HHSEARCH alignment of GI: 254780347 and SCOP domain: d1i8da2

Alignment
>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]}
Probab=99.91  E-value=6.3e-25  Score=163.68  Aligned_cols=86  Identities=16%  Similarity=0.211  Sum_probs=78.3

Q ss_pred             CCCEEEEEEEEEEEEEECCCCEEEEEEECC-CC-CCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCCC
Q ss_conf             945337118999999876993599998175-51-1266772465333154236504555668679999865655320135
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NT-SKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIA   78 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~~~~~~~l~i~~~~-~~-~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l~   78 (204)
                      |++|+|+++|+|.++.+.++..++.+..+. .+ ..+.+|+|||||||||||+++.     +++|+|+++|||+++|||+
T Consensus         5 ~vsGhV~~~G~I~~i~~~~~~~~~~i~~~~~~~~~~i~~g~SIavnGvcLTV~~~~-----~~~f~v~li~ETl~~T~l~   79 (113)
T d1i8da2           5 LMSGHIMTTAEVAKILTSENNRQIWFKVQDSQLMKYILYKGFIGIDGISLTVGEVT-----PTRFCVHLIPETLERTTLG   79 (113)
T ss_dssp             CBCCCCCEEEEEEEEEEETTEEEEEEEESCGGGGGGCCTTCEEEETTEEEECCSBC-----SSEEEEEECHHHHHHSSGG
T ss_pred             EEEEEECEEEEEEEEEECCCCEEEEEEEEHHHHHHHHHHHHEEECCCCEEEEEEEC-----CCEEEEEEEHHHHHHCCCC
T ss_conf             16069687999999997388348888741377765543232376157258876334-----8789999678986549112


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             5565663133543
Q gi|254780347|r   79 SWGIGTFINLERS   91 (204)
Q Consensus        79 ~l~~G~~VNLE~a   91 (204)
                      .|++|++||||--
T Consensus        80 ~~~~G~~VNlE~D   92 (113)
T d1i8da2          80 KKKLGARVNIEID   92 (113)
T ss_dssp             GCCTTCEEEEEEC
T ss_pred             CCCCCCEEEEEEE
T ss_conf             4768998899383


SCOP domain information

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Riboflavin synthase
domain: Riboflavin synthase
species: Escherichia coli [TaxId: 562]