HHsearch alignment of GI: 254780347 and MMDB domain: 1i8d_A_7-91

>1i8d_A (A:7-91) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli}
Probab=99.91  E-value=8.2e-25  Score=165.32  Aligned_cols=83  Identities=27%  Similarity=0.326  Sum_probs=80.5

Q ss_pred             CCHHHHHHHCCCCCEEEEEEECCCCCCCEECCCCEEEEEEEEEEEEEECCCEEEEEEEHHHHCCCCHHHCCCCCEEEEEH
Q ss_conf             00110111002331379875134211210023571998234578774168549999844433013300248996746971
Q gi|254780347|r  108 DGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEV  187 (204)
Q Consensus       108 d~~~~i~~i~~~~~~~~~~i~~~~~~~~~l~~KgsI~idGvSLTV~~~~~~~f~v~lIp~Tl~~T~l~~~k~Gd~VNiE~  187 (204)
                      +++|+|.++++.++++.++|++|+.+.+|+..|||||+|||||||+++.+++|.+++||||+++|||+.+++||+||||.
T Consensus         1 e~~g~I~~i~~~~~~~~~~i~~~~~~~~~i~~~~SIavnGvsLTV~~~~~~~f~v~i~~eTl~~T~l~~~~~G~~VNlE~   80 (85)
T 1i8d_A            1 QGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVSFDLMKETLRITNLGDLKVGDWVNVER   80 (85)
T ss_dssp             CEEEEEEEEEECSSEEEEEEECCGGGTTTCCTTCEEEETTEEEEEEEEETTEEEEEEEHHHHHHSGGGGCCTTCEEEEEE
T ss_pred             CCEEEEEEEEECCCCEEEEEECCCCCCCCCCCCCEEEECCEEEEEEEECCCEEEEECHHHHHHHHCCCCCCCCCEEEECC
T ss_conf             70899999997699669999828400044778887997879804689726547886337776441245335697460044


Q ss_pred             HHH
Q ss_conf             358
Q gi|254780347|r  188 DSM  190 (204)
Q Consensus       188 D~l  190 (204)
                      ++.
T Consensus        81 ~l~   83 (85)
T 1i8d_A           81 AAK   83 (85)
T ss_dssp             CCB
T ss_pred             CCC
T ss_conf             525