BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit
alpha [Candidatus Liberibacter asiaticus str. psy62]
         (204 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040024|gb|ACT56820.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 204

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD
Sbjct: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG
Sbjct: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG
Sbjct: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DLINIEVDSMMRYIARLYALNTSQ
Sbjct: 181 DLINIEVDSMMRYIARLYALNTSQ 204


>gi|315122229|ref|YP_004062718.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495631|gb|ADR52230.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 204

 Score =  354 bits (909), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 165/200 (82%), Positives = 187/200 (93%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+IIA+ PIAKG+RLR+MTSY+TS M++GCSIAHAGICLTVV+LS+E SV+
Sbjct: 1   MFTGIVTDIGQIIAIMPIAKGLRLRLMTSYDTSTMRVGCSIAHAGICLTVVQLSDESSVN 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWYEVE+W ETNR+TN+ +W IGTF+NLERS+KLGD LDGHLVSGH+DGTVEILF+DF G
Sbjct: 61  NWYEVEIWEETNRLTNVVAWEIGTFVNLERSMKLGDELDGHLVSGHVDGTVEILFMDFFG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+YCRLSLPHNLE+FIAVKGSVCLNGVSLTVNLVG NFFDVLLIRHTIE+TTW MHK G
Sbjct: 121 DSVYCRLSLPHNLEKFIAVKGSVCLNGVSLTVNLVGDNFFDVLLIRHTIEQTTWSMHKTG 180

Query: 181 DLINIEVDSMMRYIARLYAL 200
           DLINIEVDSMMRYI+RL A 
Sbjct: 181 DLINIEVDSMMRYISRLCAF 200


>gi|15964964|ref|NP_385317.1| riboflavin synthase subunit alpha [Sinorhizobium meliloti 1021]
 gi|307301035|ref|ZP_07580804.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti BL225C]
 gi|15074143|emb|CAC45790.1| Probable riboflavin synthase alpha chain [Sinorhizobium meliloti
           1021]
 gi|20385602|gb|AAM21352.1| riboflavin synthase [Sinorhizobium meliloti]
 gi|306903990|gb|EFN34576.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti BL225C]
          Length = 206

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/204 (54%), Positives = 143/204 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G++LRV T+Y+   + LG S+AHAGICLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLEEGIKLRVATNYDPQTIDLGASVAHAGICLTVTSLPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIADWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +FIA KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EAVRFRLRAPEHLAKFIAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLEVTTWGERKSG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N EVD+M RY ARL      +
Sbjct: 181 DLVNFEVDTMARYAARLAEFPAPK 204


>gi|307317769|ref|ZP_07597207.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti AK83]
 gi|306896531|gb|EFN27279.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti AK83]
          Length = 206

 Score =  233 bits (593), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 143/204 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G++LRV T+Y+   + LG S+AHAGICLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLEEGIKLRVATNYDPQTIDLGASVAHAGICLTVTSLPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIADWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EAVRFRLRAPEHLAKFVAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLEVTTWGERKSG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N EVD+M RY ARL      +
Sbjct: 181 DLVNFEVDTMARYAARLAEFPAPK 204


>gi|150396043|ref|YP_001326510.1| riboflavin synthase subunit alpha [Sinorhizobium medicae WSM419]
 gi|150027558|gb|ABR59675.1| riboflavin synthase, alpha subunit [Sinorhizobium medicae WSM419]
          Length = 206

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/197 (55%), Positives = 142/197 (72%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G +LRV T+Y+   + +G SIAHAG+CLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLREGAKLRVATNYDPKTIDMGASIAHAGVCLTVTALPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA+W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIAAWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRH+++ TTW   K G
Sbjct: 121 DAVRFRLRAPEHLAKFVAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLDVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N EVD+M RY ARL
Sbjct: 181 DLVNFEVDTMARYAARL 197


>gi|116251388|ref|YP_767226.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256036|emb|CAK07117.1| putative riboflavin synthase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 204

 Score =  230 bits (587), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 143/203 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++P+ +G++LRV TSY+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 2   MFTGIVTDIGTIESVSPLKEGIKLRVATSYDPATIDMGASISHSGICLTVTGLPQEGSNG 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 62  RWFEVEAWEEALRLTTIGAWQEGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTAEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 122 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 182 DFVNFEVDTMARYAARLAEFPST 204


>gi|190891195|ref|YP_001977737.1| riboflavin synthase, alpha chain [Rhizobium etli CIAT 652]
 gi|190696474|gb|ACE90559.1| riboflavin synthase protein, alpha chain [Rhizobium etli CIAT 652]
          Length = 203

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + +++P+ +G+RLRV T+Y+ S + +G SI+H+GICLTV  L  E S  
Sbjct: 1   MFTGIVTDVGTVESVSPLKEGIRLRVATAYDPSTIDMGASISHSGICLTVTGLPAEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWQQGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|209548783|ref|YP_002280700.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534539|gb|ACI54474.1| riboflavin synthase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 203

