIFSLPPTVRMTNLGIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L E + +FG T  Q    +E P A   I+A + Q+IML+LSMVV  +++G+ GLG
Sbjct: 181 QIPEELIEVSKSFGTTKMQQLCGIEFPLAKNTILAGINQSIMLALSMVVTASMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSI 274
             VL AL   ++G+GF +G  +VILAI++DR    
Sbjct: 241 RGVLEALQRAEVGKGFVNGFALVILAIVIDRFTQR 275


>gi|196032371|ref|ZP_03099785.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus W]
 gi|195995122|gb|EDX59076.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus W]
          Length = 278

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIILLCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|23502444|ref|NP_698571.1| glycine betaine/L-proline ABC transporter permease [Brucella suis
           1330]
 gi|161619521|ref|YP_001593408.1| binding-protein-dependent transport systems inner membrane
           component [Brucella canis ATCC 23365]
 gi|254704827|ref|ZP_05166655.1| binding-protein-dependent transport systems inner membrane
           component [Brucella suis bv. 3 str. 686]
 gi|260565930|ref|ZP_05836400.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 4 str. 40]
 gi|261755523|ref|ZP_05999232.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 3 str. 686]
 gi|23348434|gb|AAN30486.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Brucella suis 1330]
 gi|161336332|gb|ABX62637.1| binding-protein-dependent transport systems inner membrane
           component [Brucella canis ATCC 23365]
 gi|260155448|gb|EEW90528.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 4 str. 40]
 gi|261745276|gb|EEY33202.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 3 str. 686]
          Length = 278

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 137/278 (49%), Positives = 198/278 (71%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDDLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|332885227|gb|EGK05478.1| hypothetical protein HMPREF9456_02679 [Dysgonomonas mossii DSM
           22836]
          Length = 293

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 117/286 (40%), Positives = 178/286 (62%), Gaps = 15/286 (5%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
             + +G Y++ F   L+     F   ++ ++  +V+++  +L Y+P  + + VV+L+  +
Sbjct: 2   NKLDIGKYIERFVDWLSDTAAPFFRQITIMIDNSVDVLQELLGYVPFYMIIAVVALIAFI 61

Query: 67  VKRS---------------ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIG 111
           +K+                I   +   +GLLLI   G+W++T +T  LVLV+T I + IG
Sbjct: 62  IKKKSLGNDKAWQGNITTLIGFPLFCVLGLLLIYWMGFWEQTMDTFILVLVATLIVLTIG 121

Query: 112 VPLGVLAAWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSV 171
           +PLG+  A+  R Y+IIR  LD MQT+P FVYLIPA++ F +G VPG++AT++FS+P +V
Sbjct: 122 IPLGIWCAYNKRAYAIIRPLLDFMQTMPAFVYLIPAILFFSVGNVPGVLATVIFSLPPAV 181

Query: 172 RLTRLGIISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTA 231
           R+T LGI S P  + EA+ AFG T  Q   KV++P A+  I+A + Q IMLSLSMVV+ +
Sbjct: 182 RMTALGIKSVPKEVVEASVAFGCTRRQTLFKVQMPLAMTTILAGINQVIMLSLSMVVIAS 241

Query: 232 LVGSNGLGVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +VG+ GLG  V   +   D+  GFE+GLCIVILAIILDR+  +   
Sbjct: 242 MVGAGGLGESVYAGIQQADVALGFEAGLCIVILAIILDRMTQLLGK 287


>gi|148259997|ref|YP_001234124.1| binding-protein-dependent transport systems inner membrane
           component [Acidiphilium cryptum JF-5]
 gi|326403047|ref|YP_004283128.1| putative ABC transporter permease [Acidiphilium multivorum AIU301]
 gi|146401678|gb|ABQ30205.1| binding-protein-dependent transport systems inner membrane
           component [Acidiphilium cryptum JF-5]
 gi|325049908|dbj|BAJ80246.1| putative ABC transporter permease protein [Acidiphilium multivorum
           AIU301]
          Length = 286

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 138/271 (50%), Positives = 183/271 (67%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            I+   IPLG +       L  N + F N+LS +L   ++     L ++ PL+ + + + 
Sbjct: 10  WIVHHVIPLGAWATAAIDALKNNFQGFFNVLSDVLGFLLDNTTGALNWVSPLILIVIFAG 69

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           L    K+S  +A+   + L  ++ QGYW  T ETLSLV  +T   M IGVPLGV AA +P
Sbjct: 70  LTWYFKKSWKLALFVLIALTFVLNQGYWGRTIETLSLVAYATLACMLIGVPLGVAAAHHP 129

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
             Y I+R  LD MQT+PTFVYLIP LVLFGLG VPG+++T+VF +PT VRLT +GI++ P
Sbjct: 130 TLYRILRPVLDLMQTLPTFVYLIPTLVLFGLGSVPGLISTVVFVVPTPVRLTYVGIVNVP 189

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L EA  AFGA+P+++  KVE+P A+P I+A LTQ IMLSLSMVV+ ALVG+ GLG PV
Sbjct: 190 RPLIEAGQAFGASPWELLWKVEIPAAMPTILAGLTQVIMLSLSMVVIAALVGAGGLGEPV 249

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           + A+ TV IGRGF SGL IVI+A+ILDR+F 
Sbjct: 250 VEAMETVQIGRGFTSGLAIVIVAVILDRVFR 280


>gi|153808445|ref|ZP_01961113.1| hypothetical protein BACCAC_02739 [Bacteroides caccae ATCC 43185]
 gi|149128767|gb|EDM19984.1| hypothetical protein BACCAC_02739 [Bacteroides caccae ATCC 43185]
          Length = 275

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 114/271 (42%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     VL  +P  + +  +++   M  
Sbjct: 2   INIGQYIESAINWMMVHFSTFFDAVNSGIGSFIIGFQHVLFGIPFYITILALAVAAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T +GLLLI   G+W+ T +TL+LVL ST +++ +GVPLG+  A  PR   I+
Sbjct: 62  GR-GTAIFTVLGLLLIYGMGFWEATMQTLALVLSSTCLALVVGVPLGIWTANSPRADKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGAVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|319942970|ref|ZP_08017253.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Lautropia mirabilis ATCC 51599]
 gi|319743512|gb|EFV95916.1| amino acid ABC superfamily ATP binding cassette transporter,
           binding protein [Lautropia mirabilis ATCC 51599]
          Length = 647

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 99/269 (36%), Positives = 152/269 (56%), Gaps = 1/269 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSF-ILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKR 69
           + D+L +    L  N        S  +L   +  +   L  +PP + + +++ L      
Sbjct: 376 VADWLNDSLARLVSNHGETFRAFSQSLLHGLLLPLERALAAVPPWLLLALLAGLAWHATG 435

Query: 70  SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIR 129
           S+  A  +A G  LI   G W    +TL+L++ +    + IG PLG+L A     +  + 
Sbjct: 436 SLGSAAFSAAGFYLIGGLGLWTPLLQTLALLVAAFLFILVIGFPLGILMARSRWLHRWLS 495

Query: 130 LFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAA 189
             LD +QT+P+FVYLIP L+LFG+G +P + AT+V++    VRLT LGI      + E+A
Sbjct: 496 PVLDIIQTMPSFVYLIPVLMLFGIGRIPALFATVVYATAPLVRLTALGIREVDARMVESA 555

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
            +FG T  Q+   V LP A P I+A + Q +M+SL MVVV +++G+ GLG  VL+A+ T+
Sbjct: 556 ESFGCTRTQLLFWVLLPQARPAILAGINQAVMMSLGMVVVASMIGARGLGENVLQAIQTL 615

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPDPR 278
           DIGRG ++G  IVILAI++DR+      R
Sbjct: 616 DIGRGVQAGAAIVILAIVIDRITQAYGRR 644


>gi|262198632|ref|YP_003269841.1| binding-protein-dependent transporters inner membrane component
           [Haliangium ochraceum DSM 14365]
 gi|262081979|gb|ACY17948.1| binding-protein-dependent transport systems inner membrane
           component [Haliangium ochraceum DSM 14365]
          Length = 281

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 114/267 (42%), Positives = 167/267 (62%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +GD+ +     L +N E   + +   +   V++    L   P  V V V +L+   +   
Sbjct: 6   VGDFFENIIEWLRENFEGVFDAIGAAITTGVDVFKAGLHLPPSWVLVLVFALIAWRMSG- 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           I + + T +G+LLI   G W  T +TL+LV+ S  I++ I VP+G+ A+       ++R 
Sbjct: 65  IGMGIFTLLGMLLIDSMGLWAPTMDTLALVIASVVIALLISVPIGIWASKSDTAAHVVRP 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA++ F LG VPG++AT++F++P +VRLT LGI   P  +KEAA 
Sbjct: 125 VLDFMQTLPAFVYLIPAVLFFQLGEVPGVIATLIFAMPPAVRLTNLGIRQVPKDIKEAAV 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           +FG+TP Q+  K ELP A+P I+A + QTIML+LSMVV+T ++G+ GLG  VL+ +  + 
Sbjct: 185 SFGSTPSQMLFKAELPVAMPTILAGVNQTIMLALSMVVITGMIGAGGLGNQVLKGITQLQ 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           IG GFESG+ IVILAI LDR+      
Sbjct: 245 IGLGFESGIAIVILAIFLDRITQSLGQ 271


>gi|226309964|ref|YP_002769858.1| glycine betaine ABC transporter permease protein [Brevibacillus
           brevis NBRC 100599]
 gi|226092912|dbj|BAH41354.1| probable glycine betaine ABC transporter permease protein
           [Brevibacillus brevis NBRC 100599]
          Length = 279

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 121/273 (44%), Positives = 177/273 (64%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+G +++ F   L Q      + ++ ++   V     VL  +P L+ + ++     + 
Sbjct: 6   KLPIGGWMEGFVEVLGQYKGVLFDPVAIVISTMVTYCSTVLAEIPSLILILLLGAAAWVF 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
               ++ V T +GL LI   GYW ET ETL LVL +T IS+ IG+P+G+L A +  F ++
Sbjct: 66  AGRASM-VFTVVGLSLIHNLGYWDETMETLGLVLTATMISIAIGIPVGILCARHDTFRNL 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  FGLG VPG++A+++F++P  VRLT LGI   P  ++E
Sbjct: 125 VTPILDLMQTMPAFVYLIPAIFFFGLGEVPGVIASVIFALPPIVRLTNLGIRQVPAEMEE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGAT +Q   KV+LP+A   I+A + Q IML+LSMVV+ A++G+ GLG  V RA++
Sbjct: 185 AADAFGATGWQKLVKVQLPYAKSTILAGVNQCIMLALSMVVIAAMIGAKGLGADVYRAVS 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            VDIGRGFE+GL IVI+AI+LDRL      ++R
Sbjct: 245 QVDIGRGFEAGLSIVIIAIVLDRLTQHAGKKER 277


>gi|163940536|ref|YP_001645420.1| binding-protein-dependent transport systems inner membrane
           component [Bacillus weihenstephanensis KBAB4]
 gi|163862733|gb|ABY43792.1| binding-protein-dependent transport systems inner membrane
           component [Bacillus weihenstephanensis KBAB4]
          Length = 278

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 182/280 (65%), Gaps = 2/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG+++  F   L ++ E      S+I+   V+L+   L  +P +V + ++
Sbjct: 1   MNNI--PRIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAIVMIIIL 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L+    R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ IG+P+G+LA+ 
Sbjct: 59  CFLIWYTTRKLSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIIGIPIGILASQ 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF   ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI  
Sbjct: 119 NERFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQ 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV
Sbjct: 179 VPEDLIEAANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGV 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V R++  V+IG GFE+GL IV++AIILDR+      + +
Sbjct: 239 DVYRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFYTKRK 278


>gi|77456591|ref|YP_346096.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77380594|gb|ABA72107.1| putative histidine ABC transport system, membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 283

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 161/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V ++    
Sbjct: 7   TFSIADWVNGWVDALVTNYGDVFRHISDTLLWAIVNLEGLLRAAPWWLMLAIVGVVAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +         L L+   G W +  +TL+L++V+T IS+ IGVPLG+L+A   R  S+
Sbjct: 67  TRKVVTTAVIVGLLFLVGAVGLWDKLMQTLALMMVATVISVLIGVPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|299822937|ref|ZP_07054823.1| glycine betaine/proline ABC superfamily ATP binding cassette
           transporter [Listeria grayi DSM 20601]
 gi|299816466|gb|EFI83704.1| glycine betaine/proline ABC superfamily ATP binding cassette
           transporter [Listeria grayi DSM 20601]
          Length = 287

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 108/278 (38%), Positives = 171/278 (61%), Gaps = 1/278 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
            +   IP+ + ++     +T N   F +    I    ++ + ++L  +PPLVF+ ++++L
Sbjct: 5   FVLGKIPVAESVENLTDWMTTNFASFFDFFQTIGQGLMDNITYLLGLIPPLVFILILAVL 64

Query: 64  VLMVK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
              +  + I +     +GLL I  Q  W     T++LV+VS+ +++ IGVP+GV  +   
Sbjct: 65  AFFISGKKIGLTAFVIIGLLFIRDQELWDALVNTITLVIVSSLVAIIIGVPVGVWMSKSK 124

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
              SII+  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR T LGI   P
Sbjct: 125 IAESIIKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRFTNLGIRQVP 184

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L EA+ ++G T +Q   KVELP A   I+A + QT+ML+LSMVV+ +++G+ GLG  V
Sbjct: 185 VELVEASDSYGTTGWQKLIKVELPIAKSTIMAGINQTVMLALSMVVIASMIGAPGLGRQV 244

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           L+AL    +G GF +G+ +VILAII+DR     + R R
Sbjct: 245 LQALQRAQVGNGFVAGVSLVILAIIMDRFTQYFNTRKR 282


>gi|52080989|ref|YP_079780.1| glycine betaine ABC transporter permease [Bacillus licheniformis
           ATCC 14580]
 gi|52786365|ref|YP_092194.1| OpuAB [Bacillus licheniformis ATCC 14580]
 gi|319645053|ref|ZP_07999286.1| OpuAB protein [Bacillus sp. BT1B_CT2]
 gi|52004200|gb|AAU24142.1| glycine betaine ABC transporter (permease) [Bacillus licheniformis
           ATCC 14580]
 gi|52348867|gb|AAU41501.1| OpuAB [Bacillus licheniformis ATCC 14580]
 gi|317392862|gb|EFV73656.1| OpuAB protein [Bacillus sp. BT1B_CT2]
          Length = 284

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 105/266 (39%), Positives = 167/266 (62%), Gaps = 1/266 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D++ +F   LT +     N ++  +   V+ ++  L ++PP++   + + LV ++
Sbjct: 9   RIPLADWIDQFVDWLTVSFGGVFNGIASGVESFVDEIVQGLGFVPPVMLTVIFAALVWLI 68

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +   IA+ T +G  +I   GYW    +TL+LV+ S  IS+ IG+P+G+  +       +
Sbjct: 69  SKR-GIALFTLIGFFIIDYLGYWDAMLQTLALVVTSVLISVIIGIPVGIWGSQKKTVRRV 127

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 128 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTILGIQQVPEDLIE 187

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ ++VG+ GLG  V RA+ 
Sbjct: 188 ATEAFGSTTSQRLFKVQLPLATKTILAGINQSIMLALSMVVIASMVGAPGLGEEVYRAVT 247

Query: 248 TVDIGRGFESGLCIVILAIILDRLFS 273
            +  G G E+GL IVI+AI+LDR+  
Sbjct: 248 QLQTGTGVETGLAIVIIAIVLDRVTQ 273


>gi|119384635|ref|YP_915691.1| binding-protein-dependent transport systems inner membrane
           component [Paracoccus denitrificans PD1222]
 gi|119374402|gb|ABL69995.1| binding-protein-dependent transport systems inner membrane
           component [Paracoccus denitrificans PD1222]
          Length = 283

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 137/274 (50%), Positives = 183/274 (66%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           +    IP+G   +  F  L  N     N +S ++   +  +L +L +  PLVF  +   L
Sbjct: 8   LTDTKIPVGRTAKAIFDWLNANAAVVFNFISKMMDGLIGGILKMLVFPHPLVFTLLAVAL 67

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              ++RS    +  A+G L I+ QGYW  T ++L+LVL +  + M IGVPLG+ AA  PR
Sbjct: 68  TWALQRSWKTCLLVALGFLFILNQGYWDATMQSLTLVLSACVVCMAIGVPLGIAAAHRPR 127

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI STP 
Sbjct: 128 LYAWMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTHLGISSTPK 187

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA AFGATP Q+  KVELP A  QI+A L QTIMLSLSMVV+ ALVG++GLGVPV+
Sbjct: 188 ALVEAAIAFGATPRQLLWKVELPSATSQIMAGLNQTIMLSLSMVVIAALVGASGLGVPVV 247

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           RALN+V+   GFESG  IV++AI+LDR+  +   
Sbjct: 248 RALNSVNTALGFESGFIIVVVAIMLDRMLRVRGR 281


>gi|104781701|ref|YP_608199.1| glycine betaine ABC transporter permease [Pseudomonas entomophila
           L48]
 gi|95110688|emb|CAK15401.1| putative glycine betaine ABC transporter, permease protein
           [Pseudomonas entomophila L48]
          Length = 283

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 158/270 (58%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIADWVNGWVDALVTNYGDVFRHISDTLLWAIVNLEGLLRATPWWLMLAIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R           L L+   G W +  +TL+L+LV+T IS+ +G+PLG+L+A   R  ++
Sbjct: 67  TRRAVPTAVIVGLLFLVGAVGLWDKLMQTLALMLVATLISVLVGIPLGILSARNDRLRAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA   Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRLQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|254689762|ref|ZP_05153016.1| choline ABC transporter, permease protein [Brucella abortus bv. 6
           str. 870]
 gi|256258014|ref|ZP_05463550.1| choline ABC transporter, permease protein [Brucella abortus bv. 9
           str. C68]
 gi|260755294|ref|ZP_05867642.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 6 str. 870]
 gi|260884309|ref|ZP_05895923.1| glycine betaine/L-proline ABC transporter permease [Brucella
           abortus bv. 9 str. C68]
 gi|297248846|ref|ZP_06932564.1| choline ABC transporter, permease [Brucella abortus bv. 5 str.
           B3196]
 gi|260675402|gb|EEX62223.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 6 str. 870]
 gi|260873837|gb|EEX80906.1| glycine betaine/L-proline ABC transporter permease [Brucella
           abortus bv. 9 str. C68]
 gi|297176015|gb|EFH35362.1| choline ABC transporter, permease [Brucella abortus bv. 5 str.
           B3196]
          Length = 278

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 135/278 (48%), Positives = 196/278 (70%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMV G++AT++F IP  +RLT+L I S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVLGLLATVIFVIPAPIRLTQLSISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|333029180|ref|ZP_08457241.1| binding-protein-dependent transport systems inner membrane
           component [Bacteroides coprosuis DSM 18011]
 gi|332739777|gb|EGJ70259.1| binding-protein-dependent transport systems inner membrane
           component [Bacteroides coprosuis DSM 18011]
          Length = 281

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 118/269 (43%), Positives = 172/269 (63%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            I +G Y++     LT+N   F + L+  +   ++ +  +L  +P  + + V+++L    
Sbjct: 4   RINIGKYIEIAINWLTENFASFFDALNTGIGGFIDGLQTILNSIPFWITIIVMAILAWKK 63

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                +A+ + +GLLLI   G+W+ T ETL+LVL STFI++ IGVPLGV  A+  R   I
Sbjct: 64  AGK-GVALFSVLGLLLIWGMGFWEPTMETLALVLSSTFIALLIGVPLGVWTAYSDRCDKI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + E
Sbjct: 123 LRPVLDFMQTMPAFVYLIPAVLFFGLGPVPGAFATVIFAMPPVVRLTGLGIRQVPKNIVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  + GAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ + 
Sbjct: 183 ATTSLGATRWQLLFKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGIT 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            + IG GFE G+ +VILAIILDR+     
Sbjct: 243 QMKIGLGFEGGIAVVILAIILDRITQGIA 271


>gi|8650112|gb|AAF78098.1|AF111939_2 inner membrane protein [Sinorhizobium meliloti]
          Length = 285

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 166/269 (61%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           + +   + +F   L  N  W    +S ++LKAV  + ++L+ LP  + +     L     
Sbjct: 8   LSIRAPVNDFIQALVTNYGWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALACRSS 67

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
           R  ++ +     L  +   G W  T +TL+L+L++T +S+ IGVP+G+L A      +I 
Sbjct: 68  RRWSLTLAVCALLETVGVLGIWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNIT 127

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P+FVYLIPAL+LFGLG VP I+ATI++++P  +RLT LGI      + EA
Sbjct: 128 LPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEA 187

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A AFG +P Q+   VELP A P I+A L QTIM++LSMVVV +++G+ GLG  VL  + T
Sbjct: 188 ATAFGGSPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQT 247

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +D+G+G E+G+ IVILA++LDR+      
Sbjct: 248 LDVGKGLEAGIGIVILAVVLDRITQGFGK 276


>gi|92114025|ref|YP_573953.1| binding-protein-dependent transport systems inner membrane
           component [Chromohalobacter salexigens DSM 3043]
 gi|91797115|gb|ABE59254.1| binding-protein-dependent transport systems inner membrane
           component [Chromohalobacter salexigens DSM 3043]
          Length = 276

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 117/275 (42%), Positives = 173/275 (62%), Gaps = 1/275 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    IPLGD ++     LT N       +S +    ++ +   L +LP    + +++L+
Sbjct: 3   IDIPRIPLGDSIEGGLDFLTTNYSVVTRGISRVTQTGISALNDALMWLPEWGLMAIIALI 62

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              V  S+ +A+G+ +GL LI   G W    ETL+LV+++TF+++ I +P GV AA   R
Sbjct: 63  CWRVA-SVRLAIGSVLGLALIWNLGLWDPMIETLTLVVIATFVAVIIALPFGVFAALSDR 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           FYS+I   LD MQT+P FVYLIPA+  FG+G V  I AT++FS+P ++R T LGI   P 
Sbjct: 122 FYSLIMPVLDFMQTMPAFVYLIPAIPFFGIGSVSAIFATVIFSMPPAIRFTTLGIRQVPK 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA AFGAT  Q   K++LP ++P I+A + QTIML+LSMVV+ A++G++GLG  V 
Sbjct: 182 DLIEAADAFGATRSQKLIKIQLPLSLPTIMAGINQTIMLALSMVVIAAMIGADGLGSEVW 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           RA+  +  G GFE+G+ +VILA++LDR+      +
Sbjct: 242 RAIQRLRPGDGFEAGIAVVILAMLLDRITQAVRKK 276


>gi|47569049|ref|ZP_00239739.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Bacillus
           cereus G9241]
 gi|47554318|gb|EAL12679.1| glycine betaine/L-proline ABC transporter, glycine
           betaine/L-proline-binding/permease protein [Bacillus
           cereus G9241]
          Length = 278

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 120/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TLSLVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLSLVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|325293639|ref|YP_004279503.1| proline/glycine/betaine ABC transporter transmembrane protein
           [Agrobacterium sp. H13-3]
 gi|325061492|gb|ADY65183.1| proline/glycine/betaine ABC transporter, membrane spanning protein
           [Agrobacterium sp. H13-3]
          Length = 283

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 173/278 (62%), Positives = 212/278 (76%), Gaps = 2/278 (0%)

Query: 1   MSPII--QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVC 58
           M  +   +  +P+G Y +E    LT N  +F + LSFI    +N +L+VLQ   PLV V 
Sbjct: 1   MEWLSAPENRLPVGRYAKEAIDWLTGNLAFFFDWLSFIFQSVINALLYVLQAPHPLVIVA 60

Query: 59  VVSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLA 118
           +V+ L    +RS+ + V TA+GLL II  GYW+ TTETL+LVL S+ + M IG+PLG+LA
Sbjct: 61  IVTALSAWTRRSVGMPVFTALGLLFIINLGYWKATTETLALVLASSAVCMIIGIPLGILA 120

Query: 119 AWYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGI 178
           A     Y+ +R  LD MQTIPTFVYLIPALVLFGLGMVPG++AT++F+IP  VRLTRLGI
Sbjct: 121 ARRKWIYAGMRPVLDLMQTIPTFVYLIPALVLFGLGMVPGLIATVIFAIPAPVRLTRLGI 180

Query: 179 ISTPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGL 238
           +STPP L EAA AFGATP QV RKVELPFA PQI+A LTQTIMLSLSMVV++ALVG+NGL
Sbjct: 181 VSTPPALVEAAIAFGATPSQVLRKVELPFAAPQIMAGLTQTIMLSLSMVVISALVGANGL 240

Query: 239 GVPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPD 276
           GVPV+RALNTV+I  GFE+GLCIVILAI+LDRLF +P 
Sbjct: 241 GVPVVRALNTVNIAMGFEAGLCIVILAIVLDRLFRLPG 278


>gi|152997518|ref|YP_001342353.1| binding-protein-dependent transporter inner membrane component
           [Marinomonas sp. MWYL1]
 gi|150838442|gb|ABR72418.1| binding-protein-dependent transport systems inner membrane
           component [Marinomonas sp. MWYL1]
          Length = 281

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 133/279 (47%), Positives = 185/279 (66%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IPLG +++ F   L      F +++S  L   +  ++  +  L P   + ++
Sbjct: 1   MNWLTDNKIPLGAWMENFVDWLVTAASVFFDLVSITLETMIVTMVDAIDSLHPFAVITII 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
            + V  + RSI + +   + LLLII  GYW ET +TL LV+ +T IS+ IGVP+G+ AA 
Sbjct: 61  LVGVWFLHRSIGLLIFITLSLLLIINMGYWIETIQTLVLVVSATAISVLIGVPIGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQTIPTFVYLIP L+LFGLG VPG+++TI+F+I   +RLT LG+  
Sbjct: 121 RPWLYTTLRPILDLMQTIPTFVYLIPTLILFGLGYVPGLISTIIFAIAAPIRLTYLGVSK 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFG T  ++  KVELP A+P I+A +TQ IMLSLSMVVV ALVG++GLG 
Sbjct: 181 VPNELIEAGLAFGCTKSKLLYKVELPAAMPNIMAGVTQCIMLSLSMVVVAALVGADGLGK 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PV+RALNTV+I +GFE+G+ IV++AI+LDR+   P  R 
Sbjct: 241 PVIRALNTVNISQGFEAGVAIVLVAIMLDRICKSPSSRS 279


>gi|53714621|ref|YP_100613.1| glycine betaine/L-proline transport system permease [Bacteroides
           fragilis YCH46]
 gi|253565126|ref|ZP_04842582.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 3_2_5]
 gi|265765915|ref|ZP_06093956.1| choline ABC transporter, permease [Bacteroides sp. 2_1_16]
 gi|52217486|dbj|BAD50079.1| glycine betaine/L-proline transport system permease [Bacteroides
           fragilis YCH46]
 gi|251946591|gb|EES86968.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 3_2_5]
 gi|263253583|gb|EEZ25048.1| choline ABC transporter, permease [Bacteroides sp. 2_1_16]
 gi|301164117|emb|CBW23673.1| putative glycine betaine transport system permease protein
           [Bacteroides fragilis 638R]
          Length = 274

