HHsearch alignment of GI: 254780347 and MMDB domain: 1i8d_A_7-91

>1i8d_A (A:7-91) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli}
Probab=99.92  E-value=4.2e-25  Score=167.02  Aligned_cols=84  Identities=27%  Similarity=0.453  Sum_probs=63.8

Q ss_pred             EEEEEEEEEEECCCCEEEEEEECCC-CCCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCCCCCCCCCC
Q ss_conf             1189999998769935999981755-112667724653331542365045556686799998656553201355565663
Q gi|254780347|r    7 TDIGKIIAMTPIAKGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTF   85 (204)
Q Consensus         7 ~~~G~V~~i~~~~~~~~l~i~~~~~-~~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l~~l~~G~~   85 (204)
                      |++|+|.++++.++++++.+++|.. ++.+.+|+|||||||||||+++.     +++|+|+++|||+++|||+.|++|++
T Consensus         1 e~~g~I~~i~~~~~~~~~~i~~~~~~~~~i~~~~SIavnGvsLTV~~~~-----~~~f~v~i~~eTl~~T~l~~~~~G~~   75 (85)
T 1i8d_A            1 QGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEIN-----GNHVSFDLMKETLRITNLGDLKVGDW   75 (85)
T ss_dssp             CEEEEEEEEEECSSEEEEEEECCGGGTTTCCTTCEEEETTEEEEEEEEE-----TTEEEEEEEHHHHHHSGGGGCCTTCE
T ss_pred             CCEEEEEEEEECCCCEEEEEECCCCCCCCCCCCCEEEECCEEEEEEEEC-----CCEEEEECHHHHHHHHCCCCCCCCCE
T ss_conf             7089999999769966999982840004477888799787980468972-----65478863377764412453356974


Q ss_pred             CCCCCCCHHH
Q ss_conf             1335432000
Q gi|254780347|r   86 INLERSVKLG   95 (204)
Q Consensus        86 VNLE~a~~~g   95 (204)
                      |||||||++.
T Consensus        76 VNlE~~l~~~   85 (85)
T 1i8d_A           76 VNVERAAKFS   85 (85)
T ss_dssp             EEEEECCBTT
T ss_pred             EEECCCCCCC
T ss_conf             6004452588