BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter asiaticus str. psy62] (309 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport system [Candidatus Liberibacter asiaticus str. psy62] Length = 309 Score = 640 bits (1652), Expect = 0.0, Method: Compositional matrix adjust. Identities = 309/309 (100%), Positives = 309/309 (100%) Query: 1 MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIK 60 MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIK Sbjct: 1 MYKILAVCLFLTTFSISYARDADSCTPVRFADTGWTDIAATTAMTSVILEEILGYKTNIK 60 Query: 61 LLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVG 120 LLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVG Sbjct: 61 LLAVPVTFRSLKNKGIDIFMGYWYPSLEKFIAPYLEEGSIKLVAENLQGAKYMLAVNDVG 120 Query: 121 FALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASF 180 FALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASF Sbjct: 121 FALGIKSYQDIAKYKKELGAKIYGIEPGNEGNQRILDMINNNKFSLKGFRLIEASELASF 180 Query: 181 SQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPN 240 SQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPN Sbjct: 181 SQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISGFGEASVYTVVRSDYLDKCPN 240 Query: 241 ISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPS 300 ISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPS Sbjct: 241 ISRLLKNIKFSVALENEMMKLILNNKQDRQFVGRTMLRTHPDLLKNWLIGVTTFDGQDPS 300 Query: 301 RQLERFMNN 309 RQLERFMNN Sbjct: 301 RQLERFMNN 309 >gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 28.9 bits (63), Expect = 0.10, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 25/45 (55%) Query: 176 ELASFSQIRRDQRNNIPAVFLSWEPHPINSDLNIHYLPGGEEISG 220 +LASF ++ D R ++ + S + + S + YL GG E++G Sbjct: 92 DLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAG 136 >gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 24.3 bits (51), Expect = 2.6, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 266 KQDRQFVGRTMLRTHPDLLKNWLIGVTTFDG 296 + D++F H D +KN + G T DG Sbjct: 67 ETDKRFYSHIDCPGHADYVKNMITGATQADG 97 >gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 24.3 bits (51), Expect = 2.6, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 266 KQDRQFVGRTMLRTHPDLLKNWLIGVTTFDG 296 + D++F H D +KN + G T DG Sbjct: 67 ETDKRFYSHIDCPGHADYVKNMITGATQADG 97 >gi|254780925|ref|YP_003065338.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus Liberibacter asiaticus str. psy62] Length = 833 Score = 23.9 bits (50), Expect = 3.7, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 56 KTNIKLLAVPVTFRSLKNKGIDIFMG-YWYPSLEKFIA 92 + N+KL ++FR L +K I+ +G Y S+ FI+ Sbjct: 745 RKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFIS 782 >gi|255764474|ref|YP_003064854.2| glycosyl transferase group 1 [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 23.9 bits (50), Expect = 3.9, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 83 WYPSLEKFIAPYLEEG 98 WY +L F+AP L EG Sbjct: 242 WYRALNIFVAPPLYEG 257 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.138 0.405 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 198,078 Number of Sequences: 1233 Number of extensions: 8298 Number of successful extensions: 21 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 7 length of query: 309 length of database: 328,796 effective HSP length: 74 effective length of query: 235 effective length of database: 237,554 effective search space: 55825190 effective search space used: 55825190 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 38 (19.2 bits)