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 115/271 (42%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + L+  +   +N    +L  +P  + +  + LL    K
Sbjct: 2   INIGQYIETLINWMMIHFSTFFDALNLGIGSFINGFQHILFGIPFYLTIAAMVLLAW-AK 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +AV T +GLLLI   G+W+ T +TL+LVL ST +++ +GVP+GV  A   R   +I
Sbjct: 61  AGRGVAVFTLLGLLLIYGMGFWEATMQTLALVLSSTCLALIVGVPIGVWTANSNRAEKVI 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG+VPG+ ATI+F++P  +RLT LGI   P  + EA
Sbjct: 121 HPILDLMQTMPAFVYLIPAVLFFGLGVVPGVFATIIFAMPPVIRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMVRRK 271


>gi|324326754|gb|ADY22014.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 278

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 118/273 (43%), Positives = 178/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+L +   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILTSQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|237723326|ref|ZP_04553807.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 2_2_4]
 gi|293373152|ref|ZP_06619514.1| ABC transporter, permease protein [Bacteroides ovatus SD CMC 3f]
 gi|298480784|ref|ZP_06998980.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. D22]
 gi|229447848|gb|EEO53639.1| glycine betaine/L-proline transport system permease [Bacteroides
           sp. 2_2_4]
 gi|292631800|gb|EFF50416.1| ABC transporter, permease protein [Bacteroides ovatus SD CMC 3f]
 gi|298273218|gb|EFI14783.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. D22]
          Length = 274

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 117/271 (43%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     VL  +P  + + V++ L  M  
Sbjct: 2   INIGQYIETVINWMMVHFSTFFDAINAGIGSFIIGFQHVLFGIPFYITILVLAALAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA+GLLLI   G+W+ T +TL+LV  ST +++ +GVPLGV  A  PR   I+
Sbjct: 62  GR-GTAIFTALGLLLIYGMGFWEATMQTLALVFSSTCLALIVGVPLGVWTANSPRAEKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGAVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|224824410|ref|ZP_03697518.1| binding-protein-dependent transport systems inner membrane
           component [Lutiella nitroferrum 2002]
 gi|224603829|gb|EEG10004.1| binding-protein-dependent transport systems inner membrane
           component [Lutiella nitroferrum 2002]
          Length = 290

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 110/269 (40%), Positives = 159/269 (59%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           +P+G+++ +F   L  +     +     +      +   L  LPP + +     L +  +
Sbjct: 16  LPIGEWVNQFIHFLLDHNGGAFDAFGRAVDLFAESIEVALLSLPPWLIMGFFIGLGVW-R 74

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A      L LI   G+W +T  TL+L L +T IS+ IG+P G+  A   R  +++
Sbjct: 75  LGWRFAGFVLAALALIFGTGFWPQTVSTLALTLSATLISLMIGIPTGIWCARSKRVNTLV 134

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA + FGLG VPGI+AT+VF++P +VRLT LGI        EA
Sbjct: 135 RPVLDFMQTMPAFVYLIPAAMFFGLGRVPGILATVVFAVPPAVRLTSLGIRQVNKEQVEA 194

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG T  Q+  KV+LP A+P I+A + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 195 GHAFGCTSTQLLFKVQLPIALPAIMAGVNQTIMMALSMVIIASMVGAGGLGNDVLSSIQR 254

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +D+G GFESGL +V+LAIILDRL      
Sbjct: 255 LDVGLGFESGLAVVLLAIILDRLTESFGR 283


>gi|329928981|ref|ZP_08282791.1| glycine betaine transport system permease protein opuAB
           [Paenibacillus sp. HGF5]
 gi|328937233|gb|EGG33660.1| glycine betaine transport system permease protein opuAB
           [Paenibacillus sp. HGF5]
          Length = 277

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 114/273 (41%), Positives = 172/273 (63%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL  ++      +      F + +SFI+   V L   +     P +F+ +++++  ++
Sbjct: 3   KIPLASWVDSLVDWMGDVFSGFFDAISFIIENVVQLFTDLFMLPHPYLFIVILAVIAYLL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   + + TA+G LLI   GYW +T  TLSLV+ +  IS+ +GVPLG+ AA+      +
Sbjct: 63  GRLP-LTLFTAIGFLLIDNLGYWSQTMSTLSLVITAALISVILGVPLGIWAAYSKSASRV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYL+PA+  F LG+VPG++A+++F+IP ++RLTRLGI      L E
Sbjct: 122 IIPVLDFMQTMPAFVYLLPAVTFFSLGVVPGVIASVIFAIPPTIRLTRLGINQVSGELTE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A+P ++A + QTIMLSLSMVV+ +++G+ G+G  V RA+ 
Sbjct: 182 AADAFGSTSGQKLFKVQLPLAMPTLMAGINQTIMLSLSMVVIASMIGAQGIGAEVYRAVT 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            + IG+GFE+GL +VILAI+LDR         +
Sbjct: 242 QLQIGKGFEAGLAVVILAIVLDRFTQNIFKSKK 274


>gi|300775527|ref|ZP_07085388.1| glycine betaine ABC superfamily ATP binding cassette transporter,
           membrane protein [Chryseobacterium gleum ATCC 35910]
 gi|300505554|gb|EFK36691.1| glycine betaine ABC superfamily ATP binding cassette transporter,
           membrane protein [Chryseobacterium gleum ATCC 35910]
          Length = 275

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 124/276 (44%), Positives = 173/276 (62%), Gaps = 1/276 (0%)

Query: 5   IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLV 64
           +   I +G Y++     LT+NG+   +++  +   ++  + +VL   P  V +   +LL 
Sbjct: 1   MNKTIDIGQYVETAINWLTENGKPVFDVIKHLGNASIMGIEWVLTNTPFYVIILFFTLLA 60

Query: 65  LMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
           L       IAV TA GL LI   G W+ET ETL+L+ VST  ++ + +PLG+LAA     
Sbjct: 61  LWKAGKA-IAVVTAAGLSLIFLMGLWKETMETLALIFVSTITALILSIPLGILAAKSKIA 119

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
             IIR  LD MQT+P FVYLIPA++ F +G VPG  ATI+F++P +VRLT LGI + P  
Sbjct: 120 DKIIRPLLDLMQTMPAFVYLIPAVLFFSIGKVPGAFATIIFAMPPAVRLTALGIEAVPKD 179

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           + EAA AFGAT  Q+  KVELP A+  I+  + QTI+LSLSMVV+  ++ + GLG  VL 
Sbjct: 180 IVEAARAFGATGRQILFKVELPLAMKTILTGINQTILLSLSMVVIAGMIAAGGLGEKVLE 239

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +N +DIG GFESGL +VILAIILDR+      + +
Sbjct: 240 GINNLDIGLGFESGLSVVILAIILDRITQGFVKKKQ 275


>gi|196041697|ref|ZP_03108988.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus NVH0597-99]
 gi|196027466|gb|EDX66082.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus NVH0597-99]
          Length = 278

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLIIIPAVLMIILLCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|330807064|ref|YP_004351526.1| ABC transporter permease [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375172|gb|AEA66522.1| Putative ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 283

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIADWVNGWVDSLVTNYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLAIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +         L L+   G W +  +TL+L+LV+T IS+ IG+PLG+L+A   R  S+
Sbjct: 67  TRKVVATAVIVGLLFLVGAVGLWDKLMQTLALMLVATLISVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|94265174|ref|ZP_01288937.1| Binding-protein-dependent transport systems inner membrane
           component [delta proteobacterium MLMS-1]
 gi|93454362|gb|EAT04666.1| Binding-protein-dependent transport systems inner membrane
           component [delta proteobacterium MLMS-1]
          Length = 277

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 114/272 (41%), Positives = 161/272 (59%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IP+GD+++     +  N E   + ++++L    N     LQ +P  +   ++  L    +
Sbjct: 7   IPVGDWIELGVDWILDNLEPLLDGIAWVLGLLTNSFASGLQAIPVWLLFLILVGLCWW-R 65

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
            S   A+   + L LI+    W ETT TLSLVL S   ++ IG+P+GV  +      +II
Sbjct: 66  VSWRFAIFAILALGLIMGMDLWTETTNTLSLVLASALAALIIGLPVGVAMSRSDTVEAII 125

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA + FGLG VPG +AT+VF +P  VRLT LGI        EA
Sbjct: 126 RPLLDLMQTMPPFVYLIPAAIFFGLGTVPGAIATVVFCMPPVVRLTNLGIRQVNREQIEA 185

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG    Q+  K++LP A+P I+A + QTIML+LSMVV+ +++G+ GLG  VL  +  
Sbjct: 186 GLAFGCNRRQLLTKIQLPLALPSIMAGVNQTIMLALSMVVIASMIGAGGLGNTVLTGIQR 245

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +D+G GFE GL +VILAI+LDR+      R R
Sbjct: 246 LDVGLGFEGGLGVVILAILLDRITQSLGIRRR 277


>gi|94269123|ref|ZP_01291376.1| Binding-protein-dependent transport systems inner membrane
           component [delta proteobacterium MLMS-1]
 gi|93451338|gb|EAT02210.1| Binding-protein-dependent transport systems inner membrane
           component [delta proteobacterium MLMS-1]
          Length = 277

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 114/272 (41%), Positives = 161/272 (59%), Gaps = 1/272 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IP+GD+++     +  N E   + ++++L    N     LQ +P  +   ++  L    +
Sbjct: 7   IPVGDWIELGVDWILDNLEPLLDGIAWVLGLLTNSFASGLQAIPVWLLFLILVGLCWW-R 65

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
            S   A+   + L LI+    W ETT TLSLVL S   ++ IG+P+GV  +      +II
Sbjct: 66  VSWRFAIFAILALGLIMGMDLWTETTNTLSLVLASALAALIIGLPVGVAMSRSDTVEAII 125

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA + FGLG VPG +AT+VF +P  VRLT LGI        EA
Sbjct: 126 RPLLDLMQTMPPFVYLIPAAIFFGLGTVPGAIATVVFCMPPVVRLTNLGIRQVNREQIEA 185

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG    Q+  K++LP A+P I+A + QTIML+LSMVV+ +++G+ GLG  VL  +  
Sbjct: 186 GLAFGCNRRQLLTKIQLPLALPSIMAGVNQTIMLALSMVVIASMIGAGGLGNTVLTGIQR 245

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +D+G GFE GL +VILAI+LDR+      R R
Sbjct: 246 LDVGLGFEGGLGVVILAILLDRITQSLGMRRR 277


>gi|206973541|ref|ZP_03234459.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus H3081.97]
 gi|222096288|ref|YP_002530345.1| glycine betaine/l-proline ABC transporter , permease [Bacillus
           cereus Q1]
 gi|206747697|gb|EDZ59086.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus H3081.97]
 gi|221240346|gb|ACM13056.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           cereus Q1]
          Length = 278

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|325846755|ref|ZP_08169670.1| glycine betaine transport system permease protein opuAB
           [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325481513|gb|EGC84554.1| glycine betaine transport system permease protein opuAB
           [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 280

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 170/280 (60%), Gaps = 3/280 (1%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPL  ++      L  +  +  N +   +   V L + +    PPL+F+ +V
Sbjct: 1   MNNIPS--IPLVGFIDNLVEWLRLHASFIFNPIRDFINFTVELFIKIFSVFPPLLFIILV 58

Query: 61  SLLVLMVKRSIT-IAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           + L   + + I  I + + + LLLI    YW +   TLS+V+ S  +++ IG+PLG+  +
Sbjct: 59  AALAYYLTKKIKGITIFSILSLLLIWNLDYWDDMVITLSIVVTSALLAIIIGIPLGIWTS 118

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  +I   LD MQT+P FVYLIPA+  FG+GM PG++++++F++P +VR+T LGI 
Sbjct: 119 KSESVEKVIMPLLDFMQTMPAFVYLIPAVSFFGIGMAPGVISSVIFAMPPAVRMTNLGIK 178

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EAA +FG+TP Q   ++ELP A P I+A + QT+ML+LSMVVV +++G+ GLG
Sbjct: 179 EVPSDLVEAADSFGSTPKQKLFELELPMAKPSIMAGINQTLMLTLSMVVVASMIGAPGLG 238

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
             +  +++  D+G GF SG+ IVILA+ILDRL      ++
Sbjct: 239 NVIYTSVSRNDVGVGFASGIAIVILAVILDRLTQALSKKN 278


>gi|186472306|ref|YP_001859648.1| choline ABC transporter, permease protein [Burkholderia phymatum
           STM815]
 gi|184194638|gb|ACC72602.1| choline ABC transporter, permease protein [Burkholderia phymatum
           STM815]
          Length = 301

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 110/269 (40%), Positives = 161/269 (59%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     ++   LQ +P    + +   + L  +
Sbjct: 5   IPLGRWVDQSVHYLLDHDASTFDSIGKAIESFAAMIEHGLQAVPMWALMALFIAVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+     LLLI   G+W +T  TL L L ST IS+  G+PLG+ AA       ++
Sbjct: 64  VGWRFAIFATASLLLIYATGFWDQTVITLGLTLSSTLISLVFGIPLGIWAAKNKHVQMVV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|308172161|ref|YP_003918866.1| glycine betaine ABC transporter permease [Bacillus
           amyloliquefaciens DSM 7]
 gi|307605025|emb|CBI41396.1| glycine betaine ABC transporter (permease) [Bacillus
           amyloliquefaciens DSM 7]
          Length = 282

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 111/273 (40%), Positives = 164/273 (60%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D +  F   LT     F + +S  L   VN ++  L Y+P ++   + + L   +
Sbjct: 6   RIPLADIVDRFVDWLTMTFGGFFDGISNGLAAFVNAIVSGLGYIPSILLTVIFAALAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G L+I   GYW    +TL+LV+ S  IS+ IGVP+GV A+       I
Sbjct: 66  S-TKGIALFTLIGFLVIDYLGYWSPMLQTLALVVTSVLISIIIGVPIGVWASQKETVRRI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTSQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G G E+G+ IVI+AI LDR+      + +
Sbjct: 245 QLKTGVGVEAGIAIVIVAITLDRITQNIKVKKK 277


>gi|157691067|ref|YP_001485529.1| glycine betaine ABC transporter membrane protein [Bacillus pumilus
           SAFR-032]
 gi|157679825|gb|ABV60969.1| glycine betaine ABC superfamily ATP binding cassette transporter,
           membrane protein [Bacillus pumilus SAFR-032]
          Length = 281

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 110/272 (40%), Positives = 165/272 (60%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP  DY+ +F   LT     F + ++  L   VN ++  L  +P ++   + + +   +
Sbjct: 6   RIPFADYIDQFVDWLTLTFGGFFDGITNGLAGTVNGIVAALGVIPSIILTLIFAGIAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  +A+ T +G LLI   GYW    +TL+LVL +  IS+ IGVP+G+ A+       I
Sbjct: 66  S-TRGVALFTLIGFLLIDYLGYWHPMLQTLALVLTAVVISIVIGVPIGIWASQKETVRKI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++FS+P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFSMPPTIRMTILGIKQVPSDLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T FQ   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTFQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            +  G GFE+G+ IVI+AI LDR+      + 
Sbjct: 245 QLKTGIGFEAGIAIVIVAITLDRITQNIKTKK 276


>gi|118478145|ref|YP_895296.1| glycine betaine/L-proline ABC transporter permease [Bacillus
           thuringiensis str. Al Hakam]
 gi|118417370|gb|ABK85789.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           thuringiensis str. Al Hakam]
          Length = 278

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 182/280 (65%), Gaps = 2/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++
Sbjct: 1   MNNI--PRIPLGEWVDSFVASLYEHLEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIIL 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L+    R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+ 
Sbjct: 59  CFLIWYTTRKVSLIIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQ 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF   ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI  
Sbjct: 119 NERFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQ 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV
Sbjct: 179 VPEDLIEAANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGV 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V R++  V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 239 DVYRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|70733908|ref|YP_257548.1| ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68348207|gb|AAY95813.1| probable permease of ABC transporter PA5095 [Pseudomonas
           fluorescens Pf-5]
          Length = 283

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 103/270 (38%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  +       +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIADWVNGWVDALVTHYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLAIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +         L L+   G W +  +TL+L+LV+T IS+ IG+PLG+L+A   R  S+
Sbjct: 67  TRKLLTTAVIVGLLFLVGAVGLWDKLMQTLALMLVATLISVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|255010825|ref|ZP_05282951.1| glycine betaine/L-proline transport system permease [Bacteroides
           fragilis 3_1_12]
 gi|313148627|ref|ZP_07810820.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313137394|gb|EFR54754.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 274

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 116/271 (42%), Positives = 171/271 (63%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++E    +  +   F + L+  +   +N    +L  +P  + +  + LL  M  
Sbjct: 2   INIGQYIEELINWMMIHFSAFFDALNLGIGSFINGFQHILFGIPFYLTIAAMVLLAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +AV T +GLLLI   G+W+ T +TL+LVL ST +++ +GVP+GV  A   R   +I
Sbjct: 62  GR-GVAVFTLLGLLLIYGMGFWEATMQTLALVLSSTCLALIVGVPIGVWTANSNRAEKVI 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG+VPG+ ATI+F++P  +RLT LGI   P  + EA
Sbjct: 121 HPILDLMQTMPAFVYLIPAVLFFGLGVVPGVFATIIFAMPPVIRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMVRRK 271


>gi|288574363|ref|ZP_06392720.1| binding-protein-dependent transport systems inner membrane
           component [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570104|gb|EFC91661.1| binding-protein-dependent transport systems inner membrane
           component [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 283

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 106/268 (39%), Positives = 166/268 (61%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +  Y+ +    L        + +S  +   ++ +   L+ +P   ++  V+L V +    
Sbjct: 10  VAQYVNDGVDWLLVRFAPAFDSISVFISSVLSGIQSSLEMVPWWAYIIAVALGVWLATGK 69

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV  A     I   G W    ETLS+++ S  IS+ +G+PLGV+ A +PR  + ++ 
Sbjct: 70  KKSAVILAAFTFCIGLFGLWGLALETLSIIITSVLISLLLGIPLGVMTAEFPRGTAFMKP 129

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P+FVYLIPA++ FGLG VP + AT+++S+P  +RLT LG+   P   +EAA 
Sbjct: 130 LLDGMQTMPSFVYLIPAMMFFGLGKVPAVFATLIYSMPPVIRLTTLGLRQVPKPAQEAAI 189

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           A+GAT +Q+ ++V LP A+P I+A + QT M++L+MVVV A++G+ GLG  VL ++N +D
Sbjct: 190 AYGATRWQLLKEVRLPLAMPGIMAGINQTTMMALAMVVVCAMIGARGLGQEVLLSINRID 249

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPR 278
           IGRGFESG+ IVI+AI++DR+      R
Sbjct: 250 IGRGFESGISIVIMAIVIDRITQGLGKR 277


>gi|327439295|dbj|BAK15660.1| ABC-type proline/glycine betaine transport system, permease
           component [Solibacillus silvestris StLB046]
          Length = 287

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 104/274 (37%), Positives = 167/274 (60%), Gaps = 1/274 (0%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
            P+P+ + +++    +T         +       ++ V   L  +PP VF+ ++++L   
Sbjct: 9   TPLPVAENVEKLMDIVTDTFSAQFRFIQNNGEDLMDFVTSTLTAIPPYVFILIIAVLAFF 68

Query: 67  VK-RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFY 125
              +   +A+ + +GLL I+ QG W++   T +LVL S+ I++ IG+PLG+L +      
Sbjct: 69  ATGKKFGLAIFSIIGLLFILNQGLWEQLMNTFTLVLFSSLIAIVIGIPLGILMSKSKVVE 128

Query: 126 SIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPIL 185
            I++  LD MQT+P FVYLIPA+  FG+G+VPG+ A+++F++P +VR T LGI   P  L
Sbjct: 129 EILKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASVIFALPPTVRFTNLGIRQVPTHL 188

Query: 186 KEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRA 245
            EAA ++G+T  Q   KVELP +   I+A + QT++LSLSMVV+ +++G+ GLG  VL A
Sbjct: 189 IEAADSYGSTFTQKLVKVELPLSKSTIMAGINQTVLLSLSMVVIASMIGAPGLGREVLSA 248

Query: 246 LNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           L    IG GF +G+ +VI AII+DRL    + + 
Sbjct: 249 LQRAQIGNGFVAGISLVIFAIIVDRLTQSLNKQK 282


>gi|163843831|ref|YP_001628235.1| binding-protein-dependent transport systems inner membrane
           component [Brucella suis ATCC 23445]
 gi|163674554|gb|ABY38665.1| binding-protein-dependent transport systems inner membrane
           component [Brucella suis ATCC 23445]
          Length = 278

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 137/278 (49%), Positives = 198/278 (71%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKLVVDWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|307545947|ref|YP_003898426.1| ABC transporter permease [Halomonas elongata DSM 2581]
 gi|307217971|emb|CBV43241.1| ABC-type transport system permease protein [Halomonas elongata DSM
           2581]
          Length = 279

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 111/277 (40%), Positives = 167/277 (60%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
           I    IPLGD+++     LT         +S +    ++ +   L +LP    + ++  L
Sbjct: 3   IEIPRIPLGDWIEGALNWLTSEYSIVTRGISRVTQTGIDGLNDALMWLPDWSLLAIIVAL 62

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
              +  +  +A+G A GL LI   G W    ETL+LV+++T +++ I +P+G+ AA   R
Sbjct: 63  CWWLA-NSRLAIGAAAGLALIWNLGLWDPMIETLTLVVIATLVAVVIALPVGIAAALSER 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
            Y  I   LD MQT+P FVYLIPA+  FG+G V  I AT++FS+P ++R T LGI   P 
Sbjct: 122 LYRTIMPILDFMQTMPAFVYLIPAIPFFGIGSVSAIFATVIFSMPPAIRFTTLGIRQVPV 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA A+GAT  Q   KV+LP ++P ++A + QTIML+LSMVV+ A++G++GLG  V 
Sbjct: 182 ELVEAADAYGATRSQKLIKVQLPMSLPTVMAGINQTIMLALSMVVIAAMIGADGLGSEVW 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           RA+  +  G GFE+G+ +VILA+ILDR+      + +
Sbjct: 242 RAIQRLRPGDGFEAGIAVVILAMILDRVTQSLRKQRK 278


>gi|167632060|ref|ZP_02390387.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0442]
 gi|254743021|ref|ZP_05200706.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           anthracis str. Kruger B]
 gi|167532358|gb|EDR94994.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0442]
          Length = 278

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++
Sbjct: 1   MNSI--PRIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLIIIPAILMIILL 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L+    R +++ + T +GLL I+   Y  +T +TL+LVL S  IS+ +G+P+G+LA+ 
Sbjct: 59  CFLIWYTTRKVSLVIFTLIGLLFILNINYRAQTMQTLALVLTSVIISIIVGIPIGILASQ 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF   ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI  
Sbjct: 119 NERFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQ 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV
Sbjct: 179 VPEDLIEAANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGV 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V R++  V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 239 DVYRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|332968035|gb|EGK07122.1| glycine betaine ABC superfamily ATP binding cassette transporter,
           membrane protein [Desmospora sp. 8437]
          Length = 279

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 117/273 (42%), Positives = 176/273 (64%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL  ++      LT+N     + ++ I+   V     +L   PPLV + ++S L L  
Sbjct: 5   KVPLDQWVDSLVNWLTENLSGLFSFITNIVEPTVGFFQMILMVAPPLVTIVLISALALWA 64

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R  ++A+ T +GL L+   G W+++TETLSLVL ++ IS+ +G+PLG+ AA       I
Sbjct: 65  SR-WSVALFTLVGLFLVANLGLWEKSTETLSLVLTASLISVILGIPLGIWAARSQTVRKI 123

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA+  F LG VPG++A+++F++P ++RLT LGI   P  L E
Sbjct: 124 LTPVLDFMQTMPAFVYLIPAVFFFALGAVPGVIASVIFAMPPTIRLTNLGIRQVPGDLIE 183

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T +Q   KV+LP A   I+A + QTIMLSLSMVV+++++G+ GLG  VL++++
Sbjct: 184 AADAFGSTSWQKLVKVQLPLARTTIMAGVNQTIMLSLSMVVISSMIGAGGLGAIVLQSIS 243

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +++G GFE GL IVI+AI+LDR+        R
Sbjct: 244 RLEVGTGFEGGLAIVIIAIVLDRITQSLGKDPR 276


>gi|126737512|ref|ZP_01753242.1| glycine betaine/proline ABC transporter, permease protein, putative
           [Roseobacter sp. SK209-2-6]
 gi|126720905|gb|EBA17609.1| glycine betaine/proline ABC transporter, permease protein, putative
           [Roseobacter sp. SK209-2-6]
          Length = 519

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 93/264 (35%), Positives = 145/264 (54%), Gaps = 1/264 (0%)

Query: 16  QEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAV 75
              F  L  N     + ++  +   ++ +  +L   P  V + V  ++ L +     +A+
Sbjct: 253 DAGFDWLANNFGDVFDGVTVGIRWVLDGLEVLLIQTPWPVVMFVTVVMALRLAGP-RVAI 311

Query: 76  GTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSM 135
            TA  L  +   G W+    T++L+    F+ + IG+PLG+      R Y+I    LD M
Sbjct: 312 FTAASLAYLAFMGLWELAMITVALIGAGAFLCVAIGIPLGIWFGKSKRAYAIAEPVLDFM 371

Query: 136 QTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGAT 195
           QT+P FVYLIP +  FG G  PG++AT+VF++P  +RLT LG+   P   KEAA AFG +
Sbjct: 372 QTMPAFVYLIPIIAFFGTGKPPGVLATLVFAMPPVIRLTALGMRGVPEATKEAAVAFGCS 431

Query: 196 PFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGF 255
             Q+   VELP A+P I+  + QTI++SLSMVV+ +L+G+ GLG  +L AL     G+G 
Sbjct: 432 RRQLLFNVELPLALPSIMTGINQTILMSLSMVVIASLIGAEGLGALILEALQYAAKGQGL 491

Query: 256 ESGLCIVILAIILDRLFSIPDPRD 279
             GL I+  A+++DR+      + 
Sbjct: 492 LGGLAILFCAMVIDRIAQGAYRQK 515


>gi|307727848|ref|YP_003911061.1| choline ABC transporter permease [Burkholderia sp. CCGE1003]
 gi|307588373|gb|ADN61770.1| choline ABC transporter, permease protein [Burkholderia sp.
           CCGE1003]
          Length = 300

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 112/270 (41%), Positives = 162/270 (60%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG ++      L  +     + +  ++     +V   LQ +P    +     + L  
Sbjct: 4   VIPLGAWVDHGVHYLLDHDAKTFDSIGKVIESFAAIVEHGLQAVPMWALMAFFVGIGLW- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +     A+ T + +LLI   G+W +   TL L L STFIS+ +GVPLG+  A       I
Sbjct: 63  RVGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTFISLVLGVPLGIWTAKSRTVEMI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + E
Sbjct: 123 VRPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREIVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++ 
Sbjct: 183 AGQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            +DIG GFESGL +V+LAIILDR+      
Sbjct: 243 RLDIGLGFESGLSVVMLAIILDRITESFGR 272


>gi|255693778|ref|ZP_05417453.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides finegoldii DSM 17565]
 gi|260620401|gb|EEX43272.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides finegoldii DSM 17565]
          Length = 275

