HHsearch results for GI: 254780347 and protein with PDBid: 1kzl_A

>1kzl_A Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} SCOP: b.43.4.3 b.43.4.3
Probab=99.80  E-value=8.4e-20  Score=135.10  Aligned_cols=86  Identities=19%  Similarity=0.275  Sum_probs=58.5

Q ss_pred             CCCEEEEEEEEEEEEEECCCCEEEEEEECCC-CCC--CCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCC
Q ss_conf             9453371189999998769935999981755-112--6677246533315423650455566867999986565532013
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN-TSK--MKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNI   77 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~~~~~~~l~i~~~~~-~~~--l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l   77 (204)
                      |.+|+|.++|+|.++.+.++.+++.+..+.. +.+  +++| |||+|||+|||.++.     +++|++.++|||+++|||
T Consensus        98 ~V~GHVD~~~~i~~i~~~~~~~~~~~~~~~~~~~~yiv~KG-sIaidGvSLTV~~v~-----~~~f~v~lIP~Tl~~T~l  171 (208)
T 1kzl_A           98 FVQGHVDTVAEIVEKKQDGEAIDFTFRPRDPFVLKYIVYKG-YIALDGTSLTITHVD-----DSTFSIMMISYTQSKVIM  171 (208)
T ss_dssp             CBCSCCCEEEEEEEEEEETTEEEEEEEESSGGGGGGCCTTC-EEEETTEEEEEEEEC-----SSCEEEEECHHHHTTSGG
T ss_pred             EEEEECCEEEEEEEEEECCCCEEEEEEEEEHHHHCCEEECC-EEEEEEEEEEEEEEC-----CCEEEEEEEHHHHHHCCC
T ss_conf             47887408999999997699637999951011221246501-099850489998672-----998999997788654511


Q ss_pred             CCCCCCCCCCCCCCC
Q ss_conf             555656631335432
Q gi|254780347|r   78 ASWGIGTFINLERSV   92 (204)
Q Consensus        78 ~~l~~G~~VNLE~a~   92 (204)
                      +.+++||+||+|.-+
T Consensus       172 ~~~~~Gd~VNiE~D~  186 (208)
T 1kzl_A          172 AKKNVGDLVNVEVDQ  186 (208)
T ss_dssp             GGCCTTCEEEEEECT
T ss_pred             CCCCCCCEEEEEEHH
T ss_conf             148789999986414