RPSBLAST alignment of GI: 254780345 and protein with PDBid: 3d3b

>3d3b_A Protein NUSB, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermination; HET: NHE; 1.30A {Escherichia coli K12} PDB: 3d3c_A 3imq_A 1ey1_A Length = 141
 Score =  100 bits (251), Expect = 1e-22
 Identities = 41/146 (28%), Positives = 68/146 (46%), Gaps = 14/146 (9%)

Query: 11  KLSHRRGIARLAAVQALYQIDIIGCSTTEIISEYETYRFCADTELDVESVYLHVDLEWFR 70
           + + RR  AR  AVQALY   +      ++  +     F A+ ++        VD+ +FR
Sbjct: 4   EPAARR-RARECAVQALYSWQLSQNDIADVEYQ-----FLAEQDVK------DVDVLYFR 51

Query: 71  VIIHGVMDRKQHIDLLISSCLTEKWSFSRLDMILCSILRAGVLELIECHSVPVEVIISEY 130
            ++ GV     ++D L+   L        L  +  ++LR  + EL +   VP +V I+E 
Sbjct: 52  ELLAGVATNTAYLDGLMKPYL--SRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEA 109

Query: 131 VCIAHDFFYGDEPKFINAVLDKVSRK 156
           + +A  F   D  KF+N VLDK +  
Sbjct: 110 IELAKSFGAEDSHKFVNGVLDKAAPV 135