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 116/271 (42%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++        +   F + ++  +   +     +L  +P  + + +++ L  M  
Sbjct: 2   INIGQYIEVAINWTMVHFSTFFDAVNAGIGSFIIGFQHILFGIPFYITILILAALAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA+GLLLI   G+W+ T +TL+LVL ST +++ +GVPLGV  A  PR   I+
Sbjct: 62  GR-GTAIFTALGLLLIYGMGFWEATMQTLALVLSSTCLALIVGVPLGVWTANSPRAEKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGAVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|78063691|ref|YP_373599.1| ABC proline/glycine betaine transporter, inner membrane subunit
           [Burkholderia sp. 383]
 gi|77971576|gb|ABB12955.1| ABC proline/glycine betaine transporter, inner membrane subunit
           [Burkholderia sp. 383]
          Length = 321

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 107/278 (38%), Positives = 163/278 (58%), Gaps = 2/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSF-ILLKAVNLVLFVLQYLPPLVFVCV 59
           M+      + + D++               +  S  +L   +  +   L+  PP + + V
Sbjct: 1   MNGFFLH-LSIADWVNSALETFVAQYGDGFHHFSVLVLRYLLVPLEGALRVAPPWLVLLV 59

Query: 60  VSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           V  +     R I + V   + L  I   G W +  +TL+L+LVST +S+ IGVP+G+LA+
Sbjct: 60  VGAIAWNATRRIGLGVLFMLLLYAIGCFGLWDKLMQTLALMLVSTVLSVAIGVPVGILAS 119

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  ++   LD MQT+P+FVYLIP L+LFGLG VP I+ATI++++P  +RLT LGI 
Sbjct: 120 RSAWLRRMLLPVLDVMQTLPSFVYLIPVLMLFGLGKVPAILATIIYALPPLIRLTDLGIR 179

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
              P + EAA AFG T +Q+   V+LP A P I+A + QT M++LSMVV+ +++GS GLG
Sbjct: 180 QVDPDVTEAARAFGTTRWQLLVNVQLPLARPSIMAGINQTTMMALSMVVIASMIGSRGLG 239

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
             VL  + T+D+G+G ++GL IVILAI++DR+      
Sbjct: 240 EDVLAGIQTLDVGKGTQAGLAIVILAIVIDRISQGFGQ 277


>gi|298489261|ref|ZP_07007278.1| L-proline/glycine/betaine ABC transport system permease protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298156225|gb|EFH97328.1| L-proline/glycine/betaine ABC transport system permease protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 283

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLESLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|328551972|gb|AEB22464.1| OpuAB [Bacillus amyloliquefaciens TA208]
 gi|328910239|gb|AEB61835.1| Glycine betaine transport system permease protein [Bacillus
           amyloliquefaciens LL3]
          Length = 282

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 110/273 (40%), Positives = 164/273 (60%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D +  F   LT     F + +S  L   VN ++  L ++P ++   + + L   +
Sbjct: 6   RIPLADIVDRFVDWLTMTFGGFFDGISNGLAAFVNAIVSGLGFIPSILLTVIFAALAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G L+I   GYW    +TL+LV+ S  IS+ IGVP+GV A+       I
Sbjct: 66  S-TRGIALFTLIGFLVIDYLGYWSPMLQTLALVVTSVLISIIIGVPIGVWASQKETVRRI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTSQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G G E+G+ IVI+AI LDR+      + +
Sbjct: 245 QLKTGVGVEAGIAIVIVAITLDRITQNIKVKKK 277


>gi|289650725|ref|ZP_06482068.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 283

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 159/270 (58%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLESLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I         L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTGVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|289624880|ref|ZP_06457834.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|330869209|gb|EGH03918.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 283

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 103/270 (38%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLESLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   V     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTVVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|315122235|ref|YP_004062724.1| proline/glycine betaine ABC transporter, permease protein
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495637|gb|ADR52236.1| proline/glycine betaine ABC transporter, permease protein
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 281

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 240/279 (86%), Positives = 256/279 (91%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ IIQ  IPLGDYLQ FF  LT NGEWF + LSFILLK VN +LF+LQ+  PLV +C++
Sbjct: 1   MNWIIQTHIPLGDYLQAFFSYLTNNGEWFFSFLSFILLKIVNFILFLLQFFSPLVSICIL 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           SLLVL++KRSI I VGTAMGLLLI+ QGYWQETTETLSLVLVST ISM IGVPLGV AAW
Sbjct: 61  SLLVLVIKRSIAITVGTAMGLLLIVNQGYWQETTETLSLVLVSTSISMLIGVPLGVFAAW 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
           YPRFYSIIRL LDSMQTIPTFVYLIPALVLFGLGMVPG+VATIVFSIPTSVRLTRLGIIS
Sbjct: 121 YPRFYSIIRLLLDSMQTIPTFVYLIPALVLFGLGMVPGMVATIVFSIPTSVRLTRLGIIS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TPP+LKEAA AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGS+GLGV
Sbjct: 181 TPPVLKEAARAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSDGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           PVLRALNTVDIG+GFESG CIVI+AIILDRLFSIPDPRD
Sbjct: 241 PVLRALNTVDIGKGFESGFCIVIIAIILDRLFSIPDPRD 279


>gi|299149362|ref|ZP_07042419.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 3_1_23]
 gi|298512549|gb|EFI36441.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacteroides sp. 3_1_23]
          Length = 275

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 115/271 (42%), Positives = 171/271 (63%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     +L  +P  + + V++ +   VK
Sbjct: 2   INIGQYIEIAINWMMVHFSTFFDAVNTGIGSFITGFQHILFGIPFYLTILVLAAIAW-VK 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               I++ T +GLLLI   G+W+ T +TL+LVL ST +++  GVPLG+  A  PR   I+
Sbjct: 61  AGRGISIFTVLGLLLIYGMGFWEATMQTLALVLSSTCLALIFGVPLGIWTANSPRADKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPILDLMQTMPAFVYLIPAVLFFGLGTVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|77459006|ref|YP_348512.1| glycine betaine/L-proline ABC transporter, ATPase/permease fusion
           protein, putative [Pseudomonas fluorescens Pf0-1]
 gi|77383009|gb|ABA74522.1| putative bifunctional protein, ATP-binding: permease [Pseudomonas
           fluorescens Pf0-1]
          Length = 698

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 97/268 (36%), Positives = 145/268 (54%), Gaps = 1/268 (0%)

Query: 12  GDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSI 71
              + +F        E     +   +   +  +  +L +LP  V    + LL        
Sbjct: 427 AQSVDDFIGWSQVTFESAFVGVIVAVRTVIEGIESLLGWLPWPVCALALVLLAWRSAGLA 486

Query: 72  TIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLF 131
            +A+ ++  LL I   G+W+ T  TL+LV  S  I++ IGVP G+L A  P    ++   
Sbjct: 487 -LALTSSAALLYIGLFGFWERTIATLALVGSSVLIALVIGVPTGILLAKRPFARRLLTPL 545

Query: 132 LDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACA 191
           LD MQT+PTFVYLIPA+  F +G  P ++AT++F++   +RLT LGI   P    EAA A
Sbjct: 546 LDVMQTLPTFVYLIPAVAFFSVGKTPAVIATVIFALAPMIRLTSLGIQEVPKDAVEAAIA 605

Query: 192 FGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDI 251
            GA P+Q   KV+LP A   ++  + QTI++SLSMVVV AL+G+ GLG  V+ AL  +  
Sbjct: 606 HGANPWQTLVKVQLPLARRSLLLGINQTIVMSLSMVVVAALIGAGGLGYDVMTALRNIKG 665

Query: 252 GRGFESGLCIVILAIILDRLFSIPDPRD 279
           G G  +G+ IV+ A+I DR+      + 
Sbjct: 666 GEGVLAGVAIVLCALIPDRIIQSSLRKQ 693


>gi|256160302|ref|ZP_05457996.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella ceti M490/95/1]
 gi|256255506|ref|ZP_05461042.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella ceti B1/94]
 gi|261222715|ref|ZP_05936996.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti B1/94]
 gi|265998679|ref|ZP_06111236.1| glycine betaine/L-proline ABC transporter permease [Brucella ceti
           M490/95/1]
 gi|260921299|gb|EEX87952.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti B1/94]
 gi|262553303|gb|EEZ09137.1| glycine betaine/L-proline ABC transporter permease [Brucella ceti
           M490/95/1]
          Length = 278

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 137/278 (49%), Positives = 198/278 (71%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT +   F + L+ ++   ++ +L++L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVGWLTTHLGLFFDTLAAVMQSLIDGLLYLLELPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ + T +G L II QGYW+ T +TL+LVL S F+ M IGVPLG+ AA 
Sbjct: 61  AIIAWLIQRRISVVLLTILGFLFIINQGYWEPTLKTLTLVLSSCFVCMVIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F IP  +RLT+LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATVIFVIPAPIRLTQLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPASLIEAGEAFGASRSQLLWKVELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+R LN+V+I  GFE+G  IV++AI+LDR+F     +
Sbjct: 241 PVVRGLNSVNISLGFEAGFIIVVVAIVLDRIFRAGREK 278


>gi|170695677|ref|ZP_02886820.1| choline ABC transporter, permease protein [Burkholderia graminis
           C4D1M]
 gi|170139476|gb|EDT07661.1| choline ABC transporter, permease protein [Burkholderia graminis
           C4D1M]
          Length = 300

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 162/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++      L  +     + +  ++     +V   LQ +P    +     + L  +
Sbjct: 5   IPLGAWVDHGVHYLLDHDAKTFDSIGKVIESFAAIVEHGLQAVPMWALMAFFVGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + +LLI   G+W +   TL L L STFIS+ +GVPLG+  A       ++
Sbjct: 64  VGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTFISLVLGVPLGIWTAKSRTVEMMV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVMLAIILDRITESFGR 272


>gi|153011208|ref|YP_001372422.1| binding-protein-dependent transport systems inner membrane
           component [Ochrobactrum anthropi ATCC 49188]
 gi|151563096|gb|ABS16593.1| binding-protein-dependent transport systems inner membrane
           component [Ochrobactrum anthropi ATCC 49188]
          Length = 301

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 112/267 (41%), Positives = 161/267 (60%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP+  V +++LL L  +  
Sbjct: 7   VGGWADVVVNYILDHFTPALDMIAAAIGFVTDGIQNALLAVPPIGGVAILTLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              A+ TA+ L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAIFTALALGLIIHMELWTGTMESLSLVLASTVIAVVIGIPLGIAMARSDTVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 VLDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTSRQLLFKVQLPNAMPSIMAGINQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|320326290|gb|EFW82343.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320331710|gb|EFW87648.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330872451|gb|EGH06600.1| histidine ABC transporter permease [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 283

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLEGLLRIAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|257483860|ref|ZP_05637901.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330891839|gb|EGH24500.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330987240|gb|EGH85343.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 283

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|254455113|ref|ZP_05068548.1| choline ABC transporter, permease protein [Octadecabacter
           antarcticus 238]
 gi|198263523|gb|EDY87795.1| choline ABC transporter, permease protein [Octadecabacter
           antarcticus 238]
          Length = 277

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 150/274 (54%), Positives = 197/274 (71%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  +    IP+G  ++ F   LT +  W  + LS +L   +  +L++LQ     V V  +
Sbjct: 1   MEWLEANKIPIGVLVERFVDWLTDSYYWAFDSLSDVLEAVILAILWLLQAPNVFVVVAGI 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +LL  + +RSI   V TA+GLLLII QGYW ETTETL+LVL +  + M +GVPLG+ AA 
Sbjct: 61  TLLAWVSQRSIGFTVFTALGLLLIINQGYWVETTETLALVLAAATVCMGLGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y  +   LD MQTIPTFVYLIPAL+LFGLGMVPG++AT++F++P  +RLT+LGI S
Sbjct: 121 RPWLYKAMEPVLDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFALPAPIRLTQLGITS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  +FG+TP Q+  KVELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPTALIEAGKSFGSTPMQLLWKVELPYALPQIMAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSI 274
           P LRALN+V+I +GFE G+ IV++AII DR+F  
Sbjct: 241 PTLRALNSVNIAQGFEVGITIVLVAIISDRMFRR 274


>gi|186471608|ref|YP_001862926.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia phymatum STM815]
 gi|184197917|gb|ACC75880.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia phymatum STM815]
          Length = 294

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 111/270 (41%), Positives = 163/270 (60%), Gaps = 1/270 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G + ++    L Q+     +  S  L   + L+   L  +P +  +  +    L  +R 
Sbjct: 6   IGKFAEDAVNFLFQHFRGGFDAFSAALGAVIKLLEDGLAAVPFVAMLVFLVAFALW-RRG 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           +  ++   + LL I   G W +T  TL+LV+ +T  S+ IGVPLG+  A   R   ++R 
Sbjct: 65  VVFSIFVGLALLAIHYMGLWAQTVSTLALVIAATVFSLVIGVPLGIWGARNKRVEMVLRS 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA++LFGLG VP ++ATIVF++P  VRLT LGI      L EA  
Sbjct: 125 LLDFMQTMPAFVYLIPAVILFGLGRVPAVIATIVFAMPPVVRLTTLGIRQVREELLEAGR 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           +FG+T  Q+  KV+LP A+P I+A + QTIM++LSMVVV +++G+ GLG  VL  +  +D
Sbjct: 185 SFGSTDAQLLWKVQLPNALPSIMAGVNQTIMMALSMVVVASMIGAGGLGEYVLSGIQRLD 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           IG GFE GL +V+LAI+LDRL      + +
Sbjct: 245 IGIGFEGGLGVVLLAIVLDRLTESFGVKAK 274


>gi|331012049|gb|EGH92105.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 283

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|306845959|ref|ZP_07478526.1| binding-protein-dependent transport systems inner membrane
           component [Brucella sp. BO1]
 gi|306273594|gb|EFM55439.1| binding-protein-dependent transport systems inner membrane
           component [Brucella sp. BO1]
          Length = 301

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 113/267 (42%), Positives = 159/267 (59%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 7   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDTVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 ILDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|167840043|ref|ZP_02466727.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia thailandensis MSMB43]
          Length = 300

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     LV   LQ +P  + +     + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGRAIEGLAALVEHGLQAVPMGLMMACFVGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA  L LI   G+W +T  TL L L ST +S+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFAIFTAASLFLIFATGFWDQTVVTLGLTLSSTIVSLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|71734144|ref|YP_276955.1| histidine ABC transporter permease [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554697|gb|AAZ33908.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 283

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLEGLLRIAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNLGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|134292188|ref|YP_001115924.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia vietnamiensis G4]
 gi|134135345|gb|ABO56459.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia vietnamiensis G4]
          Length = 298

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     LV   LQ +P  + + +   + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGQAIESLAALVEHGLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      + +
Sbjct: 64  VGWRFALFTTASLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAATL 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|261409048|ref|YP_003245289.1| binding-protein-dependent transport systems inner membrane
           component [Paenibacillus sp. Y412MC10]
 gi|261285511|gb|ACX67482.1| binding-protein-dependent transport systems inner membrane
           component [Paenibacillus sp. Y412MC10]
          Length = 277

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 114/273 (41%), Positives = 173/273 (63%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL  ++      +      F + +SFI+   V L   +     P +F+ +++++  ++
Sbjct: 3   KIPLASWVDSLVDWMGDVFSGFFDAISFIIENVVQLFTDLFMLPHPYLFIVILAVIAYLL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   + + TA+G LLI   GYW +T  TLSLV+ +  IS+ +GVPLG+ AA+      +
Sbjct: 63  GRLP-LTLFTAIGFLLIDNLGYWSQTMSTLSLVITAALISVILGVPLGIWAAYSKSASRV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYL+PA+  F LG+VPG++A+++F+IP ++RLTRLGI+     L E
Sbjct: 122 IIPVLDFMQTMPAFVYLLPAVTFFSLGVVPGVIASVIFAIPPTIRLTRLGIMQVSGELTE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A+P ++A + QTIMLSLSMVV+ +++G+ G+G  V RA+ 
Sbjct: 182 AADAFGSTSGQKLFKVQLPLAMPTLMAGINQTIMLSLSMVVIASMIGAQGIGAEVYRAVT 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            + IG+GFE+GL +VILAI+LDR         +
Sbjct: 242 QLQIGKGFEAGLAVVILAIVLDRFTQNIFKSKK 274


>gi|83643736|ref|YP_432171.1| proline/glycine betaine ABC transporter permease [Hahella
           chejuensis KCTC 2396]
 gi|83631779|gb|ABC27746.1| ABC-type proline/glycine betaine transport system, permease
           component [Hahella chejuensis KCTC 2396]
          Length = 281

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 126/268 (47%), Positives = 173/268 (64%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+GD+++     L  +G  F + ++  L   +  +   L + PP +F+ V+       
Sbjct: 14  KLPVGDWMESLVDMLIDHGGAFFDGVAICLEYLIQGLTEALLFAPPWLFIAVIVAFAAWR 73

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R+ +  +   + L LI   GYW+ET ETL+LVL +T   +  GVP+G+ AA  P  Y  
Sbjct: 74  HRNWSSPLFALIALGLIWNMGYWEETIETLALVLFATGFCVLFGVPIGIAAAHRPWLYRG 133

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQTIPTFVYLIP L LFGLG+VPG+++T++F+I   +RLT LGI   P  L E
Sbjct: 134 MRPLLDLMQTIPTFVYLIPTLTLFGLGVVPGLISTVIFAIAAPIRLTHLGITQVPEELLE 193

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG  P  +  KVE+P A+  I+A +TQ IMLSLSMVV+ ALVG++GLG PV+RALN
Sbjct: 194 AGKAFGCKPSVLLLKVEIPAAMSSIMAGVTQCIMLSLSMVVIAALVGADGLGKPVVRALN 253

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIP 275
           TVDI  GFE+GL IV++AI+LDRLF   
Sbjct: 254 TVDIATGFEAGLAIVLIAILLDRLFKRA 281


>gi|154684792|ref|YP_001419953.1| OpuAB [Bacillus amyloliquefaciens FZB42]
 gi|154350643|gb|ABS72722.1| OpuAB [Bacillus amyloliquefaciens FZB42]
          Length = 282

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 109/273 (39%), Positives = 164/273 (60%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D +  F   LT     F + +S  L   VN ++  L ++P ++   + + L   +
Sbjct: 6   RIPLADIVDRFVDWLTMTFGGFFDGISNGLAAFVNAIVSGLGFIPSILLTVIFAALAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G L+I   GYW    +TL+LV+ S  IS+ IGVP+G+ A+       I
Sbjct: 66  S-TRGIALFTLIGFLVIDYLGYWSPMLQTLALVVTSVLISIIIGVPIGIWASQKETVRRI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTSQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G G E+G+ IVI+AI LDR+      + +
Sbjct: 245 QLKTGVGVEAGIAIVIVAITLDRITQNIKVKKK 277


>gi|83716128|ref|YP_439164.1| glycine betaine/L-proline ABC transporter permease [Burkholderia
           thailandensis E264]
 gi|167577605|ref|ZP_02370479.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia thailandensis TXDOH]
 gi|167615750|ref|ZP_02384385.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia thailandensis Bt4]
 gi|257142284|ref|ZP_05590546.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia thailandensis E264]
 gi|83649953|gb|ABC34017.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia thailandensis E264]
          Length = 300

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     LV   LQ +P  + + +   + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGRAIEGLAALVEHSLQAVPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA  L LI   G+W +T  TL L L ST +S+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFAIFTAASLFLIFATGFWDQTVVTLGLTLSSTIVSLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|260575920|ref|ZP_05843915.1| choline ABC transporter, permease protein [Rhodobacter sp. SW2]
 gi|259021846|gb|EEW25147.1| choline ABC transporter, permease protein [Rhodobacter sp. SW2]
          Length = 312

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 140/270 (51%), Positives = 186/270 (68%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G   +  F  L  N     + LS  +   +  +L++LQ  PPLV + +   L   +
Sbjct: 43  KIPVGKLAKTVFDWLKANAAPLFDTLSAWMEALITAILWLLQTPPPLVIIALAVGLTYGL 102

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +RS   A+    G L I+ QGYW+ETTE+L+LVL +  + M +GVP+G+ AA  PR Y+ 
Sbjct: 103 QRSWKTALLVFAGFLFILNQGYWEETTESLTLVLSACVVCMGLGVPIGIAAAHRPRLYAW 162

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+PTFVYLIPA+V FG+GMVPG++AT++F +P  +RLT LGI +TP  L E
Sbjct: 163 MVPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLIATVIFVLPAPIRLTHLGISTTPQPLLE 222

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGATP Q   KVELP+A PQI+A L QTIMLSLSMVV+ ALVG+NGLGVPV+RALN
Sbjct: 223 AATAFGATPRQRLWKVELPYAFPQIMAGLNQTIMLSLSMVVIAALVGANGLGVPVVRALN 282

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +V+   GFESG+ IV++AIILDR+  +   
Sbjct: 283 SVNTALGFESGMIIVVVAIILDRMLRVTRK 312


>gi|212696313|ref|ZP_03304441.1| hypothetical protein ANHYDRO_00850 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676942|gb|EEB36549.1| hypothetical protein ANHYDRO_00850 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 281

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 170/280 (60%), Gaps = 3/280 (1%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPL  ++      L  +  +  N +   +   V L + +    PPL+F+ +V
Sbjct: 2   MNNIPS--IPLVGFIDNLVEWLRLHASFIFNPIRDFINFTVELFIKIFSVFPPLLFIILV 59

Query: 61  SLLVLMVKRSIT-IAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           + L   + + I  I + + + LLLI    YW +   TLS+V+ S  +++ IG+PLG+  +
Sbjct: 60  AALAYYLTKKIKGITIFSILSLLLIWNLDYWDDMVITLSIVVTSALLAIIIGIPLGIWTS 119

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  +I   LD MQT+P FVYLIPA+  FG+GM PG++++I+F++P +VR+T LGI 
Sbjct: 120 KSESVEKVIMPLLDFMQTMPAFVYLIPAVSFFGIGMAPGVISSIIFAMPPAVRMTNLGIK 179

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EAA +FG+TP Q   ++ELP A P I+A + QT+ML+LSMVVV +++G+ GLG
Sbjct: 180 EVPSDLVEAADSFGSTPKQKLFELELPMAKPSIMAGINQTLMLTLSMVVVASMIGAPGLG 239

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
             +  +++  D+G GF SG+ IVILA+ILDRL      ++
Sbjct: 240 NVIYTSVSRNDVGVGFASGIAIVILAVILDRLTQALSKKN 279


>gi|295397940|ref|ZP_06807997.1| glycine betaine/proline ABC superfamily ATP binding cassette
           transporter, binding protein [Aerococcus viridans ATCC
           11563]
 gi|294973825|gb|EFG49595.1| glycine betaine/proline ABC superfamily ATP binding cassette
           transporter, binding protein [Aerococcus viridans ATCC
           11563]
          Length = 285

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 112/266 (42%), Positives = 166/266 (62%), Gaps = 1/266 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+ D+++     LT         +       +N +  +L  +PP  F+ +V+++   V
Sbjct: 11  KLPVADWVEAATNWLTVTLSGLFGAIQNGGSAFMNGITSLLLLIPPFAFILIVAVIAYFV 70

Query: 68  -KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            K+ ++++    +GL  I+ QG W E   T++LVLVS+ IS+ IGVPLG+ +A     ++
Sbjct: 71  NKKRLSLSAFALVGLGYILNQGLWSELMNTVTLVLVSSVISIIIGVPLGIWSAKSKTVHN 130

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I++  LD MQT+P FVYLIPA+  FG+G+VPG  A+++F++P +VR T LGI      L 
Sbjct: 131 ILKPILDFMQTMPAFVYLIPAVAFFGIGIVPGTFASVIFALPPTVRFTELGIKQISTELV 190

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG  VL AL
Sbjct: 191 EAADAFGSTGKQKLFKVELPLAKSTIMAGVNQTVMLALSMVVTASMIGAPGLGRQVLTAL 250

Query: 247 NTVDIGRGFESGLCIVILAIILDRLF 272
               +G GF SGL IVILAI++DRL 
Sbjct: 251 QRASVGSGFVSGLAIVILAILIDRLT 276


>gi|158522774|ref|YP_001530644.1| binding-protein-dependent transport systems inner membrane
           component [Desulfococcus oleovorans Hxd3]
 gi|158511600|gb|ABW68567.1| binding-protein-dependent transport systems inner membrane
           component [Desulfococcus oleovorans Hxd3]
          Length = 278

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 111/274 (40%), Positives = 166/274 (60%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
             IP+G+ ++        +  +     S +    V++++ V+ +  PLV +  ++ L   
Sbjct: 2   YRIPIGEVIESAIDFFVDHFSFATKAFSKVTENGVDIMVSVMMFFHPLVLILALTGLAWF 61

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
           + R   IA+ T +GLLLI     W  T  T++L++++   ++ IGVPLG+L+A     Y 
Sbjct: 62  LSRRRGIALFTLVGLLLIWNMELWAPTVSTMALIVIAVLFAIAIGVPLGILSALSQTAYR 121

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           II   LD MQT+P FVYLIPA+  FGLG V  I +T++FS+P  +RLT LGI   P  L 
Sbjct: 122 IITPILDVMQTMPAFVYLIPAIPFFGLGAVGAIFSTVIFSVPPCIRLTCLGIKQVPRELV 181

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           EAA AFG++  Q   KV+LP A   ++A + QTIML+LSMVV+ A++G+ GLG  V +A+
Sbjct: 182 EAADAFGSSRGQKLFKVQLPIAKTTMMAGINQTIMLALSMVVIAAMIGAKGLGGEVWKAI 241

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
             ++ GRGFE+G+ IVILAIILDR+        +
Sbjct: 242 QRLEPGRGFEAGIGIVILAIILDRVMQRVGTDQK 275


