HHsearch results for GI: 254780345 and protein with PDBid: 2yxl_A

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii OT3}
Probab=99.66  E-value=2e-15  Score=111.28  Aligned_cols=96  Identities=19%  Similarity=0.097  Sum_probs=85.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             14434399999999999998999999999741035763323534899999999998643557810339889999998338
Q gi|254780345|r   60 VYLHVDLEWFRVIIHGVMDRKQHIDLLISSCLTEKWSFSRLDMILCSILRAGVLELIECHSVPVEVIISEYVCIAHDFFY  139 (170)
Q Consensus        60 ~~~~~d~~~~~~lv~~v~~~~~~id~~I~~~l~~~w~~~rl~~~~~~iLr~a~~El~~~~~~p~~vvInE~V~lak~f~~  139 (170)
                      .....|+.++++||+|++|++..||.+|.+++.+  +...+++..+++||+|+||++|+ + |++++|+++|++|+.+..
T Consensus        44 ~~~~~dr~~~t~lvygvlR~~~~Ld~~l~~~~~~--~~~~~~~~vr~~Lrlg~yqllfl-~-p~~aav~~~v~~a~~~~~  119 (450)
T 2yxl_A           44 VEEAWLNRVLTMIFYDIMKKQGLIDKVIKEIVGV--TPLILDPWLRAALRVAVDIALFH-D-PSSQTIKNLRWKASDFIS  119 (450)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSS--CGGGSCHHHHHHHHHHHHHHHHS-C-BCHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--CHHHCCHHHHHHHHHHHHHHHHC-C-CHHHHHHHHHHHHHHHHC
T ss_conf             6671578999999999998599999999987089--91336999999999999999864-9-517899999999876512


Q ss_pred             CCCCCHHHHHHHHHHHHHHH
Q ss_conf             77231499999999952333
Q gi|254780345|r  140 GDEPKFINAVLDKVSRKEEI  159 (170)
Q Consensus       140 ~~~~~fVNaVL~ki~k~~~~  159 (170)
                      ....+||||||+++.|+...
T Consensus       120 ~~~~~~vnavlr~vlr~~~~  139 (450)
T 2yxl_A          120 SRTHPYVGMYFWDLLDKIFE  139 (450)
T ss_dssp             HHSCHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHCC
T ss_conf             23247667998730133202