HHsearch alignment for GI: 254780347 and conserved domain: pfam00677

>pfam00677 Lum_binding Lumazine binding domain. This domain binds to derivatives of lumazine in some proteins. Some proteins have lost the residues involved in binding lumazine.
Probab=99.94  E-value=1.3e-27  Score=182.06  Aligned_cols=85  Identities=35%  Similarity=0.480  Sum_probs=82.2

Q ss_pred             EECCCCHHHHHHHCCCCCEEEEEEECCCC-CCCEECCCCEEEEEEEEEEEEEECCCEEEEEEEHHHHCCCCHHHCCCCCE
Q ss_conf             54010011011100233137987513421-12100235719982345787741685499998444330133002489967
Q gi|254780347|r  104 SGHIDGTVEILFLDFIGDSMYCRLSLPHN-LEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDL  182 (204)
Q Consensus       104 ~GhVd~~~~i~~i~~~~~~~~~~i~~~~~-~~~~l~~KgsI~idGvSLTV~~~~~~~f~v~lIp~Tl~~T~l~~~k~Gd~  182 (204)
T Consensus         1 TGiV~~~g~V~~i~~~~~~~~~~i~~~~~~~~~~~~~~~SIavnGvcLTV~~~~~~~~~~~ii~eTl~~T~l~~~k~G~~   80 (86)
T pfam00677         1 TGIVEGVGEIAEIIENGNARSIWIKLPDKMLTKVLIGKDSIAVNGISLTVTEVTGNQFTFDLIPETLKRTNLGSLKVGDK   80 (86)
T ss_pred             CCCEEEEEEEEEEEECCCCEEEEEEECCHHHHHCCCCCCEEEECCEEEEEEEECCCEEEEEEEHHHHHHCCCCCCCCCCE
T ss_conf             96882899999999979969999993817854202368879985589999998799999999899984383534877999


Q ss_pred             EEEEHH
Q ss_conf             469713
Q gi|254780347|r  183 INIEVD  188 (204)
Q Consensus       183 VNiE~D  188 (204)
T Consensus        81 VNlE~D   86 (86)
T pfam00677        81 VNLEID   86 (86)
T ss_pred             EEEEEC
T ss_conf             996589