>gi|23500476|ref|NP_699916.1| glycine betaine/L-proline ABC transporter permease [Brucella suis
           1330]
 gi|161620798|ref|YP_001594684.1| binding-protein-dependent transport systems inner membrane
           component [Brucella canis ATCC 23365]
 gi|163844870|ref|YP_001622525.1| hypothetical protein BSUIS_B0731 [Brucella suis ATCC 23445]
 gi|225629216|ref|ZP_03787249.1| glycine betaine/L-proline ABC transporter permease protein
           [Brucella ceti str. Cudo]
 gi|254695772|ref|ZP_05157600.1| hypothetical protein Babob3T_14290 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254699956|ref|ZP_05161784.1| hypothetical protein Bsuib55_03722 [Brucella suis bv. 5 str. 513]
 gi|254703078|ref|ZP_05164906.1| hypothetical protein Bsuib36_03902 [Brucella suis bv. 3 str. 686]
 gi|254705779|ref|ZP_05167607.1| hypothetical protein BpinM_01910 [Brucella pinnipedialis
           M163/99/10]
 gi|254711010|ref|ZP_05172821.1| hypothetical protein BpinB_12262 [Brucella pinnipedialis B2/94]
 gi|254720289|ref|ZP_05182100.1| hypothetical protein Bru83_12325 [Brucella sp. 83/13]
 gi|256015503|ref|YP_003105512.1| glycine betaine/L-proline ABC transporter, permease protein
           [Brucella microti CCM 4915]
 gi|256029392|ref|ZP_05443006.1| hypothetical protein BpinM2_01820 [Brucella pinnipedialis
           M292/94/1]
 gi|256059081|ref|ZP_05449290.1| hypothetical protein Bneo5_01810 [Brucella neotomae 5K33]
 gi|256157585|ref|ZP_05455503.1| hypothetical protein BcetM4_01850 [Brucella ceti M490/95/1]
 gi|256253440|ref|ZP_05458976.1| hypothetical protein BcetB_03907 [Brucella ceti B1/94]
 gi|260167519|ref|ZP_05754330.1| glycine betaine/L-proline ABC transporter, permease protein
           [Brucella sp. F5/99]
 gi|260567993|ref|ZP_05838462.1| prion protein [Brucella suis bv. 4 str. 40]
 gi|261216184|ref|ZP_05930465.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 3 str. Tulya]
 gi|261220564|ref|ZP_05934845.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti B1/94]
 gi|261313201|ref|ZP_05952398.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis M163/99/10]
 gi|261318594|ref|ZP_05957791.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis B2/94]
 gi|261323028|ref|ZP_05962225.1| binding-protein-dependent transport system inner membrane component
           [Brucella neotomae 5K33]
 gi|261750435|ref|ZP_05994144.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 5 str. 513]
 gi|261753693|ref|ZP_05997402.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 3 str. 686]
 gi|261756935|ref|ZP_06000644.1| prion protein [Brucella sp. F5/99]
 gi|265985307|ref|ZP_06098042.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. 83/13]
 gi|265986395|ref|ZP_06098952.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis M292/94/1]
 gi|265996089|ref|ZP_06108646.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti M490/95/1]
 gi|306839824|ref|ZP_07472623.1| binding-protein-dependent transport systems inner membrane
           component [Brucella sp. NF 2653]
 gi|23464104|gb|AAN33921.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Brucella suis 1330]
 gi|161337609|gb|ABX63913.1| binding-protein-dependent transport systems inner membrane
           component [Brucella canis ATCC 23365]
 gi|163675593|gb|ABY39703.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|225615712|gb|EEH12761.1| glycine betaine/L-proline ABC transporter permease protein
           [Brucella ceti str. Cudo]
 gi|255998163|gb|ACU49850.1| glycine betaine/L-proline ABC transporter, permease protein
           [Brucella microti CCM 4915]
 gi|260154658|gb|EEW89739.1| prion protein [Brucella suis bv. 4 str. 40]
 gi|260917791|gb|EEX84652.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 3 str. Tulya]
 gi|260919148|gb|EEX85801.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti B1/94]
 gi|261297817|gb|EEY01314.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis B2/94]
 gi|261299008|gb|EEY02505.1| binding-protein-dependent transport system inner membrane component
           [Brucella neotomae 5K33]
 gi|261302227|gb|EEY05724.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis M163/99/10]
 gi|261736919|gb|EEY24915.1| prion protein [Brucella sp. F5/99]
 gi|261740188|gb|EEY28114.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 5 str. 513]
 gi|261743446|gb|EEY31372.1| binding-protein-dependent transport system inner membrane component
           [Brucella suis bv. 3 str. 686]
 gi|262550386|gb|EEZ06547.1| binding-protein-dependent transport system inner membrane component
           [Brucella ceti M490/95/1]
 gi|264658592|gb|EEZ28853.1| binding-protein-dependent transport system inner membrane component
           [Brucella pinnipedialis M292/94/1]
 gi|264663899|gb|EEZ34160.1| binding-protein-dependent transport system inner membrane component
           [Brucella sp. 83/13]
 gi|306405100|gb|EFM61380.1| binding-protein-dependent transport systems inner membrane
           component [Brucella sp. NF 2653]
          Length = 301

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 113/267 (42%), Positives = 159/267 (59%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 7   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDAVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 ILDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|159185903|ref|NP_356821.2| ABC transporter, membrane spanning protein (proline/glycine
           betaine) [Agrobacterium tumefaciens str. C58]
 gi|159141037|gb|AAK89606.2| ABC transporter, membrane spanning protein (proline/glycine
           betaine) [Agrobacterium tumefaciens str. C58]
          Length = 285

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 114/272 (41%), Positives = 166/272 (61%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +   + E    L  N  +    +S  +L+A+  V + L+ LP      V  +L     
Sbjct: 8   ISIRGPINEIVRSLVVNYGYVFKAISQTILQAILFVEWALRGLPWWAIFLVFLVLAWFAA 67

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
           + I++ +  A+ L ++   G W  T +TL+L+L+++ IS+ IGVP+G+L A       I 
Sbjct: 68  KKISLVIMVAVMLFIVGALGLWDLTMQTLALMLIASLISIVIGVPIGILLAKSEWARRIT 127

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P+FVYLIPA++LFGLG VP ++ATIV++ P  +RLT LGI      + EA
Sbjct: 128 LPILDVMQTMPSFVYLIPAIMLFGLGKVPAVLATIVYAAPPLIRLTDLGIRQVDREVVEA 187

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A AFG +P Q+   VELP A P I+A L QTIM++LSMVVV +++G+ GLG  VL  + T
Sbjct: 188 ATAFGGSPRQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQT 247

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +D+G+G E+GL IVILAI+LDR+        R
Sbjct: 248 LDVGKGLEAGLGIVILAIVLDRITQGFGQSSR 279


>gi|171316280|ref|ZP_02905502.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia ambifaria MEX-5]
 gi|171098602|gb|EDT43401.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia ambifaria MEX-5]
          Length = 295

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 115/270 (42%), Positives = 165/270 (61%), Gaps = 1/270 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G + +     L  +     +  S  L   V L+   L  +P +  V ++  L L  +R 
Sbjct: 6   IGKFAENVVNFLFLHFRVGFDTFSAGLGAVVKLLEDGLAAVPFIAMVVILVGLALW-RRG 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           I  ++   + LL+I   G W +T  TL+LV  +TF S+ IGVPLG+  A   R   I+R 
Sbjct: 65  IVFSIFVGLALLVIHYMGLWAQTVSTLALVTAATFFSLVIGVPLGIWGARNSRIGMILRS 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA++LFGLG VP ++ATIVF++P  VRLT LGI      L EA  
Sbjct: 125 LLDFMQTMPAFVYLIPAVILFGLGRVPAVIATIVFAMPPVVRLTTLGIRQVREELIEAGR 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           +FG+T +Q+  K++LP A+P I+A + QTIM++LSMVVV +++G+ GLG  VL  +  +D
Sbjct: 185 SFGSTDWQLLWKIQLPNALPSIMAGVNQTIMMALSMVVVASMIGAGGLGEYVLSGIQRLD 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           IG GFE GL +V+LAI+LDRL      + +
Sbjct: 245 IGIGFEGGLGVVLLAIVLDRLTESFGVKAK 274


>gi|330961928|gb|EGH62188.1| histidine ABC transporter permease [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 283

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 103/270 (38%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLESLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   V     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIITTVVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|94991665|ref|YP_599764.1| glycine betaine-binding protein / glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS2096]
 gi|94545173|gb|ABF35220.1| Glycine betaine-binding protein / Glycine betaine transport system
           permease protein [Streptococcus pyogenes MGAS2096]
          Length = 339

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 113/279 (40%), Positives = 172/279 (61%), Gaps = 1/279 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M  I+Q  +P+   +++    LT+      +I+  +    ++ +   L ++ PL+F+ +V
Sbjct: 1   METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMTKTLLFIHPLLFIVLV 60

Query: 61  SL-LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           +  +  + K+   +   T +GLL I  QG W++   T +LVLV++ IS+ IG+PLG+  A
Sbjct: 61  TAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVASLISVLIGIPLGIWMA 120

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
                  I+   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F++P +VR T L I 
Sbjct: 121 KNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFASVIFALPPTVRFTNLAIR 180

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
             P  L EA+ AFG+T  Q   KVELP A   I+A + QT+ML+LSMVV  +++G+ GLG
Sbjct: 181 DIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMMLALSMVVTGSMIGAPGLG 240

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VL AL   DIG GF SGL +VILAI+LDR+  + + +
Sbjct: 241 REVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSK 279


>gi|53717242|ref|YP_105326.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Burkholderia mallei ATCC 23344]
 gi|53722452|ref|YP_111437.1| glycine-betaine binding ABC transporter permease protein
           [Burkholderia pseudomallei K96243]
 gi|76817460|ref|YP_335608.1| glycine betaine/L-proline ABC transporter permease [Burkholderia
           pseudomallei 1710b]
 gi|124381826|ref|YP_001024716.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei NCTC 10229]
 gi|126444044|ref|YP_001063021.1| glycine betaine/L-proline ABC transporter permease [Burkholderia
           pseudomallei 668]
 gi|126447053|ref|YP_001079051.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei NCTC 10247]
 gi|126457380|ref|YP_001075966.1| glycine betaine/L-proline ABC transporter permease [Burkholderia
           pseudomallei 1106a]
 gi|134282424|ref|ZP_01769128.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 305]
 gi|167724046|ref|ZP_02407282.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei DM98]
 gi|167820188|ref|ZP_02451868.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 91]
 gi|167828563|ref|ZP_02460034.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 9]
 gi|167850021|ref|ZP_02475529.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei B7210]
 gi|167898630|ref|ZP_02486031.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 7894]
 gi|167906971|ref|ZP_02494176.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167915330|ref|ZP_02502421.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 112]
 gi|167923164|ref|ZP_02510255.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei BCC215]
 gi|217425333|ref|ZP_03456827.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 576]
 gi|226199143|ref|ZP_03794705.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|237509601|ref|ZP_04522316.1| choline ABC transporter, permease protein [Burkholderia
           pseudomallei MSHR346]
 gi|242313507|ref|ZP_04812524.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1106b]
 gi|254174383|ref|ZP_04881045.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei ATCC 10399]
 gi|254186743|ref|ZP_04893259.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254194352|ref|ZP_04900784.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei S13]
 gi|254204020|ref|ZP_04910379.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei FMH]
 gi|254208998|ref|ZP_04915345.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei JHU]
 gi|254262955|ref|ZP_04953820.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1710a]
 gi|254355725|ref|ZP_04972005.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei 2002721280]
 gi|52212866|emb|CAH38900.1| putative glycine-betaine binding ABC transporter permease protein
           [Burkholderia pseudomallei K96243]
 gi|52423212|gb|AAU46782.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Burkholderia mallei ATCC 23344]
 gi|76581933|gb|ABA51407.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1710b]
 gi|124289846|gb|ABM99115.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei NCTC 10229]
 gi|126223535|gb|ABN87040.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 668]
 gi|126231148|gb|ABN94561.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1106a]
 gi|126239907|gb|ABO03019.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei NCTC 10247]
 gi|134245981|gb|EBA46071.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 305]
 gi|147744904|gb|EDK51985.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei FMH]
 gi|147750221|gb|EDK57291.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei JHU]
 gi|148023818|gb|EDK82880.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei 2002721280]
 gi|157934427|gb|EDO90097.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160695429|gb|EDP85399.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia mallei ATCC 10399]
 gi|169651103|gb|EDS83796.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei S13]
 gi|217391584|gb|EEC31612.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 576]
 gi|225928918|gb|EEH24943.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei Pakistan 9]
 gi|235001806|gb|EEP51230.1| choline ABC transporter, permease protein [Burkholderia
           pseudomallei MSHR346]
 gi|242136746|gb|EES23149.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1106b]
 gi|254213957|gb|EET03342.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1710a]
          Length = 300

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 163/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     LV   LQ +P  + +     + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGRAIEGLAALVEHGLQAVPMWLMMACFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A  TA  L LI   G+W +T  TL L L ST +S+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFAFFTAASLFLIFATGFWDQTVVTLGLTLSSTIVSLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|220923325|ref|YP_002498627.1| binding-protein-dependent transport systems inner membrane
           component [Methylobacterium nodulans ORS 2060]
 gi|219947932|gb|ACL58324.1| binding-protein-dependent transport systems inner membrane
           component [Methylobacterium nodulans ORS 2060]
          Length = 283

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 111/273 (40%), Positives = 160/273 (58%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
             PL     +    LT +G W    +S  +   ++     L  LPP + + + +L+   +
Sbjct: 7   KFPLDAISDDVLGWLTDHGSWLTRAVSRNISDWIDSFTTALVSLPPWICIGIATLVSYRI 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                I V T  GLL +     WQ T ETL LV ++T +++ IG+P+G+  A   R + +
Sbjct: 67  GGR-KIGVLTLAGLLFLWNLRLWQSTVETLVLVTLATVVALVIGIPVGICCALSRRAWRL 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
               LD MQT+P+FVYLIPAL  FGLG V    ATIVFS+P  +RLT LGI   P  L E
Sbjct: 126 FSPLLDMMQTLPSFVYLIPALPFFGLGAVSACFATIVFSVPPVIRLTALGIRGVPTELVE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFG +  Q   KV+LP A+P I+A + QT+ML+LSMVV+ A++G+ GLG  V +++ 
Sbjct: 186 ASDAFGGSAAQKLFKVQLPLALPTIMAGVNQTMMLALSMVVIAAMIGAGGLGREVWQSIQ 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            ++ G GFE+G+ IVI+A+ILDR+      R R
Sbjct: 246 RLEAGAGFEAGIGIVIVAVILDRVTQALAARAR 278


>gi|62317420|ref|YP_223273.1| glycine betaine/L-proline ABC transporter permease [Brucella
           abortus bv. 1 str. 9-941]
 gi|83269400|ref|YP_418691.1| binding-protein dependent transport system inner membrane protein
           [Brucella melitensis biovar Abortus 2308]
 gi|189022674|ref|YP_001932415.1| Prion protein [Brucella abortus S19]
 gi|237816972|ref|ZP_04595964.1| glycine betaine/L-proline ABC transporter permease [Brucella
           abortus str. 2308 A]
 gi|254690919|ref|ZP_05154173.1| Prion protein [Brucella abortus bv. 6 str. 870]
 gi|254698701|ref|ZP_05160529.1| Prion protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254732147|ref|ZP_05190725.1| Prion protein [Brucella abortus bv. 4 str. 292]
 gi|256256104|ref|ZP_05461640.1| Prion protein [Brucella abortus bv. 9 str. C68]
 gi|260544659|ref|ZP_05820480.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260756507|ref|ZP_05868855.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 6 str. 870]
 gi|260759939|ref|ZP_05872287.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 4 str. 292]
 gi|260763177|ref|ZP_05875509.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882327|ref|ZP_05893941.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 9 str. C68]
 gi|297249461|ref|ZP_06933162.1| glycine betaine/proline transport system permease [Brucella abortus
           bv. 5 str. B3196]
 gi|62197613|gb|AAX75912.1| glycine betaine/L-proline ABC transporter, permease protein,
           hypothetical [Brucella abortus bv. 1 str. 9-941]
 gi|82939674|emb|CAJ12667.1| Binding-protein-dependent transport systems inner membrane
           component:Prion protein [Brucella melitensis biovar
           Abortus 2308]
 gi|189021248|gb|ACD73969.1| Prion protein [Brucella abortus S19]
 gi|237787785|gb|EEP62001.1| glycine betaine/L-proline ABC transporter permease [Brucella
           abortus str. 2308 A]
 gi|260097930|gb|EEW81804.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260670257|gb|EEX57197.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 4 str. 292]
 gi|260673598|gb|EEX60419.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676615|gb|EEX63436.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 6 str. 870]
 gi|260871855|gb|EEX78924.1| binding-protein-dependent transport system inner membrane component
           [Brucella abortus bv. 9 str. C68]
 gi|297173330|gb|EFH32694.1| glycine betaine/proline transport system permease [Brucella abortus
           bv. 5 str. B3196]
          Length = 301

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 111/267 (41%), Positives = 157/267 (58%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 7   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDAVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLI A + FGLG VP  +AT++F++P  VRLT LGI        EA  
Sbjct: 126 ILDLMQTMPAFVYLISAAMFFGLGAVPSTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|238023929|ref|YP_002908161.1| choline ABC transporter membrane-spanning permease [Burkholderia
           glumae BGR1]
 gi|237878594|gb|ACR30926.1| ABC transporter membrane-spanning permease - choline transporter
           [Burkholderia glumae BGR1]
          Length = 297

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 115/269 (42%), Positives = 167/269 (62%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +  ++     LV   LQ +P  + + +   + L  +
Sbjct: 5   IPLGSWVDQSVRYLLDHDAKTFDAIGRVIESLAALVEHGLQAIPMWLLMAIFIGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLGV AA      +I+
Sbjct: 64  VGWRFAIFTTLSLLLIFATGFWDQTVVTLGLTLSSTIISLVLGIPLGVWAAKSKWVSAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|17988894|ref|NP_541527.1| glycine betaine/L-proline transport system permease protein proW
           [Brucella melitensis bv. 1 str. 16M]
 gi|225686509|ref|YP_002734481.1| binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis ATCC 23457]
 gi|256043617|ref|ZP_05446544.1| binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111346|ref|ZP_05452372.1| binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis bv. 3 str. Ether]
 gi|256262352|ref|ZP_05464884.1| prion protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260564808|ref|ZP_05835293.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265990036|ref|ZP_06102593.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992853|ref|ZP_06105410.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 3 str. Ether]
 gi|17984721|gb|AAL53791.1| glycine betaine/l-proline transport system permease protein prow
           [Brucella melitensis bv. 1 str. 16M]
 gi|225642614|gb|ACO02527.1| binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis ATCC 23457]
 gi|260152451|gb|EEW87544.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262763723|gb|EEZ09755.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 3 str. Ether]
 gi|263000705|gb|EEZ13395.1| binding-protein-dependent transport system inner membrane component
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092082|gb|EEZ16379.1| prion protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326410891|gb|ADZ67955.1| binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis M28]
 gi|326554182|gb|ADZ88821.1| binding-protein-dependent transport systems inner membrane
           component [Brucella melitensis M5-90]
          Length = 301

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 112/267 (41%), Positives = 159/267 (59%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 7   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDAVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD +QT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 ILDLIQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|66048054|ref|YP_237895.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. syringae B728a]
 gi|289672073|ref|ZP_06492963.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. syringae FF5]
 gi|302188564|ref|ZP_07265237.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. syringae 642]
 gi|63258761|gb|AAY39857.1| Binding-protein-dependent transport systems inner membrane
           component [Pseudomonas syringae pv. syringae B728a]
 gi|330940565|gb|EGH43627.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330954740|gb|EGH55000.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae Cit 7]
 gi|330972984|gb|EGH73050.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330982273|gb|EGH80376.1| binding-protein dependent transport system inner membrane protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 283

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLMIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIVTTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|148557961|ref|YP_001257691.1| putative glycine betaine/L-proline ABC transporter permease
           [Brucella ovis ATCC 25840]
 gi|148369246|gb|ABQ62118.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Brucella ovis ATCC 25840]
          Length = 299

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 113/267 (42%), Positives = 159/267 (59%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 5   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 63

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 64  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDAVASIVRP 123

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 124 ILDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 183

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 184 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGGLGHTVLTGIQRLN 243

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 244 VGLGFEGGLAVVILAVILDRITQSFGK 270


>gi|60682640|ref|YP_212784.1| putative glycine betaine transport system permease protein
           [Bacteroides fragilis NCTC 9343]
 gi|60494074|emb|CAH08866.1| putative glycine betaine transport system permease protein
           [Bacteroides fragilis NCTC 9343]
          Length = 274

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 115/271 (42%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + L+  +   +N    +L  +P  + +  + LL    K
Sbjct: 2   INIGQYIEMLINWMMIHFSTFFDALNLGIGSFINGFQHILFGIPFYLTIAAMVLLAW-AK 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               +AV T +GLLLI   G+W+ T +TL+LVL ST +++ +GVP+GV  A   R   +I
Sbjct: 61  AGRGVAVFTLLGLLLIYGMGFWEATMQTLALVLSSTCLALIVGVPIGVWTANSNRAEKVI 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P FVYLIPA++ FGLG+VPG+ ATI+F++P  +RLT LGI   P  + EA
Sbjct: 121 HPILDLMQTMPAFVYLIPAVLFFGLGVVPGVFATIIFAMPPVIRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMVRRK 271


>gi|167743016|ref|ZP_02415790.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 14]
 gi|254183828|ref|ZP_04890420.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1655]
 gi|184214361|gb|EDU11404.1| glycine betaine/L-proline ABC transporter, permease protein
           [Burkholderia pseudomallei 1655]
          Length = 300

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 163/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     LV   LQ +P  + +     + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGRAIEGLAALVEHGLQAVPMWLMIACFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A  TA  L LI   G+W +T  TL L L ST +S+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFAFFTAASLFLIFATGFWDQTVVTLGLTLSSTIVSLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|19224203|gb|AAL86439.1|AF475089_2 transmembrane protein OtaB [Methanosarcina mazei Go1]
          Length = 277

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 129/273 (47%), Positives = 179/273 (65%), Gaps = 2/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+GDY++     +  N  W  +I+S  L   +      L   PPL+F  +++ L    
Sbjct: 5   KIPIGDYVEIAVYWIELNLGWLLDIISDFLGFMITGFRDFLMLFPPLIFALLIAALAYFT 64

Query: 68  KRSI-TIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGV-LAAWYPRFY 125
            +    +AVGT +GLLLI     W  + ETLSLV+ S F+++ IG+PLG+  A     F+
Sbjct: 65  GKKNLKLAVGTFVGLLLIENLRLWTLSMETLSLVISSAFLALVIGIPLGILAANISDFFF 124

Query: 126 SIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPIL 185
           ++++  LD MQT+P+FVYLIPAL+ FGLG VPG++AT+VF++P ++RLT LGI   P  L
Sbjct: 125 NVLKPILDLMQTMPSFVYLIPALIFFGLGNVPGMIATLVFAMPPTIRLTNLGIRQVPREL 184

Query: 186 KEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRA 245
           KE A AFG+TP+Q   KVELP A+P I+A + Q IMLSLSMVV+ A++G+ GLG  VL  
Sbjct: 185 KEVADAFGSTPWQKLVKVELPAALPTIMAGVNQCIMLSLSMVVIAAMIGARGLGYQVLFG 244

Query: 246 LNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           +  VDIG GFE+GL IVILA+ILDR+     P+
Sbjct: 245 IQRVDIGLGFEAGLGIVILAVILDRITQNLSPK 277


>gi|303246590|ref|ZP_07332868.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio fructosovorans JJ]
 gi|302491930|gb|EFL51808.1| binding-protein-dependent transport systems inner membrane
           component [Desulfovibrio fructosovorans JJ]
          Length = 278

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 121/272 (44%), Positives = 169/272 (62%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG  ++     L+ +       +S IL  A++ +   L  +PP   + V+++L   +
Sbjct: 7   RIPLGQGIEFSIDFLSDHLAPLTKSISLILETAIDAMGTALMAVPPWALIIVIAILAWRL 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             S  I +    GL L+   G W+ T  T+ LVL ST I+  IGVPLG+LAA  P +  I
Sbjct: 67  G-SRRIGLLALFGLTLVWDLGLWEPTISTIILVLFSTVIATSIGVPLGILAAMRPGWGRI 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPA+  FGLG V  I +T++F++P ++RLT LGI   P  L E
Sbjct: 126 IMPLLDFMQTMPAFVYLIPAIPFFGLGPVSAIFSTVIFAMPPAIRLTCLGIRQVPESLTE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGAT  Q  RKVELP A+P I+A + QTIMLSLSMVV+ A++G+ GLG  V +A+ 
Sbjct: 186 AADAFGATRMQRLRKVELPLALPTIMAGINQTIMLSLSMVVIAAMIGARGLGGEVWKAIQ 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            ++ G GFE+GL +VI+A+ILDR+      ++
Sbjct: 246 RLEPGLGFEAGLAVVIVAVILDRVTQKLGSKN 277


>gi|194017644|ref|ZP_03056255.1| glycine betaine transport system permease protein opuAB [Bacillus
           pumilus ATCC 7061]
 gi|194010916|gb|EDW20487.1| glycine betaine transport system permease protein opuAB [Bacillus
           pumilus ATCC 7061]
          Length = 284

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 112/272 (41%), Positives = 166/272 (61%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP  DY+ +F   LT     F + ++  L   VN ++ VL  +P ++   + + +   +
Sbjct: 9   RIPFADYIDQFVDWLTLTFGGFFDGITNGLAGTVNGIVAVLGVIPSIILTLIFAGIAWWI 68

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G LLI   GYW    +TL+LVL +  IS+ IGVP+G+ A+       I
Sbjct: 69  S-TRGIALFTLIGFLLIDYLGYWHPMLQTLALVLTAVVISIVIGVPIGIWASQKETVRKI 127

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++FS+P ++R+T LGI   P  L E
Sbjct: 128 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFSMPPTIRMTILGIKQVPADLIE 187

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T FQ   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 188 ATEAFGSTTFQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 247

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
            +  G GFE+G+ IVI+AI LDR+      + 
Sbjct: 248 QLKTGIGFEAGIAIVIVAITLDRITQNIKTKK 279


>gi|229030467|ref|ZP_04186507.1| Glycine betaine transport system permease protein opuAB [Bacillus
           cereus AH1271]
 gi|228730906|gb|EEL81846.1| Glycine betaine transport system permease protein opuAB [Bacillus
           cereus AH1271]
          Length = 278

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHLEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLIIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|295085035|emb|CBK66558.1| ABC-type proline/glycine betaine transport system, permease
           component [Bacteroides xylanisolvens XB1A]
          Length = 274

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 117/271 (43%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     VL  +P  + + V++ L  M  
Sbjct: 2   INIGQYIEMAINWMMVHFSTFFDAVNAGIGSFIIGFQHVLFGIPFYITILVLAALAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA+GLLLI   G+W+ T +TL+LV  ST +++ +GVPLGV  A  PR   I+
Sbjct: 62  GR-GTAIFTALGLLLIYGMGFWEATMQTLALVFSSTCLALIVGVPLGVWTANSPRAEKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGAVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|325521967|gb|EGD00659.1| choline ABC transporter, permease protein [Burkholderia sp. TJI49]
          Length = 298

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 112/269 (41%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHGLQAIPMWLMMAIFIGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +++
Sbjct: 64  VGWRFALFTTASLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAVV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|296332656|ref|ZP_06875116.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305673000|ref|YP_003864672.1| glycine betaine ABC transporter permease [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296149936|gb|EFG90825.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305411244|gb|ADM36363.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 282

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 108/273 (39%), Positives = 164/273 (60%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D +  F   +T     F + ++  L   VN ++  L ++P ++   + + L   +
Sbjct: 6   RIPLADMIDRFVDWITMTFGGFFDGIANGLAAFVNGIVSGLGFIPSILLTIIFAALAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G LLI   GYW    +TL+LVL S  IS+ +GVP+G+ A+       I
Sbjct: 66  S-TRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIISIVVGVPIGIWASQKETVRRI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G G E+G+ IVI+AI LDR+      + +
Sbjct: 245 QLKTGVGVEAGIAIVIVAITLDRITQNIKVKKK 277


>gi|260173414|ref|ZP_05759826.1| putative glycine betaine transport system permease protein
           [Bacteroides sp. D2]
 gi|315921686|ref|ZP_07917926.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313695561|gb|EFS32396.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 274

