RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] (154 letters) >gnl|CDD|31123 COG0780, COG0780, Enzyme related to GTP cyclohydrolase I [General function prediction only]. Length = 149 Score = 164 bits (417), Expect = 9e-42 Identities = 60/148 (40%), Positives = 83/148 (56%), Gaps = 4/148 (2%) Query: 1 MSEITLNGLSILGGKAKPCD--DPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQP 58 TL G++I G D + A+LE P+ + + +V+ PEF SLCP+T QP Sbjct: 1 QPIETLEGVTIDGQ-DITIDEYEFTNAILEAFPNPHPGRDVLVKLVSPEFKSLCPITGQP 59 Query: 59 DFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAY 118 DFA + ++YIP +ESKSLKL++ SFRNH FHE C I L +L P++L + Sbjct: 60 DFATIYIEYIPDKACVESKSLKLYLFSFRNHGIFHEQCANRIFNDLKALLKPEYLEVYGK 119 Query: 119 WYPRGGIPIDIFWQTSAP-PEGVFLPNQ 145 + PRGGI ID F ++ P P L Q Sbjct: 120 FTPRGGIDIDPFRESGKPGPPYETLREQ 147 >gnl|CDD|144718 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I. This family includes GTP cyclohydrolase enzymes and a family of related bacterial proteins. Length = 86 Score = 89.9 bits (224), Expect = 3e-19 Identities = 23/85 (27%), Positives = 29/85 (34%), Gaps = 5/85 (5%) Query: 58 PDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGA 117 P F + YIP +I L ++ SF E T IA LV L PK + + Sbjct: 1 PFFGKAHIAYIPNGKVIGLSKLARYVDSFARRLQVQERLTNQIADALVEALKPKGVAVVI 60 Query: 118 Y-----WYPRGGIPIDIFWQTSAPP 137 RG TSA Sbjct: 61 EAEHLCMTMRGVRKPGSKTVTSALR 85 >gnl|CDD|29763 cd00642, GTP_cyclohydro1, GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate. The enzyme product is the precursor of tetrahydrofolate in eubacteria, fungi, and plants and of the folate analogs in methanogenic bacteria. In vertebrates and insects it is the biosynthtic precursor of tetrahydrobiopterin (BH4) which is involved in the formation of catacholamines, nitric oxide, and the stimulation of T lymphocytes. The biosynthetic reaction of BH4 is controlled by a regulatory protein GFRP which mediates feedback inhibition of GTP-CH-I by BH4. This inhibition is reversed by phenylalanine. The decameric GTP-CH-I forms a complex with two pentameric GFRP in the presence of phenylalanine or a combination of GTP and BH4, respectively.. Length = 185 Score = 32.9 bits (75), Expect = 0.037 Identities = 21/92 (22%), Positives = 35/92 (38%), Gaps = 2/92 (2%) Query: 20 DDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSL 79 N+ I ++ + +V+ S+C P + + + YIPKD +I L Sbjct: 46 QALNDPKNTAIFDEDHDEMVIVKDI--TLFSMCEHHLVPFYGKVHIAYIPKDKVIGLSKL 103 Query: 80 KLFMASFRNHHSFHEDCTIYIARRLVTILDPK 111 + F E T IA + IL P+ Sbjct: 104 ARIVEFFSRRLQVQERLTKQIAVAIQEILGPQ 135 >gnl|CDD|32220 COG2037, Ftr, Formylmethanofuran:tetrahydromethanopterin formyltransferase [Energy production and conversion]. Length = 297 Score = 28.7 bits (64), Expect = 0.68 Identities = 16/61 (26%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Query: 91 SFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQY 150 +F E AR L+T D KW +I A G + + +LP ++ P Sbjct: 11 TFAEAFDGKYARVLITAADKKWAKIAA--TEATGFGTSVIGCPAEAGIEKYLPPEETPDG 68 Query: 151 R 151 R Sbjct: 69 R 69 >gnl|CDD|32728 COG2904, COG2904, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 137 Score = 28.4 bits (63), Expect = 0.90 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 67 YIPKD--WLIESKSLKLFMASFRN 88 YIP D LIESKS KL++ SF Sbjct: 78 YIPADSPNLIESKSFKLYLNSFNQ 101 >gnl|CDD|145908 pfam03008, DUF234, Archaea bacterial proteins of unknown function. Length = 97 Score = 26.8 bits (60), Expect = 2.2 Identities = 14/63 (22%), Positives = 24/63 (38%), Gaps = 8/63 (12%) Query: 73 LIESKSLKLFMASFRNH------HSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIP 126 LIE + + + + F E C + P++ +IG +W+ G Sbjct: 11 LIEEGNYEEVLEKIKEDLNEYLGFVFEELCRELLRELNKLGKLPRFTKIGRWWH--KGEE 68 Query: 127 IDI 129 IDI Sbjct: 69 IDI 71 >gnl|CDD|39470 KOG4269, KOG4269, KOG4269, Rac GTPase-activating protein BCR/ABR [Signal transduction mechanisms]. Length = 1112 Score = 26.6 bits (58), Expect = 3.0 Identities = 9/42 (21%), Positives = 12/42 (28%), Gaps = 7/42 (16%) Query: 32 SQNKNLNYVVRFTIPEF-------TSLCPVTSQPDFAHMILD 66 KN Y ++ IP + S D LD Sbjct: 590 KDGKNQQYDCKWYIPLKDLQVNRYNANEASPSIIDPPDEELD 631 >gnl|CDD|145206 pfam01913, FTR, lobe. This enzyme EC:2.3.1.101 is involved in archaebacteria in the formation of methane from carbon dioxide. N-terminal distal lobe of alpha+beta ferredoxin-like fold. SCOP reports fold duplication with C-terminal proximal lobe. Length = 144 Score = 26.4 bits (59), Expect = 3.2 Identities = 8/28 (28%), Positives = 13/28 (46%) Query: 91 SFHEDCTIYIARRLVTILDPKWLRIGAY 118 +F E + + R L+T +W R A Sbjct: 11 TFAEAFPMKVTRVLITAATERWAREAAT 38 >gnl|CDD|30416 COG0067, GltB, Glutamate synthase domain 1 [Amino acid transport and metabolism]. Length = 371 Score = 26.0 bits (57), Expect = 4.3 Identities = 14/66 (21%), Positives = 23/66 (34%), Gaps = 6/66 (9%) Query: 68 IPKDWLIESKSLKLFMASFRNHHSFHE------DCTIYIARRLVTILDPKWLRIGAYWYP 121 P+ W++ + A + +H + E D ILD LR YW Sbjct: 299 GPEAWVVGTDMDPEGRAFYEDHSALMEPWDGPADIVFTDGSEEGAILDRNGLRPARYWIT 358 Query: 122 RGGIPI 127 + G + Sbjct: 359 KDGEVV 364 >gnl|CDD|99731 cd06410, PB1_UP2, Uncharacterized protein 2. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.. Length = 97 Score = 26.0 bits (58), Expect = 4.4 Identities = 6/36 (16%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Query: 34 NKNLNYVVRFTIP--EFTSLCPVTSQPDFAHMILDY 67 + +++ +P + +L V++ D +M+ +Y Sbjct: 47 GAGVVVTLKYQLPDEDLDALISVSNDEDLKNMMEEY 82 >gnl|CDD|37065 KOG1854, KOG1854, KOG1854, Mitochondrial inner membrane protein (mitofilin) [Cell wall/membrane/envelope biogenesis]. Length = 657 Score = 25.8 bits (56), Expect = 4.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 50 SLCPVTSQPDFAHMILDYIPK 70 +L VT + LD IPK Sbjct: 502 ALKEVTKDDELVAAALDSIPK 522 >gnl|CDD|99995 cd04299, GT1_Glycogen_Phosphorylase_like, This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The members of this family are found in bacteria and Archaea.. Length = 778 Score = 26.0 bits (58), Expect = 4.8 Identities = 21/95 (22%), Positives = 31/95 (32%), Gaps = 47/95 (49%) Query: 11 ILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPK 70 I GKA P D+P + L++ I V F + +P+F I+ Sbjct: 517 IFAGKAHPADEPGKELIQEI----------VEF-----------SRRPEFRGRIV----- 550 Query: 71 DWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLV 105 F ED + +AR LV Sbjct: 551 ---------------------FLEDYDMALARHLV 564 >gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only]. Length = 478 Score = 25.6 bits (56), Expect = 6.0 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Query: 113 LRIGAYWYPRGGIPIDIFWQTSAPPEGVF 141 L G +GGI +D F+QTS P V+ Sbjct: 318 LEKGILLDSKGGIKVDEFFQTSVP--NVY 344 >gnl|CDD|31658 COG1469, COG1469, Uncharacterized conserved protein [Function unknown]. Length = 289 Score = 25.3 bits (55), Expect = 8.0 Identities = 9/24 (37%), Positives = 10/24 (41%) Query: 92 FHEDCTIYIARRLVTILDPKWLRI 115 F ED IARRLV + Sbjct: 240 FVEDVVREIARRLVEDFPDAAFTV 263 >gnl|CDD|30685 COG0337, AroB, 3-dehydroquinate synthetase [Amino acid transport and metabolism]. Length = 360 Score = 24.8 bits (54), Expect = 9.8 Identities = 12/55 (21%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 18 PCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDW 72 P + E LLE + K L +RF + + + D ++LD + + Sbjct: 305 PDELDAEKLLEAMARDKKVLGGKIRFVLLKEIGKAEIAEGVDE-ELLLDALEEVH 358 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.141 0.461 Gapped Lambda K H 0.267 0.0764 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,117,967 Number of extensions: 110108 Number of successful extensions: 225 Number of sequences better than 10.0: 1 Number of HSP's gapped: 223 Number of HSP's successfully gapped: 19 Length of query: 154 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 68 Effective length of database: 4,405,363 Effective search space: 299564684 Effective search space used: 299564684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.1 bits)