BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] (154 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780344|ref|YP_003064757.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 154 Score = 322 bits (826), Expect = 1e-90, Method: Compositional matrix adjust. Identities = 154/154 (100%), Positives = 154/154 (100%) Query: 1 MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDF 60 MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDF Sbjct: 1 MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDF 60 Query: 61 AHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWY 120 AHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWY Sbjct: 61 AHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWY 120 Query: 121 PRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG 154 PRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG Sbjct: 121 PRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG 154 >gi|254780804|ref|YP_003065217.1| DNA polymerase III subunit delta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 25.8 bits (55), Expect = 0.39, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 24/50 (48%) Query: 30 IPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSL 79 I S N +R +FTS+ ++ PD ++D I + LI KS+ Sbjct: 116 IKSNEIKKNNTLRKIAEKFTSVLAISCYPDNKIHLMDLIEESLLIGQKSI 165 >gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator complex subunit SufB [Candidatus Liberibacter asiaticus str. psy62] Length = 489 Score = 23.5 bits (49), Expect = 1.8, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query: 82 FMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAP 136 F+++ +N + + + RR +T+ DP W RI YP I D + +AP Sbjct: 43 FISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARI---RYP--AIDFDDLYYYAAP 92 >gi|255764506|ref|YP_003065297.2| GTP cyclohydrolase I [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 23.5 bits (49), Expect = 2.1, Method: Compositional matrix adjust. Identities = 17/68 (25%), Positives = 27/68 (39%) Query: 48 FTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTI 107 F S C P + + L YIPK +I L + + E T+ IA + + Sbjct: 90 FFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESS 149 Query: 108 LDPKWLRI 115 D K + + Sbjct: 150 TDSKGVAV 157 >gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 23.1 bits (48), Expect = 2.7, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 5 TLNGLSILGGKAKPCDDPNEALLERIPSQNK 35 TLNG I+ G AK + NE I S+N+ Sbjct: 77 TLNGAKIVYGFAKSALEKNERESVAIHSKNE 107 >gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 22.7 bits (47), Expect = 3.1, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 20 DDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQ 57 D PN A L+ IP Q + + F+ + + P+ S+ Sbjct: 7 DTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASR 44 >gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus str. psy62] Length = 395 Score = 22.3 bits (46), Expect = 3.7, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 14/29 (48%) Query: 48 FTSLCPVTSQPDFAHMILDYIPKDWLIES 76 F P +P +ILD I K+W + S Sbjct: 76 FGGGTPSLIEPQNIALILDGIAKNWTVSS 104 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 22.3 bits (46), Expect = 4.6, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 24 EALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIE 75 E+L+++ + L+ T SL + S +FAH I + + D LI+ Sbjct: 1076 ESLIKKFFGEEIKLSVFDSNTKESNKSLAVINSTLEFAHSIRERVLFDELIQ 1127 >gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 21.6 bits (44), Expect = 7.7, Method: Composition-based stats. Identities = 6/17 (35%), Positives = 12/17 (70%) Query: 60 FAHMILDYIPKDWLIES 76 + ++I Y+P W+IE+ Sbjct: 127 YQNVISGYVPSPWIIEA 143 >gi|254780353|ref|YP_003064766.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 753 Score = 21.2 bits (43), Expect = 9.7, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 63 MILDYIPKDWLIESKSLKLFMASFR 87 M LD I K+WL + + +SFR Sbjct: 355 MPLDGILKEWLAHRREVLFRRSSFR 379 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.141 0.461 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,491 Number of Sequences: 1233 Number of extensions: 4073 Number of successful extensions: 14 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 10 length of query: 154 length of database: 328,796 effective HSP length: 67 effective length of query: 87 effective length of database: 246,185 effective search space: 21418095 effective search space used: 21418095 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)