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 114/271 (42%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     +L  +P  + +  ++ +   VK
Sbjct: 2   INIGQYIEIAINWMMVHFSTFFDAVNAGIGSFITGFQHILFGIPFYLTILALAAIAW-VK 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
               I++ T +GLLLI   G+W+ T +TL+LVL ST +++  GVPLG+  A  PR   I+
Sbjct: 61  AGRGISIFTVLGLLLIYGMGFWEATMQTLALVLSSTCLALIFGVPLGIWTANSPRADKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPILDLMQTMPAFVYLIPAVLFFGLGTVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|206971955|ref|ZP_03232904.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus AH1134]
 gi|206733340|gb|EDZ50513.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus AH1134]
          Length = 278

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 118/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHLEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + +
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHTKRK 278


>gi|306841729|ref|ZP_07474415.1| binding-protein-dependent transport systems inner membrane
           component [Brucella sp. BO2]
 gi|306288134|gb|EFM59521.1| binding-protein-dependent transport systems inner membrane
           component [Brucella sp. BO2]
          Length = 301

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 113/267 (42%), Positives = 159/267 (59%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 7   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDTVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 ILDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ GLG  VL  +  ++
Sbjct: 186 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGGLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|108805376|ref|YP_645313.1| binding-protein-dependent transport systems inner membrane
           component [Rubrobacter xylanophilus DSM 9941]
 gi|108766619|gb|ABG05501.1| binding-protein-dependent transport systems inner membrane
           component [Rubrobacter xylanophilus DSM 9941]
          Length = 293

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 120/266 (45%), Positives = 175/266 (65%), Gaps = 2/266 (0%)

Query: 9   IPLGDYLQEFFVCLT-QNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
           IPL  +++ F   +T +  E F + L   L   V+++   L +LPPLV V V + L  +V
Sbjct: 12  IPLEGWVESFVDFITSETFEGFFDALEGFLNLLVDVLEAGLTFLPPLVMVAVFAGLAWLV 71

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             S  IA+ TA GLLL+     W++   TL+LV+ +T +++ +G+PLG++AA      ++
Sbjct: 72  S-SWRIALLTAAGLLLLQGLRLWEDAMLTLALVIAATAVALVVGIPLGIVAAKSRGVETV 130

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYL+PA+VL GLG  P +VA ++F++P +VRLT LG+        E
Sbjct: 131 LRPVLDFMQTMPAFVYLVPAIVLLGLGAAPALVAVVIFAMPPAVRLTMLGLQQVSKETVE 190

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGAT +Q  RKVELP A+P I+A + Q IMLSLSMVV+ AL+G+ GLG  V + L+
Sbjct: 191 AASAFGATGWQTLRKVELPLAMPTIMAGVNQVIMLSLSMVVIAALIGAGGLGEEVYQGLS 250

Query: 248 TVDIGRGFESGLCIVILAIILDRLFS 273
            +D+G+ F+ GL IVI+AI+LDR+  
Sbjct: 251 QLDVGKSFKGGLGIVIIAILLDRITR 276


>gi|217960227|ref|YP_002338787.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus AH187]
 gi|217064216|gb|ACJ78466.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus AH187]
          Length = 278

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLIIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|30262757|ref|NP_845134.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. Ames]
 gi|47528078|ref|YP_019427.1| glycine betaine/L-proline ABC transporter permease protein
           [Bacillus anthracis str. 'Ames Ancestor']
 gi|49185603|ref|YP_028855.1| glycine betaine/L-proline ABC transporter permease [Bacillus
           anthracis str. Sterne]
 gi|52142725|ref|YP_084104.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           cereus E33L]
 gi|65320082|ref|ZP_00393041.1| COG4176: ABC-type proline/glycine betaine transport system,
           permease component [Bacillus anthracis str. A2012]
 gi|165868422|ref|ZP_02213082.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0488]
 gi|167637784|ref|ZP_02396063.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0193]
 gi|170685429|ref|ZP_02876653.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0465]
 gi|170704600|ref|ZP_02895066.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0389]
 gi|177649738|ref|ZP_02932740.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0174]
 gi|190565236|ref|ZP_03018156.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis Tsiankovskii-I]
 gi|196043421|ref|ZP_03110659.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus 03BB108]
 gi|218903908|ref|YP_002451742.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus AH820]
 gi|225864762|ref|YP_002750140.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus 03BB102]
 gi|227814403|ref|YP_002814412.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. CDC 684]
 gi|229601264|ref|YP_002867064.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0248]
 gi|254685349|ref|ZP_05149209.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           anthracis str. CNEVA-9066]
 gi|254722757|ref|ZP_05184545.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           anthracis str. A1055]
 gi|254737805|ref|ZP_05195508.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           anthracis str. Western North America USA6153]
 gi|254752119|ref|ZP_05204156.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           anthracis str. Vollum]
 gi|254760640|ref|ZP_05212664.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           anthracis str. Australia 94]
 gi|300118748|ref|ZP_07056474.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           cereus SJ1]
 gi|301054307|ref|YP_003792518.1| glycine betaine/L-proline ABC transporter permease [Bacillus
           anthracis CI]
 gi|30257389|gb|AAP26620.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. Ames]
 gi|47503226|gb|AAT31902.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. 'Ames Ancestor']
 gi|49179530|gb|AAT54906.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. Sterne]
 gi|51976194|gb|AAU17744.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           cereus E33L]
 gi|164715148|gb|EDR20665.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0488]
 gi|167514333|gb|EDR89700.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0193]
 gi|170130401|gb|EDS99262.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0389]
 gi|170670789|gb|EDT21528.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0465]
 gi|172084812|gb|EDT69870.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0174]
 gi|190563263|gb|EDV17228.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis Tsiankovskii-I]
 gi|196025730|gb|EDX64399.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus 03BB108]
 gi|218538402|gb|ACK90800.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus AH820]
 gi|225786094|gb|ACO26311.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus 03BB102]
 gi|227004898|gb|ACP14641.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. CDC 684]
 gi|229265672|gb|ACQ47309.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus anthracis str. A0248]
 gi|298723905|gb|EFI64621.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           cereus SJ1]
 gi|300376476|gb|ADK05380.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           cereus biovar anthracis str. CI]
          Length = 278

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLIIIPAILMIILLCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|28872384|ref|NP_795003.1| histidine ABC transporter permease [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971438|ref|ZP_03399551.1| histidine ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301382155|ref|ZP_07230573.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. tomato Max13]
 gi|302060092|ref|ZP_07251633.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. tomato K40]
 gi|302132378|ref|ZP_07258368.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28855639|gb|AAO58698.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213923799|gb|EEB57381.1| histidine ABC transporter, permease protein [Pseudomonas syringae
           pv. tomato T1]
 gi|330874123|gb|EGH08272.1| histidine ABC transporter permease [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330965521|gb|EGH65781.1| histidine ABC transporter permease [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331017887|gb|EGH97943.1| histidine ABC transporter, permease protein, putative [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 283

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISETLLWAIVNLEGLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIITTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|298292114|ref|YP_003694053.1| binding-protein-dependent transporters inner membrane component
           [Starkeya novella DSM 506]
 gi|296928625|gb|ADH89434.1| binding-protein-dependent transport systems inner membrane
           component [Starkeya novella DSM 506]
          Length = 284

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 170/277 (61%), Gaps = 1/277 (0%)

Query: 4   IIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLL 63
                IPL ++        T++       +S ++   +  +   L  LPP + + +  LL
Sbjct: 3   FEIPRIPLAEWCDIALDWATEHFSGVTRAISAVIGTGIEEITDFLVGLPPWLVIVLFGLL 62

Query: 64  VLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPR 123
           +  +  +  IA+ + +G   +     W+ T ++L LVLVST  ++ IG+P+G+ AA   R
Sbjct: 63  IWRLT-TARIALFSMLGFAFLWNLELWRATMQSLVLVLVSTLFALAIGIPIGIGAALSKR 121

Query: 124 FYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPP 183
           F+ ++   LD MQT+P+FVYLIPA+  FGLG V    ATIVF++P ++RLT LGI+ TP 
Sbjct: 122 FWRVVAPALDMMQTMPSFVYLIPAIPFFGLGAVSACFATIVFAMPPTIRLTALGILETPS 181

Query: 184 ILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVL 243
            L EAA AFG++ +Q   KV+LP AIP I+A + QTIML+LSMVV+ A++G+ GLG  V 
Sbjct: 182 QLVEAADAFGSSRWQKLFKVQLPLAIPTIMAGINQTIMLALSMVVIAAMIGAGGLGGEVW 241

Query: 244 RALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +A+  ++ G+GF++G+ IV+LA+ILDR+        R
Sbjct: 242 KAIQRLEAGQGFQAGIAIVVLAVILDRITQHIARHMR 278


>gi|237802267|ref|ZP_04590728.1| histidine ABC transporter permease [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025124|gb|EGI05180.1| histidine ABC transporter permease [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 283

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 160/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + +++ +    L          +S  LL A+  +  +L+  P  + + +V  +    
Sbjct: 7   TFSIANWVNDGVDSLVTQYGDVFRHISETLLWAIVNLEGLLRMAPWWLMLIIVGGIAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R I   +     L L+   G W +  +TL+L+LV+T I++ IG+PLG+L+A   R  S+
Sbjct: 67  TRKIITTLVIVGLLFLVGAVGLWDKLMQTLALMLVATIIAVLIGIPLGILSARSNRLRSV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P+FVYLIP L+LFGLG VP I AT++++ P  +RLT LGI      + E
Sbjct: 127 LMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFGA  +Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  + 
Sbjct: 187 AINAFGANRWQQLFGVQLPLAMPSIMAGINQTTMMALSMVVIASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++GRG E+GL IVILA+++DR+      
Sbjct: 247 TLNVGRGLEAGLAIVILAVVIDRITQAYGR 276


>gi|16077368|ref|NP_388181.1| glycine betaine ABC transporter permease [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221308115|ref|ZP_03589962.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221312438|ref|ZP_03594243.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221317371|ref|ZP_03598665.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221321636|ref|ZP_03602930.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321313969|ref|YP_004206256.1| glycine betaine ABC transporter permease [Bacillus subtilis BSn5]
 gi|1171920|sp|P46921|OPUAB_BACSU RecName: Full=Glycine betaine transport system permease protein
           opuAB
 gi|984804|gb|AAC43456.1| transmembrane protein [Bacillus subtilis]
 gi|1805371|dbj|BAA08933.1| glycine betain/L-proline transmembrane protein [Bacillus subtilis]
 gi|2632585|emb|CAB12093.1| glycine betaine ABC transporter (permease) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291482686|dbj|BAI83761.1| glycine betaine ABC transporter, permease [Bacillus subtilis subsp.
           natto BEST195]
 gi|320020243|gb|ADV95229.1| glycine betaine ABC transporter (permease) [Bacillus subtilis BSn5]
          Length = 282

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 108/273 (39%), Positives = 164/273 (60%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D +  F   +T     F + ++  L   VN ++  L ++P ++   + + L   +
Sbjct: 6   RIPLADIIDRFVDWITMTFGGFFDGIANGLAAFVNGIVTGLGFIPSILLTIIFAALAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G LLI   GYW    +TL+LVL S  IS+ +GVP+G+ A+       I
Sbjct: 66  S-TRGIALFTLIGFLLIDYLGYWDPMLQTLALVLTSVIISIVVGVPIGIWASQKETVRRI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G G E+G+ IVI+AI LDR+      + +
Sbjct: 245 QLKTGVGVEAGIAIVIVAITLDRITQNIKVKKK 277


>gi|326772164|ref|ZP_08231449.1| glycine betaine/L-proline ABC transporter, permease protein
           [Actinomyces viscosus C505]
 gi|326638297|gb|EGE39198.1| glycine betaine/L-proline ABC transporter, permease protein
           [Actinomyces viscosus C505]
          Length = 292

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 168/269 (62%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG +++     +  +   F  ++S       + ++ VL  +PPLV V V  L+  + 
Sbjct: 10  KIPLGSWVETLINWIQMHLHGFLGLISQSGTSVNDALVDVLLAIPPLVMVVVFVLIAWLA 69

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +S  +AVGTA+  LLII  G W    ETL LV ++T  ++   +PLG+ AA      ++
Sbjct: 70  -KSWRLAVGTAVTFLLIISMGQWTNAMETLVLVTLATVTALIFAIPLGIWAARNKYVSAL 128

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIP+++ F +G+VPG+ AT++F++P  VR+T LGI        E
Sbjct: 129 VRPVLDLMQTMPAFVYLIPSVLFFSIGVVPGMFATLIFAMPPGVRMTELGIKQVDKETVE 188

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  +FGAT +Q+ R ++LP A+P I+A + Q IML+LSM V+  +VG++GLG  V++AL 
Sbjct: 189 AGRSFGATDWQILRGIQLPLAVPTIMAGVNQVIMLALSMAVIAGMVGADGLGKEVVKALA 248

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
           T+DI +G E+GL IV LAI LDR+ +   
Sbjct: 249 TIDIAKGTEAGLSIVFLAIFLDRVTAALG 277


>gi|227823271|ref|YP_002827243.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Sinorhizobium fredii NGR234]
 gi|227342272|gb|ACP26490.1| putative glycine betaine/L-proline ABC transporter, permease
           protein [Sinorhizobium fredii NGR234]
          Length = 285

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 168/269 (62%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           + +   + EF   L  N  W    +S ++LKAV  + ++L+ LP  + +     L     
Sbjct: 8   LSIRAPVNEFIQALVTNYGWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALAWQSS 67

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
           +  T+ +   + LL +   G W  T +TL+L+L++T +S+ IGVP+G+L A      ++ 
Sbjct: 68  KRWTLTLAVGVLLLAVGVLGLWDLTMQTLALMLMATIVSVVIGVPIGILVAKSRVVRNVT 127

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P+FVYLIPAL+LFGLG VP I+ATI++++P  +RLT LGI      + EA
Sbjct: 128 LPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDGEVVEA 187

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A AFG +P Q+   VELP A P I+A L QTIM++LSMVVV +++G+ GLG  VL  + T
Sbjct: 188 ATAFGGSPTQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQT 247

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +D+G+G E+G+ IVILAI+LDR+      
Sbjct: 248 LDVGKGLEAGIGIVILAIVLDRITQGFGK 276


>gi|218897809|ref|YP_002446220.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus G9842]
 gi|218544027|gb|ACK96421.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus G9842]
          Length = 278

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 182/280 (65%), Gaps = 2/280 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ I    IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++
Sbjct: 1   MNNI--PRIPLGEWVDSFVASLYEHLEGIFRGFSYIIGGFVDLLTNFLTIIPAILMIIIL 58

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
             L+    R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+ 
Sbjct: 59  CFLIWYTTRKVSLIIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQ 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
             RF   ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI  
Sbjct: 119 NERFSKFLKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQ 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EAA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV
Sbjct: 179 VPEDLIEAANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGV 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V R++  V+IG GFE+GL IV++AIILDR+      + +
Sbjct: 239 DVYRSVTQVNIGMGFEAGLAIVVIAIILDRITQGFHTKRK 278


>gi|160886481|ref|ZP_02067484.1| hypothetical protein BACOVA_04492 [Bacteroides ovatus ATCC 8483]
 gi|156108366|gb|EDO10111.1| hypothetical protein BACOVA_04492 [Bacteroides ovatus ATCC 8483]
          Length = 274

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 118/271 (43%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     VL  +P  + + V++ L  M  
Sbjct: 2   INIGQYIEMAINWMMVHFSTFFDAVNAGIGSFIIGFQHVLFGIPFYITILVLAALAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA+GLLLI   G+W+ T +TL+LV  ST +++ IGVPLGV  A  PR   I+
Sbjct: 62  GR-GTAIFTALGLLLIYGMGFWEATMQTLALVFSSTCLALIIGVPLGVWTANSPRAEKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGAVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|30020911|ref|NP_832542.1| glycine betaine transport system permease protein [Bacillus cereus
           ATCC 14579]
 gi|218232077|ref|YP_002367503.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus B4264]
 gi|29896464|gb|AAP09743.1| Glycine betaine transport system permease protein [Bacillus cereus
           ATCC 14579]
 gi|218160034|gb|ACK60026.1| glycine betaine/L-proline ABC transporter, permease protein
           [Bacillus cereus B4264]
          Length = 278

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 117/273 (42%), Positives = 178/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++   +   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLTIIPAILMIIILCFFIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKLSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + +
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHTKRK 278


>gi|237713750|ref|ZP_04544231.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262409343|ref|ZP_06085886.1| choline ABC transporter, permease [Bacteroides sp. 2_1_22]
 gi|294805993|ref|ZP_06764860.1| ABC transporter, permease protein [Bacteroides xylanisolvens SD CC
           1b]
 gi|229446197|gb|EEO51988.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262352795|gb|EEZ01892.1| choline ABC transporter, permease [Bacteroides sp. 2_1_22]
 gi|294446875|gb|EFG15475.1| ABC transporter, permease protein [Bacteroides xylanisolvens SD CC
           1b]
          Length = 274

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 117/271 (43%), Positives = 170/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     +  +   F + ++  +   +     VL  +P  + + V++ L  M  
Sbjct: 2   INIGQYIEMVINWMMVHFSTFFDAVNAGIGSFIIGFQHVLFGIPFYITILVLAALAWMKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA+GLLLI   G+W+ T +TL+LV  ST +++ +GVPLGV  A  PR   I+
Sbjct: 62  GR-GTAIFTALGLLLIYGMGFWEATMQTLALVFSSTCLALIVGVPLGVWTANSPRAEKIL 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG+ ATI+F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGAVPGVFATIIFAMPPVVRLTGLGIRQVPKNVVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           + +FGAT +Q+  KV+LP A+P I+  + QTIM+SLSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 SRSFGATRWQLLYKVQLPLALPTILTGVNQTIMMSLSMVVIAAMIAAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAIILDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIILDRITQGMAGRK 271


>gi|206564248|ref|YP_002235011.1| putative glycine-betaine ABC transporter permease [Burkholderia
           cenocepacia J2315]
 gi|198040288|emb|CAR56273.1| putative glycine-betaine binding ABC transporter permease protein
           [Burkholderia cenocepacia J2315]
          Length = 298

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHGLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTASLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|150397782|ref|YP_001328249.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium medicae WSM419]
 gi|150029297|gb|ABR61414.1| binding-protein-dependent transport systems inner membrane
           component [Sinorhizobium medicae WSM419]
          Length = 285

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 112/269 (41%), Positives = 167/269 (62%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           + +   + +F   L  N  W    +S ++LKAV  + ++L+ LP  + +     L     
Sbjct: 8   LSIRAPVNDFIQALVANYGWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALAWRSS 67

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
           R  ++ +     LL +   G W  T +TL+L+L++T +S+ IGVP+G+L A      +I 
Sbjct: 68  RRWSLTLAVGALLLAVGVLGLWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNIT 127

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
              LD MQT+P+FVYLIPAL+LFGLG VP I+ATI++++P  +RLT LGI      + EA
Sbjct: 128 LPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVEA 187

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A AFG +P Q+   VE+P A P I+A L QTIM++LSMVVV +++G+ GLG  VL  + T
Sbjct: 188 ATAFGGSPGQILFGVEMPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQT 247

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +D+G+G E+G+ IVILAI+LDR+      
Sbjct: 248 LDVGKGLEAGIGIVILAIVLDRITQGFGK 276


>gi|323530093|ref|YP_004232245.1| choline ABC transporter permease [Burkholderia sp. CCGE1001]
 gi|323387095|gb|ADX59185.1| choline ABC transporter, permease protein [Burkholderia sp.
           CCGE1001]
          Length = 300

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 162/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++      L  +     + +  ++     +V   LQ +P    +     + L  +
Sbjct: 5   IPLGAWVDHGVHYLLDHDAKTFDSIGKMIESFAAVVEHSLQAVPMWALMAFFVGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + +LLI   G+W +   TL L L STFIS+ +GVPLG+  A       ++
Sbjct: 64  VGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTFISLVLGVPLGIWTAKSRTVEMMV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVMLAIILDRITESFGR 272


>gi|167566077|ref|ZP_02358993.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia oklahomensis EO147]
 gi|167573155|ref|ZP_02366029.1| glycine betaine/L-proline ABC transporter, permease protein,
           putative [Burkholderia oklahomensis C6786]
          Length = 300

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 112/269 (41%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     LV   LQ +P    + +   + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAKTFDAIGRAIEGLAALVEHGLQAVPMWAMMALFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ TA+ L LI   G+W +   TL L L ST +S+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFAIFTALSLFLIFATGFWDQMIVTLGLTLSSTIVSLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|332703713|ref|ZP_08423801.1| ABC-type transporter, integral membrane subunit [Desulfovibrio
           africanus str. Walvis Bay]
 gi|332553862|gb|EGJ50906.1| ABC-type transporter, integral membrane subunit [Desulfovibrio
           africanus str. Walvis Bay]
          Length = 281

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 112/273 (41%), Positives = 171/273 (62%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG  ++     L ++  +     + ++   ++L++  + +LPP + + + + L   +
Sbjct: 8   KIPLGASIETSIDFLAEHLSFATKAFAKVVESGIDLLVGTMMFLPPWLLILLAAGLCWRL 67

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +S  +A+ T +GL LI   G+W  T  T++LVLV+T +++ IG+PLG+L A     Y +
Sbjct: 68  SKSRGVALFTMLGLGLIWNLGFWSPTISTIALVLVATSLAIIIGMPLGILTALSQPAYRL 127

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPA+  FGLG V  I +T++F++P ++RLT LGI   P  L E
Sbjct: 128 IMPVLDFMQTMPAFVYLIPAIPFFGLGKVAAIFSTVIFAMPPAIRLTCLGIRQVPRELVE 187

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFGAT  Q   K++LP A   I+A + QT+ML+LSMVVV A++G+ GLG  V +A+ 
Sbjct: 188 ASDAFGATRGQKLLKLQLPMAASTIMAGVNQTVMLALSMVVVAAMIGAKGLGGEVWKAIQ 247

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +D  RGFE+GL IVI+A+I DR+      R R
Sbjct: 248 RLDPARGFEAGLGIVIVAMIFDRVMQRIVVRKR 280


>gi|15600570|ref|NP_254064.1| permease of ABC transporter [Pseudomonas aeruginosa PAO1]
 gi|107104479|ref|ZP_01368397.1| hypothetical protein PaerPA_01005556 [Pseudomonas aeruginosa PACS2]
 gi|116053524|ref|YP_793851.1| putative BC-type proline/glycine betaine transport system, permease
           component [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894480|ref|YP_002443350.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
 gi|254237937|ref|ZP_04931260.1| hypothetical protein PACG_04041 [Pseudomonas aeruginosa C3719]
 gi|254242929|ref|ZP_04936251.1| hypothetical protein PA2G_03715 [Pseudomonas aeruginosa 2192]
 gi|296392237|ref|ZP_06881712.1| glycine/betaine/L-proline ABC transporter, permease protein
           [Pseudomonas aeruginosa PAb1]
 gi|313111693|ref|ZP_07797487.1| putative BC-type proline/glycine betaine transport system, permease
           component [Pseudomonas aeruginosa 39016]
 gi|9951700|gb|AAG08762.1|AE004950_5 probable permease of ABC transporter [Pseudomonas aeruginosa PAO1]
 gi|115588745|gb|ABJ14760.1| putative BC-type proline/glycine betaine transport system, permease
           component [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169868|gb|EAZ55379.1| hypothetical protein PACG_04041 [Pseudomonas aeruginosa C3719]
 gi|126196307|gb|EAZ60370.1| hypothetical protein PA2G_03715 [Pseudomonas aeruginosa 2192]
 gi|218774709|emb|CAW30526.1| probable permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
 gi|310883989|gb|EFQ42583.1| putative BC-type proline/glycine betaine transport system, permease
           component [Pseudomonas aeruginosa 39016]
          Length = 279

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 129/271 (47%), Positives = 182/271 (67%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            +    +PLG+ +  F   LT +G  F + +S  L   ++ V   L +  PLV + ++  
Sbjct: 2   FLTDHKLPLGEQIAGFVDWLTLHGASFFDKISDTLEFLIHGVTNGLLWFNPLVLIALLVG 61

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           LV  ++RS  + V     LLLI+  GYWQET ETL+ V+ +T + + +GVPLG++AA  P
Sbjct: 62  LVHFIQRSWGLTVFALASLLLILNLGYWQETMETLAQVIFATLVCIAVGVPLGIVAAHKP 121

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
            FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T++F++   +RLT LGI   P
Sbjct: 122 WFYTALRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVIFAVAAPIRLTCLGIQDVP 181

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L +A  AFG + +Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV
Sbjct: 182 AELLDAGKAFGCSRWQLLTRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV 241

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           + ALNT DI  GFE+GL IV+LAI+LDR+  
Sbjct: 242 VNALNTADISLGFEAGLAIVLLAILLDRVCK 272


>gi|209520159|ref|ZP_03268932.1| choline ABC transporter, permease protein [Burkholderia sp. H160]
 gi|209499423|gb|EDZ99505.1| choline ABC transporter, permease protein [Burkholderia sp. H160]
          Length = 300

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 111/270 (41%), Positives = 160/270 (59%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG ++      L  +     +++  ++      V   LQ +P    +     + L  
Sbjct: 4   VIPLGAWVDHGVHYLLDHDAKTFDMIGKVIESFAASVEHGLQAVPMWALMAFFVGIGLW- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +     A+ T   LLLI   G+W +   TL L L ST IS+ +GVPLG+  A       I
Sbjct: 63  RVGWRFALFTLAALLLIYGTGFWDQMVITLGLTLSSTVISLVLGVPLGIWMAKSRTVEMI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + E
Sbjct: 123 VRPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTALGIKHVNHEIVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++ 
Sbjct: 183 AGQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            +DIG GFESG+ +V+LAIILDR+      
Sbjct: 243 RLDIGLGFESGMSVVMLAIILDRITESFGR 272


>gi|229589718|ref|YP_002871837.1| putative ATP-binding protein/permease [Pseudomonas fluorescens
           SBW25]
 gi|229361584|emb|CAY48461.1| Putative bi-functional protein (ATP-binding and permease)
           [Pseudomonas fluorescens SBW25]
          Length = 733

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 97/268 (36%), Positives = 144/268 (53%), Gaps = 1/268 (0%)

Query: 12  GDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSI 71
              + EF        E     +   +   +  +  +L +LP  V    +  L        
Sbjct: 462 AQSIDEFIGWSQVTFEGAFVGVIVAVRTVIEGIENLLGWLPWPVSALTLVFLAWRSAGLP 521

Query: 72  TIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLF 131
            +A+ ++  LL I   G+W+ T  TL+LV  S  I++ IGVP G+L A  P    +I   
Sbjct: 522 -LALTSSAALLYIGLFGFWERTIATLALVGSSVLIALVIGVPTGILLAKRPLLRRVITPL 580

Query: 132 LDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACA 191
           LD MQT+PTFVYLIPA+  F +G  P ++AT++F++   +RLT LGI        EAA A
Sbjct: 581 LDVMQTLPTFVYLIPAVAFFSVGKTPAVIATVIFALAPMIRLTSLGIQEVAKDAVEAAVA 640

Query: 192 FGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDI 251
            GA+P+Q   KV+LP A   ++  + QTI++SLSMVVV AL+G+ GLG  V+ AL  +  
Sbjct: 641 HGASPWQTLIKVQLPLARRSLLLGINQTIVMSLSMVVVAALIGAGGLGYDVMTALRNIKG 700

