BLAST/PSIBLAST alignment of GI: 254780347 and GI: 315122229 at iteration 1
>gi|315122229|ref|YP_004062718.1| riboflavin synthase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 204
>gi|313495631|gb|ADR52230.1| riboflavin synthase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 204
 Score =  354 bits (909), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 165/200 (82%), Positives = 187/200 (93%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+IIA+ PIAKG+RLR+MTSY+TS M++GCSIAHAGICLTVV+LS+E SV+
Sbjct: 1   MFTGIVTDIGQIIAIMPIAKGLRLRLMTSYDTSTMRVGCSIAHAGICLTVVQLSDESSVN 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWYEVE+W ETNR+TN+ +W IGTF+NLERS+KLGD LDGHLVSGH+DGTVEILF+DF G
Sbjct: 61  NWYEVEIWEETNRLTNVVAWEIGTFVNLERSMKLGDELDGHLVSGHVDGTVEILFMDFFG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+YCRLSLPHNLE+FIAVKGSVCLNGVSLTVNLVG NFFDVLLIRHTIE+TTW MHK G
Sbjct: 121 DSVYCRLSLPHNLEKFIAVKGSVCLNGVSLTVNLVGDNFFDVLLIRHTIEQTTWSMHKTG 180

Query: 181 DLINIEVDSMMRYIARLYAL 200
           DLINIEVDSMMRYI+RL A 
Sbjct: 181 DLINIEVDSMMRYISRLCAF 200