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 143/203 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + +++P+ +G+RLRV T+Y+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDVGTVESVSPLKEGIRLRVATAYDPATIDMGASISHSGICLTVTGLPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|327190086|gb|EGE57201.1| riboflavin synthase protein, alpha chain [Rhizobium etli CNPAF512]
          Length = 203

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G +  ++P+ +G+RLRV T+Y+ S + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDVGTVEFVSPLKEGIRLRVATAYDPSTIDMGASISHSGICLTVTGLPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWQQGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|241204004|ref|YP_002975100.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857894|gb|ACS55561.1| riboflavin synthase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 203

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV TSY+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDIGTIESVSSLKEGIKLRVATSYDPATIDMGASISHSGICLTVTGLPQEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGAWQEGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPST 203


>gi|325292543|ref|YP_004278407.1| Riboflavin synthase alpha chain [Agrobacterium sp. H13-3]
 gi|325060396|gb|ADY64087.1| Riboflavin synthase alpha chain [Agrobacterium sp. H13-3]
          Length = 203

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G +  +  +A+G+RLRV T+Y+   + +G SI+H G+CLTV +L E+ S +
Sbjct: 1   MFTGIVTDVGTVSELEALAEGIRLRVATNYDPKTIDMGASISHGGVCLTVTKLPEDGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            WYEVE W E  R+T IA W  GT +NLER++K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWYEVEAWEEALRLTTIAGWQKGTHVNLERALKIGDELGGHIVSGHVDGKAEILSVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+  TTW   + G
Sbjct: 121 EAVRIRLRAPDHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLTVTTWGERQPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|222085510|ref|YP_002544040.1| riboflavin synthase [Agrobacterium radiobacter K84]
 gi|221722958|gb|ACM26114.1| riboflavin synthase [Agrobacterium radiobacter K84]
          Length = 207

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG + +++P+ +G++LRV+T+Y+ + + +G SI+H+GICLTV  L E  S  
Sbjct: 2   MFTGIVTDIGTVESVSPLKEGIKLRVVTNYDPATIDMGASISHSGICLTVTGLPEAGSNG 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I  W  G+ INLERS+K+GD L GH+VSGH+DG  EIL     G
Sbjct: 62  RWFEVEAWEEALRLTTIGKWQAGSNINLERSLKIGDELGGHIVSGHVDGKAEILSATEEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 122 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +N EVD+M RY ARL
Sbjct: 182 DFVNFEVDTMARYAARL 198


>gi|121602297|ref|YP_988936.1| riboflavin synthase subunit alpha [Bartonella bacilliformis KC583]
 gi|6572099|emb|CAB63083.1| riboflavin synthase alpha chain [Bartonella bacilliformis]
 gi|120614474|gb|ABM45075.1| riboflavin synthase, alpha subunit [Bartonella bacilliformis KC583]
          Length = 205

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 138/198 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  + P+A+G+RL + T Y+   +K+G S+A +GICLTVV  +      
Sbjct: 1   MFTGIVTDIGCVEEIQPLAQGVRLNISTHYDLENLKVGASVACSGICLTVVECASTQKNS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN++ W  GTF+NLERS++LGD + GHLVSGH+DG  EI+      
Sbjct: 61  HWFAVEAWEETLRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHVDGLAEIIDQKNER 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D +Y RL +P  L  FIA KGSV LNG SLT+N V  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DMVYFRLQVPEQLAPFIAQKGSVALNGTSLTINYVEDNVFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+EVD   RY ARL+
Sbjct: 181 DQVNLEVDQFARYAARLF 198


>gi|227821533|ref|YP_002825503.1| riboflavin synthase subunit alpha [Sinorhizobium fredii NGR234]
 gi|227340532|gb|ACP24750.1| riboflavin synthase alpha chain [Sinorhizobium fredii NGR234]
          Length = 206

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 106/204 (51%), Positives = 138/204 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G +  +  + +G++LRV TSY+   + LG SIAHAG+CLTV  L E  S +
Sbjct: 1   MFTGIITDVGTVEKVAALREGVKLRVATSYDPKTIDLGASIAHAGVCLTVTALPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+ W  G  INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTISGWREGVRINLERSLKIGDELGGHIVSGHVDGQAEILAVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++  RL  P  L +F+A KGSV L+G SLTVN V    FDVLLIRH++E TTW   + G
Sbjct: 121 DAVRFRLRAPEQLARFVAPKGSVALDGTSLTVNRVDGAEFDVLLIRHSLEVTTWGERRAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N EVD+M RY ARL      +
Sbjct: 181 DFVNFEVDTMARYAARLAEFPAPK 204


>gi|218673495|ref|ZP_03523164.1| riboflavin synthase subunit alpha [Rhizobium etli GR56]
          Length = 203