Query: 252 GRGFESGLCIVILAIILDRLFSIPDPRD 279
           G G  +G+ IV+ A+I DR+      + 
Sbjct: 701 GEGVLAGVAIVLCALIPDRIIQSSLRKQ 728


>gi|108762126|ref|YP_630471.1| glycine betaine/L-proline ABC transporter permease [Myxococcus
           xanthus DK 1622]
 gi|108466006|gb|ABF91191.1| glycine betaine/L-proline ABC transporter, permease protein
           [Myxococcus xanthus DK 1622]
          Length = 277

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 116/270 (42%), Positives = 168/270 (62%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            + +G+  +E    +   G    + +   L   +N +   L   P    + V+ +L   +
Sbjct: 3   TLRIGEGFEELIDWMGTRGAPVFDAIRSGLTACINGLESALLLPPSYAIITVLMVLAWRL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
                 AV TA+G+LLI   G W+ T ETL+LVL S  +++ +G+PLG+ AA+      +
Sbjct: 63  SGL-GTAVFTALGMLLIQDMGLWKATMETLALVLSSAMVALVLGIPLGIWAAYSRVVERV 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA++ F LG VPG+VAT++F++P +VRLT LGI   P  + E
Sbjct: 122 LRPALDLMQTMPAFVYLIPAVLFFRLGKVPGVVATVIFAMPPAVRLTNLGIRQVPTEVVE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGATP Q    V+LP A+P ++A + QTIMLSLSMVV++A++G+ GLG  VL+ + 
Sbjct: 182 AAIAFGATPRQTLLNVQLPIAVPTLLAGVNQTIMLSLSMVVISAMIGAGGLGEQVLKGIT 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            + IG GFESG+ +VILAI+LDRL      
Sbjct: 242 QLRIGLGFESGIAVVILAIVLDRLTHALGK 271


>gi|167584096|ref|ZP_02376484.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia ubonensis Bu]
          Length = 298

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGRWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHSLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTASLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|150390569|ref|YP_001320618.1| binding-protein-dependent transport systems inner membrane
           component [Alkaliphilus metalliredigens QYMF]
 gi|149950431|gb|ABR48959.1| binding-protein-dependent transport systems inner membrane
           component [Alkaliphilus metalliredigens QYMF]
          Length = 287

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 111/275 (40%), Positives = 163/275 (59%)

Query: 6   QAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVL 65
           Q  +P+GD ++ F   LT N  +    +S  L  A+      +    P + + ++  L+ 
Sbjct: 11  QQKLPIGDVIESFIDFLTTNFRFVFRQISERLDWALTFFEEDILLRVPPLLLILLIALLA 70

Query: 66  MVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFY 125
               S  + + + +GLLL+   G W  T  TLS+VL ST IS+ +G+P+G+L A      
Sbjct: 71  WRVASKGVGIFSFLGLLLVYNLGLWVPTMSTLSMVLTSTVISIMLGIPIGILIAKNQIMN 130

Query: 126 SIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPIL 185
            II   +D MQT+P FVYLIPA+  F +G VPGI AT++FSI   +RLT LGI   P  L
Sbjct: 131 RIIMPIMDLMQTMPAFVYLIPAVSFFRMGKVPGIFATVIFSIAPCIRLTNLGIRQVPEEL 190

Query: 186 KEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRA 245
            EAA AFG+T  Q   KV+ P A+  I+A + QTIMLSLSMVV++A++G+ GLG  V   
Sbjct: 191 IEAADAFGSTGAQKLMKVQFPLALSTIMAGVNQTIMLSLSMVVISAMIGAGGLGREVWHG 250

Query: 246 LNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +  + +G  FE+G+ +VILA+ILDR+      +++
Sbjct: 251 IQRLQVGSAFEAGIAVVILAMILDRITQSIAIKNK 285


>gi|221200703|ref|ZP_03573744.1| glycine betaine transport system permease protein opuAB
           [Burkholderia multivorans CGD2M]
 gi|221206899|ref|ZP_03579910.1| glycine betaine transport system permease protein opuAB
           [Burkholderia multivorans CGD2]
 gi|221172973|gb|EEE05409.1| glycine betaine transport system permease protein opuAB
           [Burkholderia multivorans CGD2]
 gi|221179275|gb|EEE11681.1| glycine betaine transport system permease protein opuAB
           [Burkholderia multivorans CGD2M]
          Length = 295

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 115/266 (43%), Positives = 163/266 (61%), Gaps = 1/266 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G + + F   L  +     +  S  L   V L+   L  +P +  V ++  + L  +R 
Sbjct: 6   IGKFAENFVNFLFLHFRGGFDTFSAGLGAVVKLLEDGLAAVPFIAMVVILVGVALW-RRG 64

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           I  +V   + L +I   G W +T  TL+LV  +TF S+ IGVPLG+  A   R   I+R 
Sbjct: 65  IVFSVFVGLALFVIHYMGLWAQTVSTLALVTAATFFSLVIGVPLGIWGARNNRIGMILRS 124

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA++LFGLG VP ++ATIVF++P  VRLT LGI      L EA  
Sbjct: 125 LLDFMQTMPAFVYLIPAVILFGLGRVPAVIATIVFAMPPVVRLTTLGIRQVREELIEAGR 184

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           +FG+T +Q+  K++LP A+P I+A + QTIM++LSMVVV +++G+ GLG  VL  +  +D
Sbjct: 185 SFGSTDWQLLWKIQLPNALPSIMAGVNQTIMMALSMVVVASMIGAGGLGEYVLSGIQRLD 244

Query: 251 IGRGFESGLCIVILAIILDRLFSIPD 276
           IG GFE GL +V+LAI+LDRL     
Sbjct: 245 IGIGFEGGLGVVLLAIVLDRLTESFG 270


>gi|171316855|ref|ZP_02906065.1| choline ABC transporter, permease protein [Burkholderia ambifaria
           MEX-5]
 gi|171098025|gb|EDT42842.1| choline ABC transporter, permease protein [Burkholderia ambifaria
           MEX-5]
          Length = 298

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 114/269 (42%), Positives = 163/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++      L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGTWVDRSVHYLLDHDAATFDAIGRAIEGLAAFVEHGLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +T  TL L L ST IS+ +G+PLGV AA      +I+
Sbjct: 64  VGWRFALFTTASLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGVWAAKSKLVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|121610976|ref|YP_998783.1| binding-protein-dependent transport systems inner membrane
           component [Verminephrobacter eiseniae EF01-2]
 gi|121555616|gb|ABM59765.1| binding-protein-dependent transport systems inner membrane
           component [Verminephrobacter eiseniae EF01-2]
          Length = 290

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 111/268 (41%), Positives = 163/268 (60%), Gaps = 1/268 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           +PLG ++ E    L  +G    + +  ++      +   +  +P  + + VVS++    +
Sbjct: 16  LPLGRWVNEGVKLLLDHGATVFDSVGVMVEAFAQWIEQGMLAIPFWLTIAVVSVIGWR-R 74

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                 +   + L LI+  G+W +T  TL+L L +T IS+F G+PLG+  A   R  + +
Sbjct: 75  LGAGFGMFVLLALALIVVTGFWPQTMVTLALTLSATLISLFFGIPLGIGCARSNRVNACV 134

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPG +AT++F++P  VRLT LGI        EA
Sbjct: 135 RPVLDFMQTMPAFVYLIPAAMLFGLGRVPGTIATVIFAMPPVVRLTSLGIRQVSTEQVEA 194

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG T  Q+  KV+LP A+P I+A + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 195 GNAFGCTSTQLLFKVQLPIAMPTIMAGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 254

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPD 276
           +DIG GFESGL +V+LAIILDRL     
Sbjct: 255 LDIGLGFESGLAVVLLAIILDRLTESFG 282


>gi|297538477|ref|YP_003674246.1| binding-protein-dependent transport systems inner membrane
           component [Methylotenera sp. 301]
 gi|297257824|gb|ADI29669.1| binding-protein-dependent transport systems inner membrane
           component [Methylotenera sp. 301]
          Length = 281

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 106/276 (38%), Positives = 163/276 (59%), Gaps = 1/276 (0%)

Query: 5   IQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLV 64
           +   IPLG+++      L  N     N +  I+  +   +   LQ +P  +F  +   + 
Sbjct: 1   MSYKIPLGEWVAGAVGWLEVNDHGLFNGMGAIINSSTAGIENGLQAIPFWLFAILFIAIG 60

Query: 65  LMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
              +      +  A  L LI   G+  +T  TL+L++ +T IS+ +G+PLG+ A    + 
Sbjct: 61  YW-RLGWKFGLFCAASLWLIDNMGFTAQTLVTLALIISATLISLTVGIPLGIWAGRNDKA 119

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
            + IR  LD MQT+P FVYLIPA + FGLG VPG++AT++F++P  VRLT LGI      
Sbjct: 120 EATIRPVLDFMQTMPAFVYLIPAAMFFGLGRVPGVIATVIFAMPPVVRLTSLGIRQVNKE 179

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
             EA  AFG TP Q+  KV++P A+  + A + QTIM++LSMV++ ++VG+ GLG  VL 
Sbjct: 180 QVEAGIAFGCTPTQLLMKVQIPSAMAALFAGINQTIMMALSMVIIASMVGAGGLGNDVLS 239

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +++ +DIG GFESGL +V+LAI+LDR+      + +
Sbjct: 240 SISRLDIGLGFESGLGVVLLAIMLDRITESFGVKRK 275


>gi|295699467|ref|YP_003607360.1| choline ABC transporter permease [Burkholderia sp. CCGE1002]
 gi|295438680|gb|ADG17849.1| choline ABC transporter, permease protein [Burkholderia sp.
           CCGE1002]
          Length = 300

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 110/269 (40%), Positives = 159/269 (59%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IP+G ++      L  +     + +  ++      V   LQ +P    +     + L  +
Sbjct: 5   IPIGAWVDHGVHYLLDHDAKTFDTIGKVIESFAAAVEHSLQAVPMWALMAFFVGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +   TL L L ST IS+ +GVPLG+  A       I+
Sbjct: 64  VGWRFALFTLAALLLIYGTGFWDQMVITLGLTLSSTVISLVLGVPLGIWMAKSRTVEMIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTALGIKHVNHEIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESG+ +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGMSVVMLAIILDRITESFGR 272


>gi|170748909|ref|YP_001755169.1| binding-protein-dependent transport systems inner membrane
           component [Methylobacterium radiotolerans JCM 2831]
 gi|170655431|gb|ACB24486.1| binding-protein-dependent transport systems inner membrane
           component [Methylobacterium radiotolerans JCM 2831]
          Length = 283

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 110/278 (39%), Positives = 159/278 (57%), Gaps = 2/278 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M   +    PL     +    LT +G W    +S  +   ++ +   L  +PP   + V 
Sbjct: 1   MDWNV-PKFPLDTLSDDGLDWLTDHGAWLTRAVSRSVSNGIDTLTAALISVPPWAVIAVA 59

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +L    V     + + T  GLL +     WQ T ETL LV ++T +++ IG+P+G+  A 
Sbjct: 60  ALATYKVGGR-KVGLLTLAGLLFLWDLRLWQSTVETLVLVSLATVMALLIGIPVGIWFAL 118

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
               + +    LD MQT+P+FVYLIPAL  FGLG V    ATI+FS+P  +RLT LGI +
Sbjct: 119 SRWAWKVFSPVLDMMQTLPSFVYLIPALPFFGLGAVSACFATIIFSVPPVIRLTTLGIRN 178

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA+ AFG +  Q   KV+LP A+P I+A + QT+ML+LSMVV+ A++G+ GLG 
Sbjct: 179 VPTELIEASDAFGGSATQKLLKVQLPLALPTIMAGVNQTMMLALSMVVIAAMIGAGGLGR 238

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
            V +++  ++ G GFE+GL IVILA+ILDR       R
Sbjct: 239 EVWQSIQRLEAGAGFEAGLGIVILAVILDRFTQALAAR 276


>gi|107025553|ref|YP_623064.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia cenocepacia AU 1054]
 gi|116693264|ref|YP_838797.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia cenocepacia HI2424]
 gi|170737468|ref|YP_001778728.1| choline ABC transporter, permease protein [Burkholderia cenocepacia
           MC0-3]
 gi|105894927|gb|ABF78091.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia cenocepacia AU 1054]
 gi|116651264|gb|ABK11904.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia cenocepacia HI2424]
 gi|169819656|gb|ACA94238.1| choline ABC transporter, permease protein [Burkholderia cenocepacia
           MC0-3]
          Length = 298

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGTWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHGLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|49479143|ref|YP_036874.1| glycine betaine/L-proline ABC transporter permease [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|49330699|gb|AAT61345.1| glycine betaine/L-proline ABC transporter, permease [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 278

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 119/273 (43%), Positives = 180/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E    + S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRVFSYIIGGFVDLLTNFLIIIPAILMIILLCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKVSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + R
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHQKRR 278


>gi|311070951|ref|YP_003975874.1| glycine betaine ABC transporter permease [Bacillus atrophaeus 1942]
 gi|310871468|gb|ADP34943.1| glycine betaine ABC transporter (permease) [Bacillus atrophaeus
           1942]
          Length = 282

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 110/273 (40%), Positives = 164/273 (60%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL D +  F   LT     F + ++  L   VN ++  L Y+P ++   + + L   +
Sbjct: 6   RIPLADIIDRFVDWLTLTFGGFFDGIATGLAVFVNGIVTGLGYIPSILLTLIFAALAWWI 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
             +  IA+ T +G L+I   GYW    +TL+LVL S  IS+ +GVP+GV A+       I
Sbjct: 66  S-TRGIALFTLIGFLVIDYLGYWDPMLQTLALVLTSVIISVVVGVPIGVWASQKESVRRI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYL+PA+  F +G+VPG+VA+++F++P ++R+T LGI   P  L E
Sbjct: 125 VTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFAMPPTIRMTVLGIKQVPADLIE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG+T  Q   KV+LP A   I+A + Q+IML+LSMVV+ A+VG+ GLG  V  A+ 
Sbjct: 185 ATEAFGSTTSQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVYSAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            +  G G E+G+ IVI+AI LDR+      + +
Sbjct: 245 QLKTGIGVEAGIAIVIVAITLDRITQNIKVKKK 277


>gi|326940556|gb|AEA16452.1| glycine betaine transport system permease protein [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 278

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 118/273 (43%), Positives = 179/273 (65%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG+++  F   L ++ E      S+I+   V+L+   L  +P ++ + ++  L+   
Sbjct: 6   RIPLGEWVDSFVASLYEHFEGLFRGFSYIIGGFVDLLTNFLIIIPAILMIIILCFLIWYT 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R +++ + T +GLL I+   YW +T +TL+LVL S  IS+ +G+P+G+LA+   RF   
Sbjct: 66  TRKLSLVIFTLIGLLFILNINYWAQTMQTLALVLTSVIISIIVGIPIGILASQNERFSKF 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           ++  LD MQT+P FVYLIPA+  FG+G+VPGI+A+++F++P ++R T LGI   P  L E
Sbjct: 126 LKPTLDFMQTMPAFVYLIPAITFFGVGVVPGIIASVIFAMPPTIRFTDLGIRQVPEDLIE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A   I+A + Q+IMLSLSMVV  +LVG+ GLGV V R++ 
Sbjct: 186 AANAFGSTASQKLFKVQLPLATGTIMAGVNQSIMLSLSMVVTASLVGAPGLGVDVYRSVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            V+IG GFE+GL IV++AIILDR+      + +
Sbjct: 246 QVNIGMGFEAGLAIVVIAIILDRITQGFHTKRK 278


>gi|115359312|ref|YP_776450.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia ambifaria AMMD]
 gi|170697541|ref|ZP_02888631.1| choline ABC transporter, permease protein [Burkholderia ambifaria
           IOP40-10]
 gi|172064102|ref|YP_001811753.1| choline ABC transporter, permease protein [Burkholderia ambifaria
           MC40-6]
 gi|115284600|gb|ABI90116.1| binding-protein-dependent transport systems inner membrane
           component [Burkholderia ambifaria AMMD]
 gi|170137564|gb|EDT05802.1| choline ABC transporter, permease protein [Burkholderia ambifaria
           IOP40-10]
 gi|171996619|gb|ACB67537.1| choline ABC transporter, permease protein [Burkholderia ambifaria
           MC40-6]
          Length = 298

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++      L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGTWVDRSVHYLLDHDAATFDAIGRAIEGLAAFVEHGLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKLVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|254254558|ref|ZP_04947875.1| ABC transporter membrane-spanning permease - choline transporter
           [Burkholderia dolosa AUO158]
 gi|124899203|gb|EAY71046.1| ABC transporter membrane-spanning permease - choline transporter
           [Burkholderia dolosa AUO158]
          Length = 298

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     L+   LQ +P  + +     + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAATFDAIGRAIEGLAALIEHGLQAVPMWLMMAFFIGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|254249915|ref|ZP_04943235.1| Binding-protein-dependent transport systems inner membrane
           component [Burkholderia cenocepacia PC184]
 gi|124876416|gb|EAY66406.1| Binding-protein-dependent transport systems inner membrane
           component [Burkholderia cenocepacia PC184]
          Length = 298

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGTWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHGLQAIPMWLMMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|154490975|ref|ZP_02030916.1| hypothetical protein PARMER_00892 [Parabacteroides merdae ATCC
           43184]
 gi|154088723|gb|EDN87767.1| hypothetical protein PARMER_00892 [Parabacteroides merdae ATCC
           43184]
          Length = 271

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 112/271 (41%), Positives = 168/271 (61%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT+N     ++++ I+   ++    +L ++P  + +  ++ L     
Sbjct: 2   INIGKYIEMAINWLTENFAGLFDVINHIVGGFIDGFQGILMWVPFYLMIAGIAALAWWKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                AV T +GLLLI   G+W +T +T++LVL ST I++  GVPLG+      +   +I
Sbjct: 62  GK-GTAVLTLLGLLLIWGMGFWVQTMQTVALVLSSTIIALLFGVPLGIWTGRNDKAAKVI 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGPVPGAFATVIFAMPPVVRLTDLGIRQVPEDIVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             +FGAT  Q+  KV+LP A+P I+A + QTIM++LSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 TRSFGATSGQLLFKVQLPLALPTIMAGVNQTIMMALSMVVIAAMISAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAI+LDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIVLDRITQGFVRRK 271


>gi|84386103|ref|ZP_00989132.1| putative permease of ABC transporter [Vibrio splendidus 12B01]
 gi|84378873|gb|EAP95727.1| putative permease of ABC transporter [Vibrio splendidus 12B01]
          Length = 266

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 126/265 (47%), Positives = 181/265 (68%)

Query: 15  LQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIA 74
           ++     LT N   F + +S  L   +  ++ V +++PP + + + + +   + R  ++ 
Sbjct: 1   MEAGVDWLTINAAGFFDAISIFLETVIMFLVDVFKWMPPALPIVMTAAIAWYLHRKPSLV 60

Query: 75  VGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDS 134
           +     LL I+  GYWQE  ET  LV  +T IS+ IGVP+G++AA  P  Y+++R  LD 
Sbjct: 61  IFVVAALLTILNLGYWQEMLETFVLVFAATTISVLIGVPVGIMAAHRPWLYTVLRPILDL 120

Query: 135 MQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGA 194
           MQT+PTFVYLIP LVLFGLG+VPG+++TI+F+I   +RLT LG+   P  L EA  AFGA
Sbjct: 121 MQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLGVTKVPEELIEAGKAFGA 180

Query: 195 TPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRG 254
           +  ++  KVELP A+P I+A +TQ IMLSLSMVV+ ALVG++GLG PV+RALNTV+I +G
Sbjct: 181 SRMKLLMKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGADGLGKPVVRALNTVNISQG 240

Query: 255 FESGLCIVILAIILDRLFSIPDPRD 279
           FE+GL IV++AIILDRL   P+ ++
Sbjct: 241 FEAGLAIVLVAIILDRLCKTPNQKE 265


>gi|116254539|ref|YP_770375.1| putative glycine betaine/L-proline transport system permease
           protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115259187|emb|CAK10305.1| putative glycine betaine/L-proline transport system permease
           protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 293

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 109/267 (40%), Positives = 157/267 (58%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G+ +      +  N     + ++  +    + +   L  +P  V + +  +L L  +  
Sbjct: 5   IGNGIDAAVNYVLDNFSPLLDAIAATIGFVTDGIQNALLAIPMPVGIAIFVILSLW-RVG 63

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           I  AV TA+GLLL+     W    ETLSLV+ ST I+M +G+PLG+  A      + +R 
Sbjct: 64  IGFAVFTALGLLLVNHIALWGPMMETLSLVIASTLIAMLVGLPLGISMARKDSVAAFVRP 123

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++FS+P   RLT LGI        EA  
Sbjct: 124 VLDLMQTMPAFVYLIPAAMFFGLGAVPGAIATVIFSMPPVARLTNLGIRQVDGEFIEAGN 183

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+ G+G  VL  +  +D
Sbjct: 184 AFGCTATQLLFKVQLPNALPSIMAGINQTIMLSLSMVVIASMIGAGGIGNTVLTGIQRLD 243

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE G+ +VILA+ILDR+      
Sbjct: 244 VGTGFEGGIAVVILAVILDRITQSLGK 270


>gi|218261441|ref|ZP_03476256.1| hypothetical protein PRABACTJOHN_01922 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224016|gb|EEC96666.1| hypothetical protein PRABACTJOHN_01922 [Parabacteroides johnsonii
           DSM 18315]
          Length = 271

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 112/271 (41%), Positives = 169/271 (62%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           I +G Y++     LT+N     ++++ I+   ++    +L ++P  + +  ++ L     
Sbjct: 2   INIGKYIEMAINWLTENFAGLFDVINHIVGGFIDGFQGILMWVPFYLMIAGIAALAWWKA 61

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                AV T +GLLLI   G+W +T +T++LVL ST I++ +GVPLG+      +   +I
Sbjct: 62  GK-GTAVLTLLGLLLIWGMGFWVQTMQTVALVLSSTIIALLLGVPLGIWTGRNDKAAKVI 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ FGLG VPG  AT++F++P  VRLT LGI   P  + EA
Sbjct: 121 RPVLDLMQTMPAFVYLIPAVLFFGLGPVPGAFATVIFAMPPVVRLTDLGIRQVPEDIVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             +FGAT  Q+  KV+LP A+P I+A + QTIM++LSMVV+ A++ + GLG  VL+ +  
Sbjct: 181 TRSFGATSGQLLFKVQLPLALPTIMAGVNQTIMMALSMVVIAAMISAGGLGEIVLKGITQ 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDPRD 279
           + IG GFE G+ +VILAI+LDR+      R 
Sbjct: 241 MKIGLGFEGGIAVVILAIVLDRITQGFVRRK 271


>gi|119945744|ref|YP_943424.1| ABC transporter substrate binding inner membrane protein
           [Psychromonas ingrahamii 37]
 gi|119864348|gb|ABM03825.1| ABC transporter substrate binding inner membrane protein
           [Psychromonas ingrahamii 37]
          Length = 291

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 130/273 (47%), Positives = 179/273 (65%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           MS I +  +P+G +       L      F + +S +L   +  ++  L  +PP +F+ +V
Sbjct: 17  MSFITEYKLPIGQWAATMMDGLITYCGSFFDAISMVLDVMIESLVDFLSMMPPWLFIIIV 76

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           + L+   +R+  +     + LLLI   GYW+ET ET SL++ +T   + +GVP+G+ AA 
Sbjct: 77  AGLIFWQQRNKAVTAFFILSLLLIWNLGYWEETIETFSLIIYATGFCVLLGVPIGIAAAH 136

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            PR Y  IR  LD MQTIP FVYLIPAL LFGLG+VPG+++TIVF+I   +RLT LGI  
Sbjct: 137 RPRLYRFIRPLLDLMQTIPPFVYLIPALTLFGLGVVPGLISTIVFAIAAPIRLTHLGISQ 196

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
            P  L EA  AFG T   +  KVE+P A+  I A +TQ IMLSLSMVV++ALVG++GLG 
Sbjct: 197 VPLELLEAGRAFGCTKRSLLLKVEIPAAMSSIRAGITQCIMLSLSMVVISALVGADGLGK 256

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           PV+RALNTV+I  GFE+GL IV++AI+LDR+F 
Sbjct: 257 PVVRALNTVNIATGFEAGLAIVLVAIMLDRIFK 289


>gi|78061306|ref|YP_371214.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Burkholderia sp. 383]
 gi|77969191|gb|ABB10570.1| ABC glycine betaine/L-proline transporter, inner membrane subunit
           [Burkholderia sp. 383]
          Length = 298

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 164/269 (60%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +      V   LQ +P  + + +   + L  +
Sbjct: 5   IPLGTWVDQSVHYLLDHDAKTFDAIGQAIEGLAAFVEHGLQAIPMWMMMAIFIGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T   LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTASLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|302553673|ref|ZP_07306015.1| glycine betaine ABC transport system integral membrane protein
           [Streptomyces viridochromogenes DSM 40736]
 gi|302471291|gb|EFL34384.1| glycine betaine ABC transport system integral membrane protein
           [Streptomyces viridochromogenes DSM 40736]
          Length = 662

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 85/277 (30%), Positives = 148/277 (53%), Gaps = 7/277 (2%)

Query: 8   PIPLGDYLQEFFVCLTQN------GEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVS 61
            +     L +    +  N        +F   +S +++ AV  V   L  +       + +
Sbjct: 54  TLDFSAPLAKASDWIIDNRDSHPLFLYFFGHVSNVVVIAVRAVYLTLLAIGWAGVTALGA 113

Query: 62  LLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWY 121
           L+   V   + +A+GTA+  L     G W  T +TL+L++V+   S+ +GV LG+ A   
Sbjct: 114 LVAWRVAG-VKLALGTAVAFLACGLLGMWVPTMQTLALMVVAVLASVVVGVLLGLAAGLS 172

Query: 122 PRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIST 181
            R    +R  LD+MQ +P F YL+P +++FG+G+   ++AT++++ P   RLT LG+   
Sbjct: 173 DRMDRALRPILDTMQVLPAFAYLLPVVLVFGIGVPAAVLATVIYAAPPMARLTSLGLRGA 232

Query: 182 PPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
              + EA  + G+T  Q      +P A  +++  + QTIM++LSM V+ A++G+ GLG  
Sbjct: 233 DKSVLEAVESLGSTARQRLLTARIPLARKELLLGVNQTIMMALSMAVIAAVIGAGGLGDR 292

Query: 242 VLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           V +AL +VD+G    +G+ IV+LA++LDR+      R
Sbjct: 293 VYQALASVDVGAALAAGIPIVLLAVVLDRVTGAAGER 329


>gi|62183746|gb|AAX73264.1| transmembrane protein [Methanohalophilus portucalensis FDF-1]
          Length = 276

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 117/272 (43%), Positives = 180/272 (66%), Gaps = 1/272 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG  ++     ++    +  +  S +    +++   VL  +PPL+FV +++ +  +V
Sbjct: 5   QLPLGSIVESLVYWISDTFGFILDAFSALFGFVIDIFKDVLMAMPPLLFVVLIAAIAYVV 64

Query: 68  KR-SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            R    +A+GTA+G ++I+    W+ + ET++LV+ S  +++ IG+PLG+LAA     + 
Sbjct: 65  GRKDWKLALGTALGFIVILSMDLWEYSMETIALVISSAALALIIGIPLGILAAKSETLHR 124

