HHsearch alignment of GI: 254780345 and MMDB domain: 1tzv_A_

>1tzv_A (A:) NUSB protein, N utilization substance protein B homolog; RNA-protein interaction, transcriptional antitermination, transcription regulation; 1.35A {Thermotoga maritima}
Probab=99.98  E-value=5.5e-32  Score=212.03  Aligned_cols=139  Identities=32%  Similarity=0.430  Sum_probs=127.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             13234699999999999999569998999999998531001322112014434399999999999998999999999741
Q gi|254780345|r   12 LSHRRGIARLAAVQALYQIDIIGCSTTEIISEYETYRFCADTELDVESVYLHVDLEWFRVIIHGVMDRKQHIDLLISSCL   91 (170)
Q Consensus        12 ~~~~r~~aR~~aiq~Ly~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~d~~~~~~lv~~v~~~~~~id~~I~~~l   91 (170)
                      |..+|+.+|+.|+|+||++++.+.+.++++..+..           ...++..|+.|++++++|++++...+|.+|.+++
T Consensus         1 Mk~~r~~~R~~a~q~L~~~~~~~~~~~~~l~~~~~-----------~~~~~~~d~~~~~~lv~gv~~~~~~ld~~i~~~l   69 (142)
T 1tzv_A            1 MKTPRRRMRLAVFKALFQHEFRRDEDLEQILEEIL-----------DETYDKKAKEDARRYIRGIKENLSMIDDLISRYL   69 (142)
T ss_dssp             CCCCHHHHHHHHHHHHHHHTTCTTSCHHHHHHHHC-----------CTTSCHHHHHHHHHHHHHHHHTHHHHHHHHHTTC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH-----------HCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99827999999999999998619985999999998-----------6435656799999999999980999999999853


Q ss_pred             CCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             03576332353489999999999864355781033988999999833877231499999999952333203
Q gi|254780345|r   92 TEKWSFSRLDMILCSILRAGVLELIECHSVPVEVIISEYVCIAHDFFYGDEPKFINAVLDKVSRKEEIKRS  162 (170)
Q Consensus        92 ~~~w~~~rl~~~~~~iLr~a~~El~~~~~~p~~vvInE~V~lak~f~~~~~~~fVNaVL~ki~k~~~~~~~  162 (170)
                       ++|+++|++.++++|||+|+||+++++++|++++|||||++||.|++++++||||||||+++|+.+..+.
T Consensus        70 -~~~~~~rl~~~~r~iLr~a~~El~~~~~~p~~vvInEaVelak~~~~~~~~~fVNaVL~~i~k~~~~~~~  139 (142)
T 1tzv_A           70 -EKWSLNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAKRYGTENSGKFVNGILDRIAKEHAPKEK  139 (142)
T ss_dssp             -SSSCGGGSCHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHCCGGG
T ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             -1588688878999999999999986233420389999999999868886331189999999986595101