 Score =  224 bits (572), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV TSY+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDIGTIESVSTLKEGIKLRVATSYDPATIDMGASISHSGICLTVTGLPQEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   + G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERQAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|159184646|ref|NP_354187.2| riboflavin synthase subunit alpha [Agrobacterium tumefaciens str.
           C58]
 gi|159139944|gb|AAK86972.2| riboflavin synthase alpha chain [Agrobacterium tumefaciens str.
           C58]
          Length = 203

 Score =  224 bits (570), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/203 (50%), Positives = 141/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G +  +  + +G+RLRV T+Y+   + +G SI+H G+CLTV +L ++ S +
Sbjct: 1   MFTGIVTDVGTVSELEALPEGVRLRVATNYDPKTIDMGASISHGGVCLTVTKLPDDGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            WYEVE W E  R+T IA W  GT +NLER++K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWYEVEAWEEALRLTTIAGWRQGTHVNLERALKIGDELGGHIVSGHVDGRAEILSVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRHT+  TTW   + G
Sbjct: 121 EAVRIRLRAPEHLAKFVAPKGSVALDGTSLTVNAVEGTDFDVLLIRHTLAVTTWGERQPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|86357149|ref|YP_469041.1| riboflavin synthase subunit alpha [Rhizobium etli CFN 42]
 gi|86281251|gb|ABC90314.1| riboflavin synthase, alpha chain protein [Rhizobium etli CFN 42]
          Length = 203

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV T+Y+ + + +G SI+H+GICLTV  L  E S  
Sbjct: 1   MFTGIVTDIGTIESVSSLKEGIKLRVATAYDPATIDMGASISHSGICLTVTGLPAEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVSSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT++ TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLDVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|222148206|ref|YP_002549163.1| riboflavin synthase subunit alpha [Agrobacterium vitis S4]
 gi|221735194|gb|ACM36157.1| riboflavin synthase alpha chain [Agrobacterium vitis S4]
          Length = 204

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 138/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  + P+ +G++LR++T+Y+   + +G SIAH+G CLTV  L E  S  
Sbjct: 2   MFTGIVTDIGTVEDIVPLKEGVKLRIVTAYDPHTIDMGASIAHSGTCLTVTGLPEAGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I SW  GT INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 62  RWFEVEAWEEALRLTTIGSWQKGTRINLERSLKIGDELGGHIVSGHVDGKAEILAIKAEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L +P NL +F+A KGSV L+G SLTVN V    FD+LLIRHT+E TTW   +VG
Sbjct: 122 DATRFTLRVPENLARFVAPKGSVALDGTSLTVNGVEGCDFDILLIRHTLEVTTWGDRQVG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +N EVD+M RY ARL
Sbjct: 182 DFVNFEVDTMARYAARL 198


>gi|218463059|ref|ZP_03503150.1| riboflavin synthase subunit alpha [Rhizobium etli Kim 5]
          Length = 203

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 140/203 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + +++ + +G+RLRV T+Y+   + +G SI+HAGICLTV  L +E S  
Sbjct: 1   MFTGIVTDVGTVESVSLLKEGIRLRVATAYDPKTIDMGASISHAGICLTVTALPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G  INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGRRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   + G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERQAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|256159496|ref|ZP_05457264.1| riboflavin synthase subunit alpha [Brucella ceti M490/95/1]
 gi|256254782|ref|ZP_05460318.1| riboflavin synthase subunit alpha [Brucella ceti B1/94]
          Length = 202

 Score =  221 bits (562), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 138/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W ET R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEETLRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|261221962|ref|ZP_05936243.1| riboflavin synthase subunit alpha [Brucella ceti B1/94]
 gi|265997925|ref|ZP_06110482.1| riboflavin synthase subunit alpha [Brucella ceti M490/95/1]
 gi|260920546|gb|EEX87199.1| riboflavin synthase subunit alpha [Brucella ceti B1/94]
 gi|262552393|gb|EEZ08383.1| riboflavin synthase subunit alpha [Brucella ceti M490/95/1]
          Length = 203

 Score =  221 bits (562), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 138/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W ET R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEETLRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|254701541|ref|ZP_05163369.1| riboflavin synthase subunit alpha [Brucella suis bv. 5 str. 513]
          Length = 202

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 138/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVEVW E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEVWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|23501655|ref|NP_697782.1| riboflavin synthase subunit alpha [Brucella suis 1330]
 gi|23347575|gb|AAN29697.1| riboflavin synthase, alpha subunit [Brucella suis 1330]
          Length = 202

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 138/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY+ARL
Sbjct: 181 DKVNIEIDQLARYVARL 197


>gi|261752091|ref|ZP_05995800.1| riboflavin synthase subunit alpha [Brucella suis bv. 5 str. 513]
 gi|261741844|gb|EEY29770.1| riboflavin synthase subunit alpha [Brucella suis bv. 5 str. 513]
          Length = 203