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           I+R  LD MQT+P+FVYLIPA++ FGLG VPG++AT+VFS+P ++RLT LGI   P  L 
Sbjct: 125 ILRPILDLMQTMPSFVYLIPAVIFFGLGNVPGMIATVVFSMPPAIRLTTLGITQVPKELV 184

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           E A AFG+T +Q   KVE+P A+  I+A + Q IML+LSMVV+ +++G+ GLG  VL  +
Sbjct: 185 EVADAFGSTSWQKLIKVEIPVALKTIMAGVNQCIMLALSMVVIASMIGARGLGYQVLIGI 244

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
             VDIG GFE+GL IVI+AI+LDRL     P+
Sbjct: 245 QRVDIGVGFEAGLGIVIIAIVLDRLTQHLTPK 276


>gi|329944190|ref|ZP_08292449.1| glycine betaine transport system permease protein opuAB
           [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530920|gb|EGF57776.1| glycine betaine transport system permease protein opuAB
           [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 292

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 112/269 (41%), Positives = 167/269 (62%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG  ++     +  +       +S       + ++ VL  +PPL+ V V +L+  M 
Sbjct: 10  KIPLGKTVEVLIDWIQNHLHGLLAAISQAGTSVNDTLVDVLLAVPPLLMVIVFALIAWMA 69

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            +S  +A+GTA+  LLII  G W+   ETL LV ++T  ++   +PLG+ AA      +I
Sbjct: 70  -KSWRLALGTAITFLLIISLGQWENAMETLVLVTIATLTALVFAIPLGIWAARNKYVSAI 128

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           IR  LD MQT+P FVYLIP+++ F +G+VPG+ AT++FS+P  VR+T LGI        E
Sbjct: 129 IRPVLDLMQTMPAFVYLIPSVLFFSIGVVPGMFATLIFSMPPGVRMTELGIKQVDKETVE 188

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  +FGAT +Q+ R ++LP A+P I+A + Q IML+LSM V+  +VG++GLG  V+ AL+
Sbjct: 189 AGRSFGATDWQILRGIQLPLAVPTIMAGVNQVIMLALSMAVIAGMVGADGLGKEVVNALS 248

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
           T+DI +G E+GL IV LAI LDR+ +   
Sbjct: 249 TIDIAKGTEAGLSIVFLAIFLDRVTAALG 277


>gi|294853483|ref|ZP_06794155.1| glycine betaine/proline transport system permease [Brucella sp.
           NVSL 07-0026]
 gi|294819138|gb|EFG36138.1| glycine betaine/proline transport system permease [Brucella sp.
           NVSL 07-0026]
          Length = 301

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 112/267 (41%), Positives = 158/267 (59%), Gaps = 1/267 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +G +       +  +     ++++  +    + +   L  +PP   V ++SLL L  +  
Sbjct: 7   VGGWADVAVNYILDHFTPALDMIAAAIGFVTDGIQNALIAVPPFAGVAILSLLALW-RVG 65

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
              AV T + L LII    W  T E+LSLVL ST I++ IG+PLG+  A      SI+R 
Sbjct: 66  WKFAVFTLLALALIIHMDLWSGTMESLSLVLASTVIAVVIGIPLGIAMARSDAVASIVRP 125

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIPA + FGLG VPG +AT++F++P  VRLT LGI        EA  
Sbjct: 126 ILDLMQTMPAFVYLIPAAMFFGLGAVPGTIATVIFAMPPVVRLTNLGIRQVHAEFVEAGL 185

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           AFG T  Q+  KV+LP A+P I+A + QTIMLSLSMVV+ +++G+  LG  VL  +  ++
Sbjct: 186 AFGCTARQLLFKVQLPNAMPSIMAGVNQTIMLSLSMVVIASMIGAGSLGNTVLTGIQRLN 245

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDP 277
           +G GFE GL +VILA+ILDR+      
Sbjct: 246 VGLGFEGGLAVVILAVILDRITQSFGK 272


>gi|330819748|ref|YP_004348610.1| ABC transporter membrane-spanning permease - choline transporter
           [Burkholderia gladioli BSR3]
 gi|327371743|gb|AEA63098.1| ABC transporter membrane-spanning permease - choline transporter
           [Burkholderia gladioli BSR3]
          Length = 297

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 114/269 (42%), Positives = 167/269 (62%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +  ++     LV   LQ +P  + + +   + L  +
Sbjct: 5   IPLGTWVDQSVRYLLDHDAKTFDAIGQVIESLAALVEHGLQAIPMWLLMAIFIGVGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFAIFTTLALLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVSAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|153008918|ref|YP_001370133.1| binding-protein-dependent transport systems inner membrane
           component [Ochrobactrum anthropi ATCC 49188]
 gi|151560806|gb|ABS14304.1| binding-protein-dependent transport systems inner membrane
           component [Ochrobactrum anthropi ATCC 49188]
          Length = 278

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 140/278 (50%), Positives = 196/278 (70%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVV 60
           M+ +    IP+G   +     LT N   F + L+ ++   ++ +LF+L+   PL+ + + 
Sbjct: 1   MNWLTDYKIPVGPTAKSVVDWLTDNMGGFFDTLAAVMQSLIDGLLFLLKLPHPLLLIAIF 60

Query: 61  SLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAW 120
           +++  +++R I++ V T +G L II QGYW  T ETL+LVL + F+ M IGVPLG+ AA 
Sbjct: 61  AVIAWLIQRRISVVVLTVIGFLFIINQGYWDRTLETLTLVLSACFLCMAIGVPLGIAAAH 120

Query: 121 YPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIIS 180
            P  Y+ +R  LD MQT+PTFVYLIPA+V FG+GMVPG++AT +F +P  VRLT LGI S
Sbjct: 121 RPALYAAMRPVLDLMQTLPTFVYLIPAIVFFGIGMVPGLLATAIFVLPAPVRLTHLGISS 180

Query: 181 TPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGV 240
           TP  L EA  AFGA+  Q+  K+ELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGV
Sbjct: 181 TPSSLIEAGEAFGASRSQLLWKIELPYAMPQILAGLTQTIMLSLSMVVIAALVGADGLGV 240

Query: 241 PVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
           PV+RALN+V+   GFE+GL IV++AI+LDR+F     +
Sbjct: 241 PVVRALNSVNTALGFEAGLVIVVVAIVLDRIFRAGREK 278


>gi|254502931|ref|ZP_05115082.1| ABC transporter, permease protein [Labrenzia alexandrii DFL-11]
 gi|222439002|gb|EEE45681.1| ABC transporter, permease protein [Labrenzia alexandrii DFL-11]
          Length = 263

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 143/255 (56%), Positives = 191/255 (74%)

Query: 19  FVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIAVGTA 78
              LT N  W  + +S  L   ++ +L++LQ   PLV V + +     V R I++A   A
Sbjct: 2   VDWLTDNAYWVFDGISVFLETLIDGILWLLQTPHPLVIVALAAGAGYAVHRKISLAAFIA 61

Query: 79  MGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDSMQTI 138
           + L+LII QGYW+ETTETL+LV+ ++ + M +G+P+GV  A  PRF++ +R  LD MQTI
Sbjct: 62  VSLMLIINQGYWEETTETLALVIAASVVCMAVGIPIGVYGAHNPRFFAAMRPVLDLMQTI 121

Query: 139 PTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGATPFQ 198
           PTFVYLIPAL+LFGLGMVPG++AT++F+IP  +RLT+LG+ STP  L EA  AFGAT  Q
Sbjct: 122 PTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTQLGVSSTPTALLEAGEAFGATKSQ 181

Query: 199 VFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRGFESG 258
           +  K+ELP+A+PQI+A LTQTIMLSLSMVV+ ALVG++GLGVP LRALNTV+I +GFE G
Sbjct: 182 LLWKIELPYALPQIMAGLTQTIMLSLSMVVIAALVGADGLGVPTLRALNTVNIAQGFEVG 241

Query: 259 LCIVILAIILDRLFS 273
           +CIV++AI+LDR F 
Sbjct: 242 VCIVLIAIVLDRFFR 256


>gi|104781566|ref|YP_608064.1| amino acid transporter permease [Pseudomonas entomophila L48]
 gi|95110553|emb|CAK15261.1| putative amino acid transporter permease protein [Pseudomonas
           entomophila L48]
          Length = 282

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 162/270 (60%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
              ++      L  +   +   +S  LL+ +  +  +L+ LP  + + +V  L     RS
Sbjct: 13  FAPWVNRLVDWLVLHYGDYLRGVSEQLLQLLVALENLLRLLPWWLLLLLVGGLAWHASRS 72

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           +  AV   + L LI   G W +  +TL+LVLVST + + +GVPLG+L A  P    ++  
Sbjct: 73  LARAVALTLLLALIGVLGLWDKLLQTLALVLVSTSLCVLVGVPLGILLATRPLARRLLLP 132

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD MQT+P FVYLIP L+LFGLG VP + AT+++++P  VRLT LG+    P L +AA 
Sbjct: 133 VLDVMQTLPAFVYLIPVLMLFGLGKVPAVFATLIYALPPLVRLTELGLAQIDPSLLKAAH 192

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
             GA  +Q   ++ LP A+P I+A L Q++M++LSMVVV +++G+ GLG  VL  + T++
Sbjct: 193 GLGAGRWQRLSRIALPLALPSIMAGLNQSVMMALSMVVVASMIGARGLGEDVLAGIQTLN 252

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +G+G E+GL IV LA+++DR+      + R
Sbjct: 253 VGQGMEAGLAIVALAMVIDRISQAYGRKRR 282


>gi|152986181|ref|YP_001351473.1| choline ABC transporter permease [Pseudomonas aeruginosa PA7]
 gi|150961339|gb|ABR83364.1| choline ABC transporter, permease protein [Pseudomonas aeruginosa
           PA7]
          Length = 279

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 129/271 (47%), Positives = 183/271 (67%)

Query: 3   PIIQAPIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSL 62
            +    +PLG+ +  F   LT +G  F + +S  L   ++ V   L +  PLV + ++  
Sbjct: 2   FLTDHKLPLGEQIAGFVDWLTLHGASFFDKVSDTLEFLIHGVTNGLLWFNPLVLIALLVG 61

Query: 63  LVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYP 122
           LV +++RS  + V     LLLI+  GYWQET ETL+ V+ +T + + +GVPLG++AA  P
Sbjct: 62  LVHVIQRSWGLTVFALASLLLILNLGYWQETMETLAQVIFATLVCIAVGVPLGIVAAHKP 121

Query: 123 RFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTP 182
            FY+ +R  LD MQT+PTFVYLIP L LFGLG+VPG+++T++F++   +RLT LGI   P
Sbjct: 122 WFYTALRPLLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVIFAVAAPIRLTCLGIQDVP 181

Query: 183 PILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPV 242
             L +A  AFG + +Q+  ++ELP A+P I A +TQ IMLSLSMVV+ ALVG++GLG PV
Sbjct: 182 AELLDAGKAFGCSRWQLLTRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV 241

Query: 243 LRALNTVDIGRGFESGLCIVILAIILDRLFS 273
           + ALNT DI  GFE+GL IV+LAI+LDR+  
Sbjct: 242 VNALNTADISLGFEAGLAIVLLAILLDRVCK 272


>gi|91778491|ref|YP_553699.1| ABC proline/glycine betaine transporter, inner membrane subunit
           [Burkholderia xenovorans LB400]
 gi|296156328|ref|ZP_06839167.1| choline ABC transporter, permease protein [Burkholderia sp. Ch1-1]
 gi|91691151|gb|ABE34349.1| ABC proline/glycine betaine transporter, inner membrane subunit
           [Burkholderia xenovorans LB400]
 gi|295893834|gb|EFG73613.1| choline ABC transporter, permease protein [Burkholderia sp. Ch1-1]
          Length = 300

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 110/270 (40%), Positives = 161/270 (59%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG ++      L  +     + +  ++     ++   LQ +P    +     + L  
Sbjct: 4   VIPLGAWVDHGVHYLLDHDAKTFDSIGKVIESFAAVIEHGLQAVPMWALMAFFVGIGLW- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +     A+ T + +LLI   G+W +   TL L L ST IS+ +GVPLG+  A       I
Sbjct: 63  RVGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTLISLLLGVPLGIWTAKSRTIEMI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + E
Sbjct: 123 VRPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREIVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++ 
Sbjct: 183 AGQAFGCTPWQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            +DIG GFESGL +V+LAIILDR+      
Sbjct: 243 RLDIGLGFESGLSVVMLAIILDRITESFGR 272


>gi|187919744|ref|YP_001888775.1| choline ABC transporter permease [Burkholderia phytofirmans PsJN]
 gi|187718182|gb|ACD19405.1| choline ABC transporter, permease protein [Burkholderia
           phytofirmans PsJN]
          Length = 300

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 110/270 (40%), Positives = 160/270 (59%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPLG ++      L  +     + +  ++     ++   LQ +P    +     + L  
Sbjct: 4   VIPLGAWVDHGVHYLLDHDAKTFDSIGKVIESFAAVIEHGLQAVPMWALMAFFVGIGLW- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +     A+ T + +LLI   G+W +   TL L L ST IS+ +GVPLG+  A       I
Sbjct: 63  RVGWRFALFTLLAMLLIYGTGFWDQMVITLGLTLSSTLISLLLGVPLGIWTAKSRTVEMI 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + E
Sbjct: 123 VRPVLDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIKHVNREIVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG TP Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++ 
Sbjct: 183 AGQAFGCTPLQLLYKVQFPNALPSIMTGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            +DIG GFESGL +V+LAIILDR+      
Sbjct: 243 RLDIGLGFESGLSVVMLAIILDRITESFGR 272


>gi|221200267|ref|ZP_03573309.1| choline ABC transporter, permease protein [Burkholderia multivorans
           CGD2M]
 gi|221205947|ref|ZP_03578961.1| choline ABC transporter, permease protein [Burkholderia multivorans
           CGD2]
 gi|221173959|gb|EEE06392.1| choline ABC transporter, permease protein [Burkholderia multivorans
           CGD2]
 gi|221179608|gb|EEE12013.1| choline ABC transporter, permease protein [Burkholderia multivorans
           CGD2M]
          Length = 298

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     L+   LQ +P  + +     + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAATFDAIGRAIEGLAALIEHGLQAVPMWLMMAFFIGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|93005914|ref|YP_580351.1| substrate-binding region of ABC-type glycine betaine transport
           system [Psychrobacter cryohalolentis K5]
 gi|92393592|gb|ABE74867.1| Substrate-binding region of ABC-type glycine betaine transport
           system [Psychrobacter cryohalolentis K5]
          Length = 646

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 98/271 (36%), Positives = 162/271 (59%), Gaps = 1/271 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFI-LLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKR 69
           L   L      + +N       +S + L   +  +  +L  +PP + + +V++L     R
Sbjct: 362 LESPLNNTLASVVRNHGDVFRTISTVALTYLLLPIERLLTLIPPWLIIALVTVLAWFAVR 421

Query: 70  SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIR 129
            I  A+    GL LI   G W    +TL+L++VS ++++ IG+P+G+  +       I+ 
Sbjct: 422 KIWFALACGAGLFLIGAFGLWGALIDTLALLIVSVWVTVVIGIPIGIAMSGSKLLRKIVT 481

Query: 130 LFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAA 189
             LD MQT+P+FVYLIP L+LFG+G VP + ATI++++P  +RLT LGI      + EA 
Sbjct: 482 PVLDVMQTMPSFVYLIPVLMLFGIGKVPALFATIIYALPPLIRLTTLGITQVNHEMVEAG 541

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
            +FG+T  Q+   ++LP A+P I+A + Q +M+SLSMVV+ +++G+ GLG  VL+++ T+
Sbjct: 542 RSFGSTHLQLLIWIKLPQALPSIMAGVNQAVMMSLSMVVLASMIGAPGLGEDVLQSIQTL 601

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
           +IG+G ++G  IVI+AII+DR+        R
Sbjct: 602 NIGQGLQAGTAIVIVAIIIDRITQAFGQGKR 632


>gi|328957271|ref|YP_004374657.1| glycine betaine transport system permease protein OpuAB
           [Carnobacterium sp. 17-4]
 gi|328673595|gb|AEB29641.1| glycine betaine transport system permease protein OpuAB
           [Carnobacterium sp. 17-4]
          Length = 281

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 111/271 (40%), Positives = 167/271 (61%), Gaps = 1/271 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           +P+ D ++ F   +TQ   +  + +       +  V   L  +PP++F+ +++L+  +  
Sbjct: 11  LPVADAVENFTSWVTQTFAFLFDPIQKYSEIVMEFVTNTLLLVPPILFILIIALIAFIAS 70

Query: 69  RSI-TIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +    +A  T +GL     QG W++   TL+LVLV++ +S+ IGVP G+L A      +I
Sbjct: 71  KKKIGLATFTIIGLWFTYNQGLWEDLMNTLTLVLVASLLSVIIGVPFGILMAKSKIANAI 130

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYLIPA+  FG+GMVPG+ A+++F+IP +VR T LGI      L E
Sbjct: 131 ITPVLDFMQTMPAFVYLIPAVAFFGIGMVPGVFASLIFAIPPTVRFTNLGIRQVSHELVE 190

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA +FG+T  Q   KVELP A   I+A + QT+ML+LSMVV+ +++G+ GLG  VL +L 
Sbjct: 191 AAESFGSTGAQKLFKVELPLAKSTIMAGINQTVMLALSMVVIASMIGAPGLGREVLSSLQ 250

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPR 278
              IG GF SGL +V+LAII+DRL    + +
Sbjct: 251 RAQIGTGFVSGLGLVVLAIIIDRLTQKLNKK 281


>gi|89893966|ref|YP_517453.1| hypothetical protein DSY1220 [Desulfitobacterium hafniense Y51]
 gi|219668341|ref|YP_002458776.1| binding-protein-dependent transporters inner membrane component
           [Desulfitobacterium hafniense DCB-2]
 gi|89333414|dbj|BAE83009.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219538601|gb|ACL20340.1| binding-protein-dependent transport systems inner membrane
           component [Desulfitobacterium hafniense DCB-2]
          Length = 279

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 110/275 (40%), Positives = 166/275 (60%), Gaps = 1/275 (0%)

Query: 7   APIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLM 66
             IPLG+++ +    L        +  +  +    + +   L  +P  + V + + L   
Sbjct: 2   TKIPLGEWVNQGVDTLLFYFGSAFDAFTDSVTSMTDAMREGLDVVPWFILVLLFAALAWR 61

Query: 67  VKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYS 126
            K    +A+GT +GL LI     W    +TL LVL+++ +S+ IG+PLG+L A +  F+ 
Sbjct: 62  AKG-WRLALGTTVGLCLIYNLELWPAFLDTLILVLLASLVSLVIGIPLGILGARHNGFHR 120

Query: 127 IIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILK 186
           ++   LD MQT+P+FVYLIPAL+ F LG V  I AT++F++P  +RLT LGI   P  L 
Sbjct: 121 VLSPILDFMQTMPSFVYLIPALMFFSLGTVSAIFATVIFAMPPVIRLTALGIRQVPADLV 180

Query: 187 EAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRAL 246
           E   AFG+   Q+  K++LP A+P I+A + QT+MLSLSMVV++A++G+ GLG  VL  +
Sbjct: 181 EVGEAFGSNSRQMLWKIQLPLALPTIMAGINQTMMLSLSMVVISAMIGAQGLGAGVLAGI 240

Query: 247 NTVDIGRGFESGLCIVILAIILDRLFSIPDPRDRI 281
           + +DIG+GFE GL +VILA+ILDRL        R+
Sbjct: 241 SGMDIGKGFEYGLAVVILAMILDRLSQGALRNSRV 275


>gi|221209305|ref|ZP_03582286.1| choline ABC transporter, permease protein [Burkholderia multivorans
           CGD1]
 gi|221169993|gb|EEE02459.1| choline ABC transporter, permease protein [Burkholderia multivorans
           CGD1]
          Length = 295

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     L+   LQ +P  + +     + L  +
Sbjct: 2   IPLGSWVDQSVHYLLDHDAATFDAIGRAIEGLAALIEHGLQAVPMWLMMAFFIGIGLW-R 60

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 61  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLVLGIPLGIWAAKSKWVAAIV 120

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 121 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 180

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 181 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 240

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 241 LDIGLGFESGLSVVLLAIILDRITESFGR 269


>gi|315649176|ref|ZP_07902266.1| binding-protein-dependent transport systems inner membrane
           component [Paenibacillus vortex V453]
 gi|315275395|gb|EFU38753.1| binding-protein-dependent transport systems inner membrane
           component [Paenibacillus vortex V453]
          Length = 277

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 115/273 (42%), Positives = 172/273 (63%), Gaps = 1/273 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IPL  ++      +      F + +S I+ K V L   +     P +F+ +++++   +
Sbjct: 3   KIPLASWVDSLVEWMGDVFSGFFDAISLIIEKIVQLFTDLFMLPHPYLFIVILAVIAYFL 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R   + + TA+G LLI   GYW +T  TLSLV+ +  IS+ +GVPLG+ AA+      I
Sbjct: 63  GRLP-LTLFTAIGFLLIDNLGYWSQTMSTLSLVITAALISVLLGVPLGIWAAYSRSASRI 121

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           I   LD MQT+P FVYL+PA+  F LG+VPG++A+++F+IP ++RLTRLGI+     L E
Sbjct: 122 IIPVLDFMQTMPAFVYLLPAVTFFSLGVVPGVIASVIFAIPPTIRLTRLGIMQVSGELTE 181

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFG+T  Q   KV+LP A+P ++A + QTIMLSLSMVV+ +++G+ G+G  V RA+ 
Sbjct: 182 AADAFGSTSGQKLFKVQLPLAMPTLMAGINQTIMLSLSMVVIASMIGAQGIGAEVYRAVT 241

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
            + IG+GFE+GL +VILAI+LDR         +
Sbjct: 242 QLQIGKGFEAGLAVVILAIVLDRFTQNIFKSKK 274


>gi|161520035|ref|YP_001583462.1| choline ABC transporter, permease protein [Burkholderia multivorans
           ATCC 17616]
 gi|189353784|ref|YP_001949411.1| glycine betaine/proline transport system permease protein
           [Burkholderia multivorans ATCC 17616]
 gi|160344085|gb|ABX17170.1| choline ABC transporter, permease protein [Burkholderia multivorans
           ATCC 17616]
 gi|189337806|dbj|BAG46875.1| glycine betaine/proline transport system permease protein
           [Burkholderia multivorans ATCC 17616]
          Length = 298

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 113/269 (42%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           IPLG ++ +    L  +     + +   +     L+   LQ +P  + +     + L  +
Sbjct: 5   IPLGSWVDQSVHYLLDHDAATFDAVGRAIEGLAALIEHGLQAVPMWLMMAFFIGIGLW-R 63

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
                A+ T + LLLI   G+W +T  TL L L ST IS+ +G+PLG+ AA      +I+
Sbjct: 64  VGWRFALFTTLSLLLIFATGFWDQTVITLGLTLSSTIISLALGIPLGIWAAKSKWVAAIV 123

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + EA
Sbjct: 124 RPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRHVNREIVEA 183

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
             AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++  
Sbjct: 184 GQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNDVLASIQR 243

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           +DIG GFESGL +V+LAIILDR+      
Sbjct: 244 LDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|33593078|ref|NP_880722.1| putative binding-protein-dependent transport protein [Bordetella
           pertussis Tohama I]
 gi|33602341|ref|NP_889901.1| putative binding-protein-dependent transport protein [Bordetella
           bronchiseptica RB50]
 gi|33563453|emb|CAE42335.1| putative binding-protein-dependent transport protein [Bordetella
           pertussis Tohama I]
 gi|33576780|emb|CAE33859.1| putative binding-protein-dependent transport protein [Bordetella
           bronchiseptica RB50]
 gi|332382490|gb|AEE67337.1| putative binding-protein-dependent transport protein [Bordetella
           pertussis CS]
          Length = 285

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 101/266 (37%), Positives = 156/266 (58%)

Query: 15  LQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIA 74
           +  F   L  N       +S   L  +  +  VL+  P    V V   +  +V R I ++
Sbjct: 15  IDGFVDHLVTNYADTLEAMSQPFLSVLVWLEQVLRQSPWWAVVAVTIAIAWLVSRRIGLS 74

Query: 75  VGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDS 134
           +     L +I   G W    +TL+L++++  +S+ IG+PLGVL A      + +   LD 
Sbjct: 75  LAMGALLCVIGVLGLWDAGMQTLALMIMAAGLSVVIGIPLGVLMARVDWLRAGMLPVLDV 134

Query: 135 MQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGA 194
           MQT+P+FVYLIP ++LFGLG +P I+AT+++++P  +RLT LGI      + EAA AFGA
Sbjct: 135 MQTMPSFVYLIPVVMLFGLGKIPAIIATVIYAVPPLIRLTDLGIRLVDREVLEAARAFGA 194

Query: 195 TPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRG 254
            P Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  +N +++GRG
Sbjct: 195 NPRQQLFGVQLPLALPNIMAGINQTTMMALSMVVIASMIGARGLGYEVLLGINRLEVGRG 254

Query: 255 FESGLCIVILAIILDRLFSIPDPRDR 280
             +GL IV+LA++ DR+      R R
Sbjct: 255 LLAGLGIVVLAVLFDRITQSYGQRVR 280


>gi|73538635|ref|YP_299002.1| binding-protein dependent transport system inner membrane protein
           [Ralstonia eutropha JMP134]
 gi|72121972|gb|AAZ64158.1| Binding-protein-dependent transport systems inner membrane
           component [Ralstonia eutropha JMP134]
          Length = 298

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 111/270 (41%), Positives = 165/270 (61%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PLG ++ +    L  +     + +   +     L+   LQ +P  + + +   + L  
Sbjct: 4   YLPLGHWVDQSVHYLLDHDAATFDTVGRAIEGLAALIERSLQAVPMWLMMAIFIGIGLW- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +     A+ TA  L +I   G+W +T  TL L L ST IS+ +GVPLG+ AA      ++
Sbjct: 63  RVGWRFALFTAASLSVIFATGFWDQTVITLGLTLSSTIISLILGVPLGIWAAKSRVVAAV 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      + E
Sbjct: 123 VRPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRQVNMEIVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG TP+Q+  KV+ P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++ 
Sbjct: 183 AGHAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNEVLASIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            +DIG GFESGL +V+LAIILDR+      
Sbjct: 243 RLDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|17548288|ref|NP_521628.1| transmembrane ABC transporter protein [Ralstonia solanacearum
           GMI1000]
 gi|17430534|emb|CAD17218.1| probable transmembrane abc transporter protein [Ralstonia
           solanacearum GMI1000]
          Length = 298

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 113/270 (41%), Positives = 164/270 (60%), Gaps = 1/270 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+G ++ +    L  +     + +   +     LV   LQ +P  + +     + L  
Sbjct: 4   TLPIGHWVDQAVHYLLDHDAAAFDTVGRAIDGLAALVERSLQAVPMWMMMAFFIGIGLW- 62

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
           +     A+ TA  L LI   G+W +T  TL L L ST IS+ +GVPLG+ AA      ++
Sbjct: 63  RVGWRFALFTAASLFLISATGFWDQTIVTLGLTLSSTIISLALGVPLGIWAARSRVVSAV 122

