BLAST/PSIBLAST alignment of GI: 254780347 and GI: 150396043 at iteration 1
>gi|150396043|ref|YP_001326510.1| riboflavin synthase subunit alpha [Sinorhizobium medicae WSM419] Length = 206
>gi|150027558|gb|ABR59675.1| riboflavin synthase, alpha subunit [Sinorhizobium medicae WSM419] Length = 206
 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/197 (55%), Positives = 142/197 (72%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G +LRV T+Y+   + +G SIAHAG+CLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLREGAKLRVATNYDPKTIDMGASIAHAGVCLTVTALPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA+W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIAAWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRH+++ TTW   K G
Sbjct: 121 DAVRFRLRAPEHLAKFVAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLDVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N EVD+M RY ARL
Sbjct: 181 DLVNFEVDTMARYAARL 197