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 108/197 (54%), Positives = 138/197 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVEVW E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEVWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|254718885|ref|ZP_05180696.1| riboflavin synthase subunit alpha [Brucella sp. 83/13]
 gi|306838195|ref|ZP_07471049.1| riboflavin synthase, alpha subunit [Brucella sp. NF 2653]
 gi|306841986|ref|ZP_07474660.1| riboflavin synthase, alpha subunit [Brucella sp. BO2]
 gi|306843712|ref|ZP_07476312.1| riboflavin synthase, alpha subunit [Brucella sp. BO1]
 gi|306276022|gb|EFM57731.1| riboflavin synthase, alpha subunit [Brucella sp. BO1]
 gi|306287914|gb|EFM59331.1| riboflavin synthase, alpha subunit [Brucella sp. BO2]
 gi|306406704|gb|EFM62929.1| riboflavin synthase, alpha subunit [Brucella sp. NF 2653]
          Length = 202

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVERVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|161618735|ref|YP_001592622.1| riboflavin synthase subunit alpha [Brucella canis ATCC 23365]
 gi|163843039|ref|YP_001627443.1| riboflavin synthase subunit alpha [Brucella suis ATCC 23445]
 gi|254704090|ref|ZP_05165918.1| riboflavin synthase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|254707009|ref|ZP_05168837.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|254709882|ref|ZP_05171693.1| riboflavin synthase subunit alpha [Brucella pinnipedialis B2/94]
 gi|256031375|ref|ZP_05444989.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|256060884|ref|ZP_05451044.1| riboflavin synthase subunit alpha [Brucella neotomae 5K33]
 gi|256369200|ref|YP_003106708.1| riboflavin synthase subunit alpha [Brucella microti CCM 4915]
 gi|260168508|ref|ZP_05755319.1| riboflavin synthase subunit alpha [Brucella sp. F5/99]
 gi|260566662|ref|ZP_05837132.1| lumazine-binding protein [Brucella suis bv. 4 str. 40]
 gi|161335546|gb|ABX61851.1| riboflavin synthase, alpha subunit [Brucella canis ATCC 23365]
 gi|163673762|gb|ABY37873.1| riboflavin synthase, alpha subunit [Brucella suis ATCC 23445]
 gi|255999360|gb|ACU47759.1| riboflavin synthase subunit alpha [Brucella microti CCM 4915]
 gi|260156180|gb|EEW91260.1| lumazine-binding protein [Brucella suis bv. 4 str. 40]
          Length = 202

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|265983871|ref|ZP_06096606.1| riboflavin synthase subunit alpha [Brucella sp. 83/13]
 gi|264662463|gb|EEZ32724.1| riboflavin synthase subunit alpha [Brucella sp. 83/13]
          Length = 203

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVERVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|225627266|ref|ZP_03785303.1| riboflavin synthase, alpha subunit [Brucella ceti str. Cudo]
 gi|261314476|ref|ZP_05953673.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|261317424|ref|ZP_05956621.1| riboflavin synthase subunit alpha [Brucella pinnipedialis B2/94]
 gi|261324882|ref|ZP_05964079.1| riboflavin synthase subunit alpha [Brucella neotomae 5K33]
 gi|261754750|ref|ZP_05998459.1| riboflavin synthase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|261757978|ref|ZP_06001687.1| lumazine-binding protein [Brucella sp. F5/99]
 gi|265988461|ref|ZP_06101018.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|294852129|ref|ZP_06792802.1| riboflavin synthase [Brucella sp. NVSL 07-0026]
 gi|225617271|gb|EEH14316.1| riboflavin synthase, alpha subunit [Brucella ceti str. Cudo]
 gi|261296647|gb|EEY00144.1| riboflavin synthase subunit alpha [Brucella pinnipedialis B2/94]
 gi|261300862|gb|EEY04359.1| riboflavin synthase subunit alpha [Brucella neotomae 5K33]
 gi|261303502|gb|EEY06999.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|261737962|gb|EEY25958.1| lumazine-binding protein [Brucella sp. F5/99]
 gi|261744503|gb|EEY32429.1| riboflavin synthase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|264660658|gb|EEZ30919.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|294820718|gb|EFG37717.1| riboflavin synthase [Brucella sp. NVSL 07-0026]
          Length = 203

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|254713883|ref|ZP_05175694.1| riboflavin synthase subunit alpha [Brucella ceti M644/93/1]
 gi|254717060|ref|ZP_05178871.1| riboflavin synthase subunit alpha [Brucella ceti M13/05/1]
          Length = 202

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAEKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|261218870|ref|ZP_05933151.1| riboflavin synthase subunit alpha [Brucella ceti M13/05/1]
 gi|261321631|ref|ZP_05960828.1| riboflavin synthase subunit alpha [Brucella ceti M644/93/1]
 gi|260923959|gb|EEX90527.1| riboflavin synthase subunit alpha [Brucella ceti M13/05/1]
 gi|261294321|gb|EEX97817.1| riboflavin synthase subunit alpha [Brucella ceti M644/93/1]
          Length = 203