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYLIPA +LFGLG VPGI++T++F++P +VRLT LGI      L E
Sbjct: 123 VRPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMPPAVRLTSLGIRQVNMELVE 182

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A  AFG TP Q+  KV++P A+P I+  + QTIM++LSMV++ ++VG+ GLG  VL ++ 
Sbjct: 183 AGLAFGCTPRQLLYKVQIPNALPSIMQGVNQTIMMALSMVIIASMVGAGGLGNEVLASIQ 242

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
            +DIG GFESGL +V+LAIILDR+      
Sbjct: 243 RLDIGLGFESGLSVVLLAIILDRITESFGR 272


>gi|302337418|ref|YP_003802624.1| binding-protein-dependent transporters inner membrane component
           [Spirochaeta smaragdinae DSM 11293]
 gi|301634603|gb|ADK80030.1| binding-protein-dependent transport systems inner membrane
           component [Spirochaeta smaragdinae DSM 11293]
          Length = 284

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 111/269 (41%), Positives = 167/269 (62%), Gaps = 1/269 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           + +G + +     +T + + F + +S I+   ++  L V  + PP+V V +++ L     
Sbjct: 10  LDVGGWFEAIIDWMTLHWDGFFDGVSAIVQAVLSAFLAVFSFPPPIVLVLLLAALA-WWL 68

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
            S    + + +G  LI   G W ET ETLSLV+ S  +++ I VP+G+ ++       I+
Sbjct: 69  VSRGAGILSFIGFSLIWIMGLWGETMETLSLVVTSVILALLIAVPVGIWSSKKDTVQRIV 128

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD MQT+P FVYLIPA++ F LG VPG++AT++F++P SVRLT LGI   P  +KEA
Sbjct: 129 RPVLDFMQTLPAFVYLIPAVLFFKLGPVPGVIATLIFAMPPSVRLTNLGIRQVPKEIKEA 188

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A +FGAT  Q+  K ELP A+P I+A + QTIML+LSMVV+  ++G+ GLG  VL+ +  
Sbjct: 189 AKSFGATSHQMLLKAELPVALPTILAGVNQTIMLALSMVVIAGMIGAGGLGNEVLKGITQ 248

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPDP 277
           + I +GFE G+ IVILA+ LDR+      
Sbjct: 249 LKIDQGFEGGIAIVILAMYLDRVTQALGK 277


>gi|126734811|ref|ZP_01750557.1| glycine betaine/L-proline transport system permease, putative
           [Roseobacter sp. CCS2]
 gi|126715366|gb|EBA12231.1| glycine betaine/L-proline transport system permease, putative
           [Roseobacter sp. CCS2]
          Length = 512

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 96/261 (36%), Positives = 156/261 (59%), Gaps = 1/261 (0%)

Query: 13  DYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSIT 72
           D+++ FF     NG+   + ++F++   ++ +  V    P +V   ++ LL  +      
Sbjct: 249 DWVENFFNWAVLNGDALFDAITFVIRLVLDALEIVFVSTPWIVIASLIILLTWL-TAGAR 307

Query: 73  IAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFL 132
           +A+ +A  L  +   G+W++   TL+L+  +  +S+ IG+PLG+ AA  PRFY+ I+  +
Sbjct: 308 MAIYSAAFLSYMGLLGFWEKAMTTLALLGTAACLSILIGIPLGMFAARRPRFYAAIQPIM 367

Query: 133 DSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAF 192
           D MQT+P FV++IP +  FG G    +V T++F     VRLT LG+   P  ++EAA +F
Sbjct: 368 DFMQTMPAFVFMIPVIAFFGTGKPAAVVTTMIFGGTPVVRLTVLGLRGVPESVREAAISF 427

Query: 193 GATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIG 252
           GA  + +  +V+LP A P I A + QTIMLSL+MVVV +L+G+ GLG  VL AL   ++G
Sbjct: 428 GANKWYLLTRVDLPLASPSIRAGINQTIMLSLAMVVVASLIGAKGLGEDVLEALQYANVG 487

Query: 253 RGFESGLCIVILAIILDRLFS 273
           +G  +G  I+  A+ILDR+  
Sbjct: 488 QGILAGFAILFCAMILDRIVQ 508


>gi|255263921|ref|ZP_05343263.1| glycine betaine transporter, permease protein [Thalassiobium sp.
           R2A62]
 gi|255106256|gb|EET48930.1| glycine betaine transporter, permease protein [Thalassiobium sp.
           R2A62]
          Length = 343

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 92/269 (34%), Positives = 149/269 (55%), Gaps = 1/269 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           L   +++ F+      +   + ++  L   ++  L+     P  + V ++  +     RS
Sbjct: 67  LTKGIEDGFLAAKPALKSVLDPITQPLSWLLDGALWTFSATPWFIMVPILVAIAWFASRS 126

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
             + +  A  +LL+    ++    +TLS++ V T IS+ +GVP+G+  +   R    +  
Sbjct: 127 KPVTIFVAFSILLLAFVDHYDVAMQTLSIIFVCTGISIVLGVPIGIAMSKSDRLQRSVVP 186

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGI-VATIVFSIPTSVRLTRLGIISTPPILKEAA 189
            LD +QT+PTFVYLIP + LF +       +A I+++I   +RLT LGI      + EAA
Sbjct: 187 ILDLLQTLPTFVYLIPLIFLFSVTESKLYGIAIILYAIVPVIRLTDLGIRLVDQDVIEAA 246

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
            AFG    Q   KVELP A+P I+A + QTIM+SL+MVV+ +LV + GLGV VLR +  +
Sbjct: 247 NAFGMNSNQKLLKVELPLALPNIMAGVNQTIMMSLAMVVIASLVSAPGLGVNVLRGIRNL 306

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPDPR 278
           ++G G  +G+ IV+LA+ILDR+      R
Sbjct: 307 ELGVGIVAGIGIVLLAVILDRVSKAALSR 335


>gi|255590255|ref|XP_002535215.1| Glycine betaine/L-proline transport system permease protein proW,
           putative [Ricinus communis]
 gi|223523727|gb|EEF27169.1| Glycine betaine/L-proline transport system permease protein proW,
           putative [Ricinus communis]
          Length = 329

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 108/281 (38%), Positives = 165/281 (58%), Gaps = 2/281 (0%)

Query: 1   MSPIIQAPIPLGDYLQEFFVCLTQNGEWFC-NILSFILLKAVNLVLFVLQYLPPLVFVCV 59
           M+ I    + + D++ +              +  + +L   +  +   L+  P    +  
Sbjct: 1   MNSIFLH-LSIADWVNDHVQSFVAAYGDSFHDFSTALLRYVLVPLEGALRATPAWAILIA 59

Query: 60  VSLLVLMVKRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAA 119
           V LL L   R I IA    + L +I   G W +  +TL+L+LV+T +S+ +GVPLG+ A+
Sbjct: 60  VGLLTLNATRRIGIAAFFVLLLYVIGCFGLWDKLMQTLALMLVATVLSVALGVPLGIWAS 119

Query: 120 WYPRFYSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGII 179
             P    ++   LD MQT+P+FVYLIP L+LFGLG VP I+ATI++++P  +RLT LGI 
Sbjct: 120 RSPWMRRVLLPVLDIMQTLPSFVYLIPVLMLFGLGKVPAILATIIYALPPLIRLTDLGIR 179

Query: 180 STPPILKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLG 239
                + EAA AFG T +Q+   V+LP A P I+A + QT M++LSMVV+ +++GS GLG
Sbjct: 180 HVDADVVEAARAFGTTRWQLLVNVQLPLARPSIMAGINQTTMMALSMVVIASMIGSRGLG 239

Query: 240 VPVLRALNTVDIGRGFESGLCIVILAIILDRLFSIPDPRDR 280
             VL  + T+DIG+G ++G+ IVILAI++DR+        R
Sbjct: 240 EDVLAGIQTLDIGKGMQAGIAIVILAIVIDRISQGYGQDRR 280


>gi|163758500|ref|ZP_02165588.1| glycine betaine/L-proline transport system permease, putative
           [Hoeflea phototrophica DFL-43]
 gi|162284789|gb|EDQ35072.1| glycine betaine/L-proline transport system permease, putative
           [Hoeflea phototrophica DFL-43]
          Length = 513

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 96/261 (36%), Positives = 153/261 (58%), Gaps = 1/261 (0%)

Query: 13  DYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSIT 72
           ++++ FF     NGE   + +++ +   ++ +  V    P +V   ++ LL  +    I 
Sbjct: 250 EWVEAFFAFCVANGEVLFDFITYCIRMVLDALELVFVSTPWIVIASLIVLLTWL-TAGIR 308

Query: 73  IAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFL 132
            A+ +A  L  +   G+W +   TL+L+  +  +S+ IG+PLG+  A  PRFYS I+  +
Sbjct: 309 TAIWSAAFLSYMGLLGFWDKAMTTLALLGTAACLSILIGIPLGMFCARRPRFYSFIQPIM 368

Query: 133 DSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAF 192
           D MQT+P FV++IP +  FG G    +V T++F     VRLT LG+   P  ++EAA +F
Sbjct: 369 DFMQTMPAFVFMIPVIAFFGTGKPAAVVTTMIFGGTPVVRLTVLGLRGVPDSVREAAISF 428

Query: 193 GATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIG 252
           GA  + +  +V+LP A P I A + QTIMLSL+MVVV +L+G+ GLG  VL AL   ++G
Sbjct: 429 GANKWYLLTRVDLPLASPSIRAGINQTIMLSLAMVVVASLIGAKGLGEDVLEALQYANVG 488

Query: 253 RGFESGLCIVILAIILDRLFS 273
           +G  +G  I+  A+ILDR+  
Sbjct: 489 QGILAGFAILFCAMILDRIVQ 509


>gi|317405786|gb|EFV86076.1| binding-protein-dependent transporter [Achromobacter xylosoxidans
           C54]
          Length = 285

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 104/267 (38%), Positives = 160/267 (59%)

Query: 15  LQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIA 74
           +  F   L  N       LS  +L A+  +  VL+  P    V V   +  +V R I ++
Sbjct: 15  IDGFVDHLVTNYADTLETLSQPVLHALVWLEQVLRSSPWWAVVGVTIAIAWLVSRRIGLS 74

Query: 75  VGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDS 134
           +     L +I   G W    +TL+L++++  +S+ IG+PLGVL A      SI+   LD 
Sbjct: 75  LAMGALLCVIGVLGLWDAGMQTLALMIMAAGLSVIIGIPLGVLMARVNWLRSIMLPVLDV 134

Query: 135 MQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGA 194
           MQT+P+FVYLIP ++LFGLG +P I+AT+++++P  +RLT LGI      + EA+ AFGA
Sbjct: 135 MQTMPSFVYLIPVVMLFGLGKIPAIIATVIYAVPPLIRLTDLGIRLVDREVLEASRAFGA 194

Query: 195 TPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRG 254
            P Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  +N +++GRG
Sbjct: 195 NPRQQLFGVQLPLALPNIMAGINQTTMMALSMVVIASMIGARGLGYEVLLGINRLEVGRG 254

Query: 255 FESGLCIVILAIILDRLFSIPDPRDRI 281
             +GL IV+LA++ DR+      R R+
Sbjct: 255 LLAGLGIVVLAVLFDRITQSYGQRMRM 281


>gi|157369046|ref|YP_001477035.1| binding-protein-dependent transport systems inner membrane
           component [Serratia proteamaculans 568]
 gi|157320810|gb|ABV39907.1| binding-protein-dependent transport systems inner membrane
           component [Serratia proteamaculans 568]
          Length = 281

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 108/270 (40%), Positives = 161/270 (59%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
              + D++  +   L  N       +S  LL AV  +  +L+  P  V + VV LL    
Sbjct: 7   TFSIADWINRWVDVLVNNYGDMFRKISDTLLWAVIHLESLLRATPWWVMLAVVGLLAWHA 66

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R     V     LLL+   G W +  +TL+LVLV+T +++ IG+P G+LAA   R  ++
Sbjct: 67  TRRWLPTVVIVGLLLLVGTAGMWDKLMQTLALVLVATLLAVIIGIPQGILAARSDRVRAV 126

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   +D MQT+P+FVYLIP L+LFGLG VP I+AT++++ P  +RLT LGI      + E
Sbjct: 127 MMPLMDVMQTMPSFVYLIPVLMLFGLGKVPAILATVIYATPPLIRLTDLGIRQVDKEVME 186

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           +  AFGA  +Q    V+LP A+P I+A + QT M+SLSMVVV +++G+ GLG  VL  + 
Sbjct: 187 SVTAFGANRWQKLFGVQLPLALPSIMAGINQTTMMSLSMVVVASMIGARGLGEDVLVGIQ 246

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           T+++G G E+GL IVILA+++DR+      
Sbjct: 247 TLNVGLGLEAGLAIVILAVVIDRITQAYGR 276


>gi|227512913|ref|ZP_03942962.1| glycine/betaine/carnitine ABC superfamily ATP binding cassette
           transporter, membrane protein [Lactobacillus buchneri
           ATCC 11577]
 gi|227523041|ref|ZP_03953090.1| glycine/betaine/carnitine ABC superfamily ATP binding cassette
           transporter, membrane protein [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083913|gb|EEI19225.1| glycine/betaine/carnitine ABC superfamily ATP binding cassette
           transporter, membrane protein [Lactobacillus buchneri
           ATCC 11577]
 gi|227089859|gb|EEI25171.1| glycine/betaine/carnitine ABC superfamily ATP binding cassette
           transporter, membrane protein [Lactobacillus hilgardii
           ATCC 8290]
          Length = 283

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 169/273 (61%), Gaps = 4/273 (1%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+ D++  F   L +    F N ++  +   +N   ++   +P  +F+ +V      +
Sbjct: 6   QLPVSDWINHFVNWL-EGFTGFFNGITNFIGGIINGFQWIFDLIPIWLFIVLVVGGTYWL 64

Query: 68  KR---SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            R     T+     +GLL +  QGYW++ T+TL+LVL S+ I++ IGVP+G+  A     
Sbjct: 65  NRKTKHWTLIGFEVIGLLYVWNQGYWRDMTQTLTLVLTSSLIALVIGVPIGIWMAKSKVV 124

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
             I++  LD MQT+P FVYLIPA+  FG+GMVPG++A+++F++P ++R+T LGI   P  
Sbjct: 125 EIIVKPILDFMQTMPAFVYLIPAVAFFGIGMVPGVIASVIFAMPPTIRMTNLGIRQVPED 184

Query: 185 LKEAACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLR 244
           L EAA ++G+T +Q   KV+LP A   ++A + Q++MLSLSMVV+ +++G+ GLG  V  
Sbjct: 185 LIEAADSYGSTSWQKLVKVQLPLAKSTLMAGVNQSMMLSLSMVVIASMIGAMGLGNKVYF 244

Query: 245 ALNTVDIGRGFESGLCIVILAIILDRLFSIPDP 277
           A+   D G GF +GL IVILAIILDR+    + 
Sbjct: 245 AVGRNDAGSGFAAGLAIVILAIILDRITQAINR 277


>gi|294101047|ref|YP_003552905.1| binding-protein-dependent transport systems inner membrane
           component [Aminobacterium colombiense DSM 12261]
 gi|293616027|gb|ADE56181.1| binding-protein-dependent transport systems inner membrane
           component [Aminobacterium colombiense DSM 12261]
          Length = 283

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 101/268 (37%), Positives = 167/268 (62%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +  ++      L Q      + +S  +L  +     +L  +P   ++  V+ L     R 
Sbjct: 10  IASHVNNGVNWLLQAMAPTFDSISNGILAMLLKTENLLHIIPWWFYIIFVAFLAWKATRC 69

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           ++  +   + L+LI   G W+    TL++V+ S F+S+ IG+P+G+L A       I++ 
Sbjct: 70  LSTTIILPLSLILIGSFGLWKLAMGTLAIVIASVFLSLLIGIPVGILMAEAKGVEPIVKP 129

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAAC 190
            LD+MQT+P+FVYLIPA++ FGLG VP ++AT+++S+P  +RLT LG+   P   +EAA 
Sbjct: 130 ILDAMQTMPSFVYLIPAMMFFGLGKVPAVLATLIYSLPPVIRLTNLGLKQVPQPAQEAAI 189

Query: 191 AFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVD 250
           A+GAT +Q+ ++V +P A+P I+A + QT M++LSMVVV +++G+ GLG  VL ++N +D
Sbjct: 190 AYGATKWQLLKEVRVPLAMPTIMAGVNQTTMMALSMVVVASMIGARGLGQEVLLSINRID 249

Query: 251 IGRGFESGLCIVILAIILDRLFSIPDPR 278
           +GRGFE+G+ IVI+AI +DR+      R
Sbjct: 250 VGRGFEAGISIVIMAIAIDRITQGFARR 277


>gi|56697293|ref|YP_167659.1| glycine betaine/proline ABC transporter, permease protein [Ruegeria
           pomeroyi DSS-3]
 gi|56679030|gb|AAV95696.1| glycine betaine/proline ABC transporter, permease protein [Ruegeria
           pomeroyi DSS-3]
          Length = 343

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 87/269 (32%), Positives = 147/269 (54%), Gaps = 1/269 (0%)

Query: 11  LGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRS 70
           +   ++E F+       +  + L+  L   +   L   +  P  + + +++L+V    RS
Sbjct: 68  VTKGVEEGFLAAKGVLRFVLDPLTQPLSWMLEFALATFEATPWWIMMPLLALVVFFASRS 127

Query: 71  ITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRL 130
           + +       L+ +    ++    +TL+++ V  F+ +  GVP+G+  +   R   +   
Sbjct: 128 MRLVGFVMACLMFLAFVDHYDHAMQTLAIIFVCAFLCVLFGVPIGIAMSRNDRLQRMTIP 187

Query: 131 FLDSMQTIPTFVYLIPALVLFGLGMVPGI-VATIVFSIPTSVRLTRLGIISTPPILKEAA 189
            LD +QT+P+FVYLIP + LF +       +A I+++I   +RLT LGI      + EAA
Sbjct: 188 ILDMLQTLPSFVYLIPLIFLFSVTEPKLYGIAIILYAIVPVIRLTDLGIRLVDRDVIEAA 247

Query: 190 CAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTV 249
            +FG T  Q    V++P A+P I+A + QTIM+SL+MVV+ +LV + GLGV VLR +  +
Sbjct: 248 DSFGMTDRQKLFGVQIPLALPNIMAGVNQTIMMSLAMVVIASLVSAPGLGVLVLRGIRNL 307

Query: 250 DIGRGFESGLCIVILAIILDRLFSIPDPR 278
           ++G G  SGL IV+LA+ILDR+      R
Sbjct: 308 ELGVGLVSGLGIVLLAVILDRVTKAALNR 336


>gi|94500530|ref|ZP_01307061.1| ABC-type proline/glycine betaine transport system, permease
           component [Oceanobacter sp. RED65]
 gi|94427320|gb|EAT12299.1| ABC-type proline/glycine betaine transport system, permease
           component [Oceanobacter sp. RED65]
          Length = 313

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 102/268 (38%), Positives = 153/268 (57%), Gaps = 1/268 (0%)

Query: 9   IPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVK 68
           +PL   +      +         +++  +   +N +  +L  +P  + +  ++ L   + 
Sbjct: 42  VPLDSMVDTAINAIVPVLRPVFQVIAQPITWFLNAIESLLLVIPAPLIIIALAALAWKLS 101

Query: 69  RSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSII 128
            +  I + T  GLL I   G W +   TLSLV+ S F  + IG+P+G+  +   +  SI+
Sbjct: 102 -NRRIGIATLFGLLAIGLIGAWDQAMTTLSLVITSLFFCILIGLPMGIWLSRSDKAVSIV 160

Query: 129 RLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEA 188
           R  LD+MQT P FVYLIP ++LF  G V G++ TI+F++P  +RLT LGI   P  L EA
Sbjct: 161 RPILDAMQTTPAFVYLIPIVMLFSPGKVAGVIVTIIFAVPPMIRLTNLGIRQVPEDLIEA 220

Query: 189 ACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNT 248
           A AFG +P Q+  KV+LP A+P I+A + QT+ML LSMVV+ +++   GLG+ VL+ +  
Sbjct: 221 ARAFGTSPKQLLFKVQLPLALPTIMAGVNQTLMLGLSMVVIASMIAVPGLGLMVLQGIGR 280

Query: 249 VDIGRGFESGLCIVILAIILDRLFSIPD 276
            DIG     GL IVILAIILDR+     
Sbjct: 281 NDIGIATVGGLGIVILAIILDRITQHIG 308


>gi|257056604|ref|YP_003134436.1| ABC-type proline/glycine betaine transport system, permease
           component [Saccharomonospora viridis DSM 43017]
 gi|256586476|gb|ACU97609.1| ABC-type proline/glycine betaine transport system, permease
           component [Saccharomonospora viridis DSM 43017]
          Length = 310

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 119/267 (44%), Positives = 167/267 (62%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            IP+G  +      LT +     + +S +L   VNL+  VL   P LV V +   L  + 
Sbjct: 6   TIPVGSAVDTAIQWLTTHAGGLFDAISAVLFFLVNLIYGVLAAPPSLVLVVIFGALAALC 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            RS+ + V   +  LLI     W +  +TLS+V+++  I++ +GVP+GVLAA  P+   +
Sbjct: 66  VRSVGMTVFAVLAFLLIDSMQLWHQMLQTLSVVVLAALIAIVVGVPVGVLAAKSPKTGLV 125

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +R  LD MQT+P FVYL+PA+  FG+G+VPGIV+T VF++P +VRLT LGI        E
Sbjct: 126 VRPVLDFMQTLPVFVYLVPAVFFFGIGVVPGIVSTTVFAVPPAVRLTELGIRQVDRETVE 185

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           AA AFGA P QV R+VELP A+P I+A + Q IML+LSMVVV  LVG+ GLG  V+  + 
Sbjct: 186 AARAFGARPRQVLREVELPLAVPSIMAGVNQVIMLALSMVVVAGLVGAEGLGGVVVEGVT 245

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSI 274
            ++IG  FE G+ +VILA+ LDR+ S 
Sbjct: 246 QLNIGAAFEGGIAVVILAVYLDRITSA 272


>gi|89096764|ref|ZP_01169656.1| glycine betaine ABC transporter (permease) [Bacillus sp. NRRL
           B-14911]
 gi|89088779|gb|EAR67888.1| glycine betaine ABC transporter (permease) [Bacillus sp. NRRL
           B-14911]
          Length = 277

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 122/269 (45%), Positives = 175/269 (65%), Gaps = 1/269 (0%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +PL  ++      +      F +IL+  +   V   + VL+ +P L+ + + + L   V
Sbjct: 6   KLPLASWVDSAVSWIKDILGPFFDILTDGIGAVVEFFVMVLESIPALLLILIFAGLAWWV 65

Query: 68  KRSITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSI 127
            R  TIA+ TA+GLLLI   GYW  T +TL+LVL S  IS+ IG+P+G+  +   R  SI
Sbjct: 66  SR-WTIALFTAIGLLLIDNLGYWDGTIDTLALVLASVIISIIIGIPIGIWISQSDRAQSI 124

Query: 128 IRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKE 187
           +   LD MQT+P FVYLIPA++ FG+G+VPGI+A+++FS+P ++RLT LGI   P  L E
Sbjct: 125 LTPILDFMQTMPAFVYLIPAIIFFGIGVVPGIIASVIFSMPPTIRLTNLGIRQVPEDLVE 184

Query: 188 AACAFGATPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALN 247
           A+ AFG+TP Q   KV+LP A+  I+A + Q+IML+LSMVV+ +LVG+ GLG  V RA+ 
Sbjct: 185 ASDAFGSTPSQKLFKVQLPLAMNTIMAGINQSIMLALSMVVIASLVGAPGLGADVYRAVT 244

Query: 248 TVDIGRGFESGLCIVILAIILDRLFSIPD 276
            + +G GFE+GL IVILAI+LDR+     
Sbjct: 245 QLKVGTGFEAGLAIVILAIVLDRISQNIR 273


>gi|293606871|ref|ZP_06689219.1| glycine betaine/L-proline ABC superfamily ATP binding cassette
           transporter, permease protein [Achromobacter piechaudii
           ATCC 43553]
 gi|292814723|gb|EFF73856.1| glycine betaine/L-proline ABC superfamily ATP binding cassette
           transporter, permease protein [Achromobacter piechaudii
           ATCC 43553]
          Length = 285

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 103/267 (38%), Positives = 159/267 (59%)

Query: 15  LQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMVKRSITIA 74
           +  F   L  N       LS  +L A+  +  +L+  P    V V   +   V R I ++
Sbjct: 15  IDGFVDHLVTNYADTLETLSQPVLHALVWLEQLLRNSPWWAVVAVTIAIAYGVSRRIGLS 74

Query: 75  VGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRFYSIIRLFLDS 134
           +     L +I   G W    +TL+L++++  +S+ IG+PLGVL A      SI+   LD 
Sbjct: 75  LAMGALLCVIGVLGLWDAGMQTLALMIMAAGLSVVIGIPLGVLMARINWLRSIMLPVLDV 134

Query: 135 MQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGA 194
           MQT+P+FVYLIP ++LFGLG +P I+AT+++++P  +RLT LGI      + EA+ AFGA
Sbjct: 135 MQTMPSFVYLIPVVMLFGLGKIPAIIATVIYAVPPLIRLTDLGIRLVDREVLEASRAFGA 194

Query: 195 TPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVPVLRALNTVDIGRG 254
            P Q    V+LP A+P I+A + QT M++LSMVV+ +++G+ GLG  VL  +N +++GRG
Sbjct: 195 NPRQQLFGVQLPLALPNIMAGINQTTMMALSMVVIASMIGARGLGYEVLLGINRLEVGRG 254

Query: 255 FESGLCIVILAIILDRLFSIPDPRDRI 281
             +GL IV+LA++ DR+      R R+
Sbjct: 255 LLAGLGIVVLAVLFDRITQSYGQRMRM 281


>gi|227509979|ref|ZP_03940028.1| glycine/betaine/carnitine ABC superfamily ATP binding cassette
           transporter, membrane-spanning subunit [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
 gi|227190585|gb|EEI70652.1| glycine/betaine/carnitine ABC superfamily ATP binding cassette
           transporter, membrane-spanning subunit [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
          Length = 283

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 169/273 (61%), Gaps = 4/273 (1%)

Query: 8   PIPLGDYLQEFFVCLTQNGEWFCNILSFILLKAVNLVLFVLQYLPPLVFVCVVSLLVLMV 67
            +P+ D++  F   L +    F N ++  +   +N   ++   +P  +F+ +V      +
Sbjct: 6   QLPVSDWINHFVNWL-EGFTGFFNGITNFIGGIINGFQWIFDLIPIWLFIVLVVGGTYWL 64

Query: 68  KR---SITIAVGTAMGLLLIIKQGYWQETTETLSLVLVSTFISMFIGVPLGVLAAWYPRF 124
            R     T+     +GLL +  QGYW++ T+TL+LVL S+ I++ IGVP+G+  A     
Sbjct: 65  NRKTKHWTLIGFEVIGLLYVWNQGYWRDMTQTLTLVLTSSLIALVIGVPIGIWMAKSKVV 124

Query: 125 YSIIRLFLDSMQTIPTFVYLIPALVLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPI 184
             I++  LD