RPSBLAST alignment of GI: 254780345 and MMDB domain: 1tzv_A_

>1tzv_A (A:) NUSB protein, N utilization substance protein B homolog; RNA-protein interaction, transcriptional antitermination, transcription regulation; 1.35A {Thermotoga maritima}Length = 142
 Score =  106 bits (266), Expect = 2e-24
 Identities = 44/143 (30%), Positives = 67/143 (46%), Gaps = 12/143 (8%)

Query: 16  RGIARLAAVQALYQIDIIGCSTTEIISEYETYRFCADTELDVESVYLHVDLEWFRVIIHG 75
           R   RLA  +AL+Q +       E I E        D   D          E  R  I G
Sbjct: 5   RRRMRLAVFKALFQHEFRRDEDLEQILE-----EILDETYD------KKAKEDARRYIRG 53

Query: 76  VMDRKQHIDLLISSCLTEKWSFSRLDMILCSILRAGVLELIECHSVPVEVIISEYVCIAH 135
           + +    ID LIS  L EKWS +RL ++  ++LR    EL+    +P+EV I E + IA 
Sbjct: 54  IKENLSMIDDLISRYL-EKWSLNRLSVVDRNVLRLATYELLFEKDIPIEVTIDEAIEIAK 112

Query: 136 DFFYGDEPKFINAVLDKVSRKEE 158
            +   +  KF+N +LD+++++  
Sbjct: 113 RYGTENSGKFVNGILDRIAKEHA 135