RPSBLAST alignment for GI: 254780341 and conserved domain: COG0573

>gnl|CDD|30918 COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism]. Length = 310
 Score = 57.1 bits (138), Expect = 5e-09
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 26/167 (15%)

Query: 101 LVSTFISMFIGVPLGVLAAWY-------PRFYSIIRLFLDSMQTIPTFVY-------LIP 146
           L+++ I++ I VP+G+  A +        R   +++  ++ +  IP+ VY       L P
Sbjct: 85  LITSLIALLIAVPVGIGTAIFLSEYAPPRRLRRVLKPAIELLAGIPSVVYGFFGLFVLAP 144

Query: 147 AL------------VLFGLGMVPGIVATIVFSIPTSVRLTRLGIISTPPILKEAACAFGA 194
            L              FG+ ++   +   +  +PT   L+R  + + P  L+EAA A GA
Sbjct: 145 FLRDVFGPPLGFNLGPFGISILTAGIVLAIMILPTIASLSRDALRAVPRSLREAAYALGA 204

Query: 195 TPFQVFRKVELPFAIPQIVASLTQTIMLSLSMVVVTALVGSNGLGVP 241
           T ++  RKV LP A   IV ++   +  +L   +   +V  N   +P
Sbjct: 205 TKWETIRKVILPAARSGIVGAVILGLGRALGETMAVTMVIGNTARIP 251