HHSEARCH alignment of GI: 254780347 and SCOP domain: d1kzla1

Alignment
>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
Probab=99.93  E-value=3.6e-27  Score=176.85  Aligned_cols=90  Identities=18%  Similarity=0.239  Sum_probs=81.9

Q ss_pred             EEEECCCCHHHHHHHCCCC-CEEEEEEECCCCCCCEECCCCEEEEEEEEEEEEEECCCEEEEEEEHHHHCCCCHHHCCCC
Q ss_conf             2454010011011100233-137987513421121002357199823457877416854999984443301330024899
Q gi|254780347|r  102 LVSGHIDGTVEILFLDFIG-DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG  180 (204)
Q Consensus       102 ~v~GhVd~~~~i~~i~~~~-~~~~~~i~~~~~~~~~l~~KgsI~idGvSLTV~~~~~~~f~v~lIp~Tl~~T~l~~~k~G  180 (204)
                      +.+||||++|+|.++++.+ +++.+++..|+ +.+++..|||||+|||||||+++.+++|++++|||||++|||+.+++|
T Consensus         1 MFTGiV~~~g~I~~i~~~~~~~~~~~i~~~~-~~~~i~~g~SIavnGvcLTV~~~~~~~f~~~lipeTl~~T~l~~~~~G   79 (92)
T d1kzla1           1 MFTGLVEAIGVVKDVQGTIDNGFAMKIEAPQ-ILDDCHTGDSIAVNGTCLTVTDFDRYHFTVGIAPESLRLTNLGQCKAG   79 (92)
T ss_dssp             CBCSCCCEEEEEEEEEEETTTEEEEEEECGG-GCTTCCTTCEEEETTEEEEEEEECSSEEEEEECHHHHHHSSGGGCCTT
T ss_pred             CCCCCCCEEEEEEEEEECCCCEEEEEEECCH-HHHHCCCCCEEEECCEEEEEEEECCCEEEEEEEHHHCCCCCHHHCCCC
T ss_conf             9786508399999999879995999998707-764263476698566777767611104999997376156422217679


Q ss_pred             CEEEEEHHHHHH
Q ss_conf             674697135889
Q gi|254780347|r  181 DLINIEVDSMMR  192 (204)
Q Consensus       181 d~VNiE~D~l~k  192 (204)
                      |+||||.|+++.
T Consensus        80 ~~VNlE~sl~a~   91 (92)
T d1kzla1          80 DPVNLERAVLSS   91 (92)
T ss_dssp             CEEEEEECCCCS
T ss_pred             CEEEECCCCCCC
T ss_conf             999937125588


SCOP domain information

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Riboflavin synthase
domain: Riboflavin synthase
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]