RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780346|ref|YP_003064759.1| riboflavin synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] (149 letters) >gnl|CDD|178833 PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional. Length = 154 Score = 129 bits (328), Expect = 2e-31 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 7/145 (4%) Query: 7 HVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVT---PGVLEIPAAVSMVMNAKTRS 63 + I+ ARF + ++ L EG ++ L V +I PG EIP A + S Sbjct: 14 RIGIVVARFNDFITDALLEGALDALKRHGVSEENIDVVRVPGAFEIPLAAKKLA----ES 69 Query: 64 VTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVS 123 YD +I LG V+RG+T H D +A+ V +GL D+S+ +P+G G++ D+ +QA +R Sbjct: 70 GKYDAVIALGAVIRGETPHFDYVANEVAKGLADVSLETGVPVGFGVLTTDTIEQAIERAG 129 Query: 124 PSHLDRGGCAARSALAMIELKKSLS 148 ++G AA +AL M L K L Sbjct: 130 TKAGNKGAEAALAALEMANLLKQLK 154 >gnl|CDD|129220 TIGR00114, lumazine-synth, 6,7-dimethyl-8-ribityllumazine synthase. Archaeal members of this family are considered putative, although included in the seed and scoring above the trusted cutoff. Length = 138 Score = 77.8 bits (192), Expect = 9e-16 Identities = 43/139 (30%), Positives = 73/139 (52%), Gaps = 7/139 (5%) Query: 8 VLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSI---VTPGVLEIPAAVSMVMNAKTRSV 64 V I+ ARF +++ ML +G ++ L + +I PG E+P AV + + Sbjct: 3 VGIVIARFNRDITDMLLKGAIDALKRLGAEVDNIDVIWVPGAFELPLAVKKLA----ETG 58 Query: 65 TYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSP 124 YD +I LG V+RG T H + +A +G+ DL+++ P+ GI+ + +QA +R Sbjct: 59 KYDAVIALGCVIRGGTPHFEYVADEAAKGIADLALDYDKPVIFGILTTGTIEQAIERAGD 118 Query: 125 SHLDRGGCAARSALAMIEL 143 ++G AA +AL M +L Sbjct: 119 KAGNKGVEAAVAALEMAKL 137 >gnl|CDD|178026 PLN02404, PLN02404, 6,7-dimethyl-8-ribityllumazine synthase. Length = 141 Score = 75.2 bits (185), Expect = 7e-15 Identities = 40/135 (29%), Positives = 67/135 (49%), Gaps = 9/135 (6%) Query: 10 IIEARFYENLSAMLFEGCVNVLHSRAVQWSSIV---TPGVLEIP-AAVSMVMNAKTRSVT 65 ++ ARF E ++ L EG + +V+ +I PG EIP A + S Sbjct: 12 VVVARFNEIITKNLLEGALETFKRYSVKEENIDVVWVPGSFEIPVVAQRLAK-----SGK 66 Query: 66 YDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPS 125 YD I+ +G V+RG T H D +A++ G++ +N +P G++ D +QA +R Sbjct: 67 YDAILCIGAVIRGDTTHYDAVANSAASGVLSAGLNSGVPCIFGVLTCDDMEQALNRAGGK 126 Query: 126 HLDRGGCAARSALAM 140 ++G AA +A+ M Sbjct: 127 AGNKGAEAALTAVEM 141 >gnl|CDD|177863 PLN02216, PLN02216, protein SRG1. Length = 357 Score = 26.7 bits (59), Expect = 2.5 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 34 RAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYD 67 A QWSSI+ P V E+ M+ R V D Sbjct: 5 GATQWSSIIVPSVQEM-VKEKMITTVPPRYVRSD 37 >gnl|CDD|163100 TIGR03008, pepcterm_CAAX, CAAX prenyl protease-related protein. The CAAX prenyl protease, in eukaryotes, catalyzes three covalent modifications, including cleavage and acylation, at the C-terminus of certain proteins in a process connected to protein sorting. This family describes a bacterial protein family homologous to one domain of the CAAX-processing enzyme. Members of this protein family are found in genomes that carry a predicted protein sorting system, PEP-CTERM/exosortase, usually in the vicinity of the EpsH homolog that is the hallmark of the system. The function of this protein is unknown, but it may relate to protein motification. Length = 222 Score = 26.3 bits (58), Expect = 3.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 68 GIIVLGVVMRGKTAHCDVIAHAVTRGLVDL 97 G+ +++R + ++AHAVT GL+ L Sbjct: 182 GLAYNLLLLRTGSIMACILAHAVTNGLLGL 211 >gnl|CDD|183985 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed. Length = 725 Score = 25.0 bits (55), Expect = 7.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Query: 107 NGIVVVDSEQQAFDRV 122 +VVV++ AF+RV Sbjct: 312 QALVVVEACAAAFERV 327 >gnl|CDD|183713 PRK12740, PRK12740, elongation factor G; Reviewed. Length = 668 Score = 25.1 bits (56), Expect = 8.0 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 24 FEGCVNVLHSRAVQWSSIVTPGVLEIPA 51 F G V++L +A ++ +EIPA Sbjct: 157 FTGVVDLLSMKAYRYDEGGPSEEIEIPA 184 >gnl|CDD|181511 PRK08636, PRK08636, aspartate aminotransferase; Provisional. Length = 403 Score = 25.0 bits (55), Expect = 8.7 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Query: 6 PHVLIIEARFYENLSAMLFEGCVNVLHSRA---VQWSSIVTPGVLEIPAAVSMVMNAKTR 62 P +E FYE L A+ + ++ A + + TP +LE+ A + + + T Sbjct: 187 PTTATVEKSFYERLVALAKKERFYIISDIAYADITFDGYKTPSILEVEGAKDVAVESYTL 246 Query: 63 SVTYD 67 S +Y+ Sbjct: 247 SKSYN 251 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.135 0.389 Gapped Lambda K H 0.267 0.0653 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,399,181 Number of extensions: 144408 Number of successful extensions: 226 Number of sequences better than 10.0: 1 Number of HSP's gapped: 223 Number of HSP's successfully gapped: 13 Length of query: 149 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 64 Effective length of database: 4,157,793 Effective search space: 266098752 Effective search space used: 266098752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 53 (24.4 bits)