BLAST/PSIBLAST alignment of GI: 254780347 and GI: 15964964 at iteration 1
>gi|15964964|ref|NP_385317.1| riboflavin synthase subunit alpha [Sinorhizobium meliloti 1021] Length = 206
>gi|307301035|ref|ZP_07580804.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti BL225C] Length = 206
>gi|15074143|emb|CAC45790.1| Probable riboflavin synthase alpha chain [Sinorhizobium meliloti 1021] Length = 206
>gi|20385602|gb|AAM21352.1| riboflavin synthase [Sinorhizobium meliloti] Length = 206
>gi|306903990|gb|EFN34576.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti BL225C] Length = 206
 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/204 (54%), Positives = 143/204 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G++LRV T+Y+   + LG S+AHAGICLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLEEGIKLRVATNYDPQTIDLGASVAHAGICLTVTSLPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIADWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +FIA KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EAVRFRLRAPEHLAKFIAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLEVTTWGERKSG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N EVD+M RY ARL      +
Sbjct: 181 DLVNFEVDTMARYAARLAEFPAPK 204