HHSEARCH alignment of GI: 254780347 and SCOP domain: d1i8da2

Alignment
>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=5.4e-38  Score=240.13  Aligned_cols=105  Identities=33%  Similarity=0.454  Sum_probs=97.1

Q ss_pred             CCCCEEEECCCCHHHHHHHCCCCCEEEEEEECC-CCCCCEECCCCEEEEEEEEEEEEEECCCEEEEEEEHHHHCCCCHHH
Q ss_conf             476424540100110111002331379875134-2112100235719982345787741685499998444330133002
Q gi|254780347|r   98 LDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLP-HNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM  176 (204)
Q Consensus        98 lgGH~v~GhVd~~~~i~~i~~~~~~~~~~i~~~-~~~~~~l~~KgsI~idGvSLTV~~~~~~~f~v~lIp~Tl~~T~l~~  176 (204)
                      +|||+||||||++|+|.++++.+++..+++.+| +.+.+|+..|||||+|||||||+++.+++|++++|||||++|||+.
T Consensus         1 igGH~vsGhV~~~G~I~~i~~~~~~~~~~i~~~~~~~~~~i~~g~SIavnGvcLTV~~~~~~~f~v~li~ETl~~T~l~~   80 (113)
T d1i8da2           1 IGGHLMSGHIMTTAEVAKILTSENNRQIWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLERTTLGK   80 (113)
T ss_dssp             CSSCCBCCCCCEEEEEEEEEEETTEEEEEEEESCGGGGGGCCTTCEEEETTEEEECCSBCSSEEEEEECHHHHHHSSGGG
T ss_pred             CCCEEEEEEECEEEEEEEEEECCCCEEEEEEEEHHHHHHHHHHHHEEECCCCEEEEEEECCCEEEEEEEHHHHHHCCCCC
T ss_conf             98501606968799999999738834888874137776554323237615725887633487899996789865491124


Q ss_pred             CCCCCEEEEEHHHHHHH----HHHHHCCCC
Q ss_conf             48996746971358899----999860233
Q gi|254780347|r  177 HKVGDLINIEVDSMMRY----IARLYALNT  202 (204)
Q Consensus       177 ~k~Gd~VNiE~D~l~ky----v~r~~~~~~  202 (204)
                      |++||+||||+|+++||    ++|+++.++
T Consensus        81 ~~~G~~VNlE~D~~~k~i~~~~~~~~~~~~  110 (113)
T d1i8da2          81 KKLGARVNIEIDPQTQAVVDTVERVLAARE  110 (113)
T ss_dssp             CCTTCEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHHHHHH
T ss_conf             768998899383515799999999875514


SCOP domain information

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Riboflavin synthase
domain: Riboflavin synthase
species: Escherichia coli [TaxId: 562]