HHsearch alignment of GI: 254780347 and MMDB domain: 3ddy_A_95-186

>3ddy_A (A:95-186) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi}
Probab=99.96  E-value=1.8e-29  Score=192.62  Aligned_cols=89  Identities=19%  Similarity=0.197  Sum_probs=81.0

Q ss_pred             CCCEEEEEEEEEEEEEECCCCEEEEEEECCCC-CCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCCCC
Q ss_conf             94533711899999987699359999817551-12667724653331542365045556686799998656553201355
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT-SKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIAS   79 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~~~~~~~l~i~~~~~~-~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l~~   79 (204)
                      ||||||+++|+|.++++.+++.++.++.|..+ +.+.+|+|||||||||||+++.     +++|.|+++|||+++|+|+.
T Consensus         3 MftGiI~~~g~i~~i~~~~~~~~~~i~~~~~~~~~i~~g~SIavnGvcLTV~~i~-----~~~f~v~i~~eTl~~T~l~~   77 (92)
T 3ddy_A            3 GLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMS-----DSIITLNYSRDLLASTNIAS   77 (92)
T ss_dssp             CBCSCCCEEEEEEEEECCSSEEEEEEECCTTTCSCCCTTCEEEETTEEEECCEEE-----TTEEEEEEEGGGGGTSSGGG
T ss_pred             CEEEEEEEEEEEEEEEECCCEEEEEEECCHHHHCCEEECCEEEEEEEEEEEEEEC-----CCEEEEEECHHHHHHCCCCC
T ss_conf             5878944899999999769939999998979960187362387710799998441-----98999998057774162014


Q ss_pred             CCCCCCCCCCCCCHH
Q ss_conf             565663133543200
Q gi|254780347|r   80 WGIGTFINLERSVKL   94 (204)
Q Consensus        80 l~~G~~VNLE~a~~~   94 (204)
                      |++|++|||||++||
T Consensus        78 ~k~G~~VNlE~~~ky   92 (92)
T 3ddy_A           78 LAKDVKVNVEILNEW   92 (92)
T ss_dssp             CCTTCEEEEEECC--
T ss_pred             CCCCCEEEEEEEECC
T ss_conf             758998999998769