HHsearch alignment for GI: 254780347 and conserved domain: KOG3310

>KOG3310 consensus.
Probab=100.00  E-value=0  Score=364.65  Aligned_cols=195  Identities=34%  Similarity=0.547  Sum_probs=185.1

Q ss_pred             CCCEEEEEEEEEEEEEE-CCCCEEEEEEECCCCCCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCCCC
Q ss_conf             94533711899999987-69935999981755112667724653331542365045556686799998656553201355
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTP-IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIAS   79 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~-~~~~~~l~i~~~~~~~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l~~   79 (204)
T Consensus         1 mftgive~mG~Vkd~~~~dd~Gf~~kI~A~~iL~Dch~GDSIAVNGtCLTVTeFn~~-----~FtVGiaPEtlr~tnl~~   75 (210)
T KOG3310           1 MFTGIVECMGEVKDLGMADDGGFDLKIGARVILEDCHLGDSIAVNGTCLTVTEFNAE-----EFTVGIAPETLRKTNLEE   75 (210)
T ss_pred             CCCCHHHHHEEHHHCCCCCCCCEEEEECCCEEEEECCCCCEEEECCEEEEEEEECCC-----CEEEECCHHHHHHCCHHH
T ss_conf             941057221132304765468788896687355312357727883479988860542-----058725879963256988


Q ss_pred             CCCCCCCCCCCCCHHHHCCCCCEEEECCCCHHHHHHHCCCCCEEEEEEEC-CCCCCCEECCCCEEEEEEEEEEEEEEC--
Q ss_conf             56566313354320000047642454010011011100233137987513-421121002357199823457877416--
Q gi|254780347|r   80 WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL-PHNLEQFIAVKGSVCLNGVSLTVNLVG--  156 (204)
Q Consensus        80 l~~G~~VNLE~a~~~g~~lgGH~v~GhVd~~~~i~~i~~~~~~~~~~i~~-~~~~~~~l~~KgsI~idGvSLTV~~~~--  156 (204)
T Consensus        76 ~k~G~pVNLERAv~~~~RmGGH~VQGHVDtva~Ivs~~~eG~si~f~f~~rD~~~lKYIV~KGfiavDGTSLTi~~Vd~~  155 (210)
T KOG3310          76 LKKGSPVNLERAVQPVSRMGGHVVQGHVDTVAVIVSMEVEGDSIWFKFKLRDKGLLKYIVPKGFIAVDGTSLTIVDVDDE  155 (210)
T ss_pred             HHCCCCCCHHHHCCCCCCCCCEEEEEEECCEEEEEEECCCCCEEEEEEEECCCCCEEEEECCCEEEECCCEEEEEEECCC
T ss_conf             73599625656406122005547876603237899861369779999885682505788115479972736899997688


Q ss_pred             CCEEEEEEEHHHHCCCCHHHCCCCCEEEEEHHHHHHHHHHHHCC
Q ss_conf             85499998444330133002489967469713588999998602
Q gi|254780347|r  157 KNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYAL  200 (204)
Q Consensus       157 ~~~f~v~lIp~Tl~~T~l~~~k~Gd~VNiE~D~l~kyv~r~~~~  200 (204)
T Consensus       156 ~s~F~imMI~yTQ~nVimp~KkiGd~VN~EVD~~GKy~Ekl~~~  199 (210)
T KOG3310         156 ESCFNIMMIAYTQQNVIMPTKKIGDKVNLEVDIMGKYVEKLLTS  199 (210)
T ss_pred             CCEEEEEEEEECCCCEEEECHHCCCEEEEEEEHHHHHHHHHHHH
T ss_conf             87589998410234278750142864668982676799999998