HHsearch alignment for GI: 254780347 and conserved domain: TIGR00187

>TIGR00187 ribE riboflavin synthase, alpha subunit; InterPro: IPR001783 The following proteins have been shown , to be structurally and evolutionary related: Riboflavin synthase alpha chain (2.5.1.9 from EC) (RS-alpha) (gene ribC in Escherichia coli, ribB in Bacillus subtilis and Photobacterium leiognathi, RIB5 in yeast. This enzyme synthesises riboflavin from two moles of 6,7- dimethyl-8-(1'-D-ribityl)lumazine (Lum), a pteridine-derivative. Photobacterium phosphoreum lumazine protein (LumP) (gene luxL). LumP is a protein that modulates the colour of the bioluminescence emission of bacterial luciferase. In the presence of LumP, light emission is shifted to higher energy values (shorter wavelength). LumP binds non-covalently to 6,7-dimethyl-8-(1'-D-ribityl)lumazine. Vibrio fischeri yellow fluorescent protein (YFP) (gene luxY). Like LumP, YFP modulates light emission but towards a longer wavelength. YFP binds non-covalently to FMN. These proteins seem to have evolved from the duplication of a domain of about 100 residues. In its C-terminal section, this domain contains a conserved motif [KR]-V-N-[LI]-E which has been proposed to be the binding site for lumazine (Lum) and some of its derivatives. RS-alpha which binds two molecules of Lum has two perfect copies of this motif, while LumP which binds one molecule of Lum, has a Glu instead of Lys/Arg in the first position of the second copy of the motif. Similarly, YFP, which binds to one molecule of FMN, also seems to have a potentially dysfunctional binding site by substitution of Gly for Glu in the last position of the first copy of the motif. .
Probab=100.00  E-value=0  Score=484.46  Aligned_cols=196  Identities=36%  Similarity=0.590  Sum_probs=186.8

Q ss_pred             CCCEEEEEEEEEEEEEECCCC------EEEEEEEC-CCCCCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHH
Q ss_conf             945337118999999876993------59999817-55112667724653331542365045556686799998656553
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTPIAKG------MRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNR   73 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~~~~~------~~l~i~~~-~~~~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~   73 (204)
T Consensus         1 MFTGIi~~~g~~~s~~~~~~~esGGqG~~~~~~~~~~~L~D~~lGdSIA~NGvCLTV~e~~~-----~~f~vd~s~ET~~   75 (225)
T TIGR00187         1 MFTGIIQGTGKVKSIKEKRLFESGGQGISLTINLAQKILEDLHLGDSIAVNGVCLTVTEINK-----DHFSVDLSPETLK   75 (225)
T ss_pred             CCCEEECCCEEEEECCCCCCCCCCCCCEEECCCCCHHHHCCCCCCCEEEECCEEEEEEEECC-----CEEEEEECHHHHH
T ss_conf             96302023023320013322012785047634872345402520454123674332221128-----8689983256733


Q ss_pred             HCCCCCCCCC-CCCCCCCCCHHHHCCCCCEEEECCCCHHHHHHHCCCCCEEEEEEEC-CCC-------CCCEECCCCEEE
Q ss_conf             2013555656-6313354320000047642454010011011100233137987513-421-------121002357199
Q gi|254780347|r   74 ITNIASWGIG-TFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL-PHN-------LEQFIAVKGSVC  144 (204)
Q Consensus        74 ~T~l~~l~~G-~~VNLE~a~~~g~~lgGH~v~GhVd~~~~i~~i~~~~~~~~~~i~~-~~~-------~~~~l~~KgsI~  144 (204)
T Consensus        76 ~t~L~~~k~gr~~VNiErA~~~~~~~GGHfvsGHvd~~a~i~~i~~~~N~~~~~f~~~~~~qkqWqey~~ky~v~KGsIa  155 (225)
T TIGR00187        76 RTNLGDLKVGRTKVNIERALKADGRIGGHFVSGHVDGVAEIEKIEESENAVQFWFKLRDSEQKQWQEYLLKYIVEKGSIA  155 (225)
T ss_pred             HHHHHHHHHCCCEECEEHHHHCCCEECCEEEEEEEEEEEEEEEHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             54233355236720110674169741666751116665522300301582899984058134678887687642477579


Q ss_pred             EEEEEEEEEEECCCEEE----EEEEHHHHCCCCHHHCCCCCEEEEEHHHHHHHHHHHHCCC
Q ss_conf             82345787741685499----9984443301330024899674697135889999986023
Q gi|254780347|r  145 LNGVSLTVNLVGKNFFD----VLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALN  201 (204)
Q Consensus       145 idGvSLTV~~~~~~~f~----v~lIp~Tl~~T~l~~~k~Gd~VNiE~D~l~kyv~r~~~~~  201 (204)
T Consensus       156 vDG~SLTi~~v~e~~f~Gafyv~lIP~T~~~T~~~~~k~G~~VNIE~D~~gk~~~~~l~~~  216 (225)
T TIGR00187       156 VDGISLTIGKVTEDSFCGAFYVSLIPHTLEETILGLKKIGDRVNIEIDMLGKYVARFLEKT  216 (225)
T ss_pred             ECCEEEEEEEECCCCEEEEEEEEECCCCHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHH
T ss_conf             9667876577413603315899863101222210111768776542085789999999987