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAEKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|114704831|ref|ZP_01437739.1| riboflavin synthase subunit alpha [Fulvimarina pelagi HTCC2506]
 gi|114539616|gb|EAU42736.1| riboflavin synthase subunit alpha [Fulvimarina pelagi HTCC2506]
          Length = 202

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 105/199 (52%), Positives = 138/199 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I++   + KG R RV T+Y+ + + LG SIA +GICLTV   SE     
Sbjct: 1   MFTGIVTDVGRILSSETLPKGRRFRVETTYDCAGIDLGASIACSGICLTVTGFSEAGDTR 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T   +WG GT INLERS+K+GD L GHLVSGH+DG  +I+ ++  G
Sbjct: 61  RWFEVEAWEEALRLTTAGTWGEGTRINLERSLKIGDELGGHLVSGHVDGLADIVAIEEEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL      ++FIA KGSVCL+G SLTVN V    FDVLLIRH++E TTW   +VG
Sbjct: 121 EAVRFRLRAGEGEKRFIAQKGSVCLDGTSLTVNSVQDAEFDVLLIRHSLEVTTWAERRVG 180

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY ARL+ 
Sbjct: 181 DRVNLEVDQIARYAARLFG 199


>gi|62289720|ref|YP_221513.1| riboflavin synthase subunit alpha [Brucella abortus bv. 1 str.
           9-941]
 gi|82699649|ref|YP_414223.1| riboflavin synthase subunit alpha [Brucella melitensis biovar
           Abortus 2308]
 gi|189023969|ref|YP_001934737.1| riboflavin synthase subunit alpha [Brucella abortus S19]
 gi|254689029|ref|ZP_05152283.1| riboflavin synthase subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|254693512|ref|ZP_05155340.1| riboflavin synthase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697164|ref|ZP_05158992.1| riboflavin synthase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730060|ref|ZP_05188638.1| riboflavin synthase subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|256044454|ref|ZP_05447358.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113298|ref|ZP_05454166.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257279|ref|ZP_05462815.1| riboflavin synthase subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|260545527|ref|ZP_05821268.1| lumazine-binding protein [Brucella abortus NCTC 8038]
 gi|260563805|ref|ZP_05834291.1| lumazine-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|297248125|ref|ZP_06931843.1| riboflavin synthase, alpha subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|62195852|gb|AAX74152.1| RibE, riboflavin synthase, alpha subunit [Brucella abortus bv. 1
           str. 9-941]
 gi|82615750|emb|CAJ10746.1| Rhodopsin-like GPCR superfamily:Lumazine-binding protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189019541|gb|ACD72263.1| Lumazine-binding protein [Brucella abortus S19]
 gi|260096934|gb|EEW80809.1| lumazine-binding protein [Brucella abortus NCTC 8038]
 gi|260153821|gb|EEW88913.1| lumazine-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|297175294|gb|EFH34641.1| riboflavin synthase, alpha subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 202

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|17987471|ref|NP_540105.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           16M]
 gi|237815208|ref|ZP_04594206.1| riboflavin synthase, alpha subunit [Brucella abortus str. 2308 A]
 gi|260754524|ref|ZP_05866872.1| riboflavin synthase subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|260757745|ref|ZP_05870093.1| riboflavin synthase subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260761570|ref|ZP_05873913.1| riboflavin synthase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883552|ref|ZP_05895166.1| riboflavin synthase subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|261213772|ref|ZP_05928053.1| riboflavin synthase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|265990875|ref|ZP_06103432.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994711|ref|ZP_06107268.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983167|gb|AAL52369.1| riboflavin synthase alpha chain [Brucella melitensis bv. 1 str.
           16M]
 gi|237790045|gb|EEP64255.1| riboflavin synthase, alpha subunit [Brucella abortus str. 2308 A]
 gi|260668063|gb|EEX55003.1| riboflavin synthase subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260672002|gb|EEX58823.1| riboflavin synthase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674632|gb|EEX61453.1| riboflavin synthase subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|260873080|gb|EEX80149.1| riboflavin synthase subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|260915379|gb|EEX82240.1| riboflavin synthase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|262765824|gb|EEZ11613.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001659|gb|EEZ14234.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 203

 Score =  218 bits (554), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|153009854|ref|YP_001371069.1| riboflavin synthase subunit alpha [Ochrobactrum anthropi ATCC
           49188]
 gi|151561742|gb|ABS15240.1| riboflavin synthase, alpha subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 202

 Score =  218 bits (554), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 106/197 (53%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ +  
Sbjct: 1   MFTGIITDIGKVDRIKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGTNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+ W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISKWQSGRNINLERSLKLGDEMGGHLVSGHVDGQAEIVERKEEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNGNEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|225852284|ref|YP_002732517.1| riboflavin synthase subunit alpha [Brucella melitensis ATCC 23457]
 gi|225640649|gb|ACO00563.1| riboflavin synthase, alpha subunit [Brucella melitensis ATCC 23457]
 gi|326408788|gb|ADZ65853.1| riboflavin synthase subunit alpha [Brucella melitensis M28]
 gi|326538506|gb|ADZ86721.1| riboflavin synthase, alpha subunit [Brucella melitensis M5-90]
          Length = 202

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQTEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|265999514|ref|ZP_05466743.2| lumazine-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|263094455|gb|EEZ18277.1| lumazine-binding protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 203

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQTEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|148559282|ref|YP_001258747.1| riboflavin synthase subunit alpha [Brucella ovis ATCC 25840]
 gi|148370539|gb|ABQ60518.1| riboflavin synthase, alpha subunit [Brucella ovis ATCC 25840]
          Length = 202

 Score =  217 bits (552), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGECKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 181 DKVNIEIDQLARYAARL 197


>gi|239831593|ref|ZP_04679922.1| riboflavin synthase, alpha subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239823860|gb|EEQ95428.1| riboflavin synthase, alpha subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 203

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 106/197 (53%), Positives = 137/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ +  
Sbjct: 2   MFTGIITDIGKVDRIKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGTNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISAWQNGRNINLERSLKLGDEMGGHLVSGHVDGQAEIIDRKEEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVDGNEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D + RY ARL
Sbjct: 182 DKVNIEIDQLARYAARL 198


>gi|34391406|gb|AAM77474.1| riboflavin synthase [Bartonella doshiae]
          Length = 205

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ KG+RL++ T Y+   +++G SIA +GICLTVV    +H   
Sbjct: 1   MFTGIITDIGCVEDVQPLKKGVRLKISTHYDIESLEIGASIACSGICLTVVERGLKHGDT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+A W  GTF+NLERS++LGD L GHLV GHIDG  EI+     G
Sbjct: 61  NWFTVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDELGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FI  KGS+ LNG SLT+N +    FDVL+IRHT+E TTW   +VG
Sbjct: 121 DAVRFHLQAPARLTSFIVNKGSIALNGTSLTINCIEDRIFDVLIIRHTLEMTTWGQARVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           DLIN+E+D + RY+A+L
Sbjct: 181 DLINVEIDQLARYVAKL 197


>gi|163759205|ref|ZP_02166291.1| putative riboflavin synthase [Hoeflea phototrophica DFL-43]
 gi|162283609|gb|EDQ33894.1| putative riboflavin synthase [Hoeflea phototrophica DFL-43]
          Length = 204

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 139/201 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG++ A++P  +G+RLR+ TS++ + + +G SIA +G+CLTV  L E     
Sbjct: 1   MFTGIITDIGRLAAISPRDQGIRLRIETSWDPATIDIGASIACSGVCLTVTGLPEAGETA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +WG GT INLERS+++GD L GH+V+GH+DG  +++ +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGAWGEGTRINLERSLRIGDELGGHMVTGHVDGMADLVSVKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++    L  P  L +FIA KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EARRFTLRAPDGLARFIAPKGSVALDGTSLTVNGVEGADFDVLLIRHSLEVTTWADRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+EVD M RY ARL  ++
Sbjct: 181 DRINLEVDQMARYAARLTEMS 201


>gi|319404316|emb|CBI77909.1| Riboflavin synthase alpha chain [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 205

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 139/205 (67%), Gaps = 2/205 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G I  + P+ +GMRL + T Y+   +++G SIA +GICLT+V  + + +  
Sbjct: 1   MFTGIVTDVGCIEDIQPLKQGMRLNISTHYDVESLEIGASIACSGICLTIVERALKSTDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  HWFIVEAWEEALRLTNLAQWTKGTLINLERSLRLGDEMGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   RL +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E TTW    VG
Sbjct: 121 GATRFRLQVPMQLASFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTTWGQADVG 180

Query: 181 DLINIEVDSMMRYIARL--YALNTS 203
           D +N+EVD + RY+ARL  + +N S
Sbjct: 181 DQVNLEVDQLARYVARLSDFKMNKS 205


>gi|49475528|ref|YP_033569.1| riboflavin synthase subunit alpha [Bartonella henselae str.
           Houston-1]
 gi|6572107|emb|CAB63091.1| riboflavin synthase [Bartonella henselae str. Houston-1]
 gi|49238334|emb|CAF27558.1| Riboflavin synthase alpha chain [Bartonella henselae str.
           Houston-1]
          Length = 206

 Score =  211 bits (537), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 139/198 (70%), Gaps = 1/198 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSV 59
           MFTGIVTDIG +  +  + +GMR  + T Y+   +++G SIA +G+CLT+V R S++ + 
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGMRFNISTRYSIENLEIGASIACSGVCLTIVERGSKQQAK 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            NW+ VE W E  R+TN+  W  GTFINLERS++LGD + GHLVSGHIDG  EI+     
Sbjct: 61  INWFAVEAWEEALRLTNLTQWTKGTFINLERSLRLGDEMGGHLVSGHIDGLAEIIDQKSE 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD++   L +P     FI  KGS+ LNG SLTVN V ++ FDVL+IRHT+E TTW+  K+
Sbjct: 121 GDAVRFFLQVPKRFIPFIVNKGSIALNGTSLTVNCVEEHIFDVLIIRHTLEMTTWRQAKI 180

Query: 180 GDLINIEVDSMMRYIARL 197
           GDL+N+E+D + RY+A+L
Sbjct: 181 GDLVNLEIDQLARYVAKL 198


>gi|90419411|ref|ZP_01227321.1| riboflavin synthase, alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336348|gb|EAS50089.1| riboflavin synthase, alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 205

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 97/204 (47%), Positives = 136/204 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+++    +  G R R+ T Y+ + + LG SIA +G+CLTV  L +    D
Sbjct: 1   MFTGIVTDVGRVVRTERLDAGRRFRIATHYDPAGIALGASIACSGVCLTVTALPQAGDAD 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T   SW   + +NLERS+K+GD + GHLVSGH+DG  EI+ +   G
Sbjct: 61  RWFEVEAWEEALRLTTAGSWEEASALNLERSLKIGDEIGGHLVSGHVDGQAEIVAVTGEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   L  P +L +FIA KGSVCL+G SLTVN V  + FDVLLIRH+++ TTW   K G
Sbjct: 121 EAVRFTLQAPGDLSRFIARKGSVCLDGTSLTVNGVDGDRFDVLLIRHSLDVTTWGARKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + RY  RL+   +++
Sbjct: 181 DRVNLEVDQIARYAERLFGARSAE 204


>gi|319407321|emb|CBI80962.1| Riboflavin synthase alpha chain [Bartonella sp. 1-1C]
          Length = 205

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 138/205 (67%), Gaps = 2/205 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  + P+ +GMRL + T Y+   +++G SIA +GICLT+V  + +    
Sbjct: 1   MFTGIVTDIGCIEDIQPLKQGMRLNISTHYDVESLEIGASIACSGICLTIVERALKPIDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  HWFIVEAWEEALRLTNLAQWTKGTLINLERSLRLGDEMGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   RL +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E TTW    VG
Sbjct: 121 GATRFRLQVPMQLAPFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTTWGHADVG 180

Query: 181 DLINIEVDSMMRYIARL--YALNTS 203
           D +N+EVD + RY+ARL  + +N S
Sbjct: 181 DQVNLEVDQLARYVARLSNFKMNKS 205


>gi|319405759|emb|CBI79382.1| Riboflavin synthase alpha chain [Bartonella sp. AR 15-3]
          Length = 205

 Score =  211 bits (536), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 104/197 (52%), Positives = 135/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLTVV  + + +V 
Sbjct: 1   MFTGIITDIGCVEDIQPLKQGIRLNISTHYDVESLEIGASIACSGICLTVVERTSKPTVA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + VE W ET  +TN+  W  GTFINLERS++LGD + GHLV GHIDG  EIL     G
Sbjct: 61  HCFTVEAWEETLCLTNLTQWTKGTFINLERSLRLGDEVAGHLVFGHIDGLAEILEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L  P  L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DATRFHLQAPMKLAPFIAEKGSIALNGTSLTVNYIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|13476939|ref|NP_108509.1| riboflavin synthase subunit alpha [Mesorhizobium loti MAFF303099]
 gi|14027702|dbj|BAB54295.1| riboflavin synthase alpha chain [Mesorhizobium loti MAFF303099]
          Length = 205

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 136/197 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG + A+ P+++G+ LR+ T+Y+   + +G SI+  G+CLTV  L E  S  
Sbjct: 1   MFTGIVTDIGTVAAVRPLSEGVGLRIDTAYDPETIAIGASISCGGVCLTVTALPEHGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T  +SW  G+ +NLER++K+GD L GH+VSGH+DGT E++     G
Sbjct: 61  RWFEVEAWEEALRLTTASSWKSGSKVNLERALKIGDELGGHIVSGHVDGTAELVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P +L +FIA KGSV L+G SLTVN V    FDVLLI H++  TTW   KVG
Sbjct: 121 DAVRFTLEAPRHLAKFIAPKGSVALDGTSLTVNKVEGTRFDVLLIHHSLTVTTWGERKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE+D+M RY ARL
Sbjct: 181 DRVNIEIDTMARYAARL 197


>gi|169659028|dbj|BAG12723.1| riboflavin synthase [Bartonella grahamii]
 gi|169659030|dbj|BAG12724.1| riboflavin synthase [Bartonella grahamii]
 gi|169659032|dbj|BAG12725.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 136/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVARQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+AL 
Sbjct: 181 DRVNLEIDQLARYAAKLFALK 201


>gi|218514636|ref|ZP_03511476.1| riboflavin synthase subunit alpha [Rhizobium etli 8C-3]
          Length = 203

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 131/190 (68%)

Query: 14  AMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNR 73
           +++P+ +G+RLRV T+Y+ S + +G SI+H+GICLTV  L  E S   W+EVE W E  R
Sbjct: 14  SVSPLKEGIRLRVATAYDPSTIDMGASISHSGICLTVTGLPAEGSNGRWFEVEAWEEALR 73

Query: 74  ITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNL 133
           +T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   GD+   RL  P +L
Sbjct: 74  LTTIGTWQQGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEGDATRYRLRAPEHL 133

Query: 134 EQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRY 193
            +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K GD +N EVD+M RY
Sbjct: 134 AKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAGDFVNFEVDTMARY 193

Query: 194 IARLYALNTS 203
            ARL    ++
Sbjct: 194 AARLAEFPSA 203


>gi|319898991|ref|YP_004159084.1| Riboflavin synthase alpha chain [Bartonella clarridgeiae 73]
 gi|6572095|emb|CAB63088.1| riboflavin synthase alpha chain [Bartonella clarridgeiae]
 gi|125213054|dbj|BAF46401.1| riboflavin synthase [Bartonella clarridgeiae]
 gi|319402955|emb|CBI76506.1| Riboflavin synthase alpha chain [Bartonella clarridgeiae 73]
          Length = 205

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 134/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  + P+ +G+RL + T Y+   +K+G SIA +GICLT+V  + + +  
Sbjct: 1   MFTGIITDIGCIEDIQPLKQGIRLNISTHYDVESLKIGASIACSGICLTIVERALKSTAT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E   +TN+  W  GTF+NLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  HWFAVEAWEEALCLTNLTQWTKGTFVNLERSLRLGDEIGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E T W   +VG
Sbjct: 121 DATRFHLQVPMQLAPFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTIWGQAEVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|169659026|dbj|BAG12722.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 136/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVARQFMPFIFNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+AL 
Sbjct: 181 DRVNLEIDQLARYAAKLFALK 201


>gi|169659014|dbj|BAG12716.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/201 (50%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSREFMPFIVNKGSIALNGTSLTVNGVENCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D + RY A+L+ L 
Sbjct: 181 DRINLEIDQLARYAAKLFTLK 201


>gi|169659018|dbj|BAG12718.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIPFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+ L 
Sbjct: 181 DRVNLEIDQLARYAAKLFTLK 201


>gi|169659012|dbj|BAG12715.1| riboflavin synthase [Bartonella grahamii]
 gi|169659016|dbj|BAG12717.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSREFMPFIVNKGSIALNGTSLTVNGVENCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+ L 
Sbjct: 181 DRVNLEIDQLARYAAKLFTLK 201


>gi|125213039|dbj|BAF46397.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/197 (51%), Positives = 134/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLTVV    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDIDSLEIGASIACSGICLTVVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L LP  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQLPTRLTPFIVNKGSIALNGTSLTVNSVEDRIFDVLIIRHTLQMTTWGQVKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+E+D + RY A+L
Sbjct: 181 DQINLEIDQLARYAAKL 197


>gi|169659024|dbj|BAG12721.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHVDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+ L 
Sbjct: 181 DRVNLEIDQLARYAAKLFTLK 201


>gi|110633490|ref|YP_673698.1| riboflavin synthase subunit alpha [Mesorhizobium sp. BNC1]
 gi|110284474|gb|ABG62533.1| riboflavin synthase, alpha subunit [Chelativorans sp. BNC1]
          Length = 204

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 102/197 (51%), Positives = 135/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G I  + P+ KG+RLR+ T+Y+   + +G SIA AG+CLTVV L E  S  
Sbjct: 1   MFTGIVTDVGAIQRIVPLPKGLRLRIGTNYDPQSIDIGASIACAGVCLTVVALPEGGSNQ 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W EVE W E  ++T ++ W  GT INLER++K+GD L GH+VSGH+DGT  I+     G
Sbjct: 61  RWCEVEAWDEALQLTTVSEWHDGTRINLERALKIGDELGGHIVSGHVDGTATIVERREEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   L  P  L +FIA KGSV L+G SLTVN V  N F+VLLI H+++ TTW   +VG
Sbjct: 121 EAVRFVLEAPRELAKFIAPKGSVALDGTSLTVNRVDGNRFNVLLIHHSLDVTTWGERQVG 180

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD+M RY ARL
Sbjct: 181 QKVNLEVDTMARYAARL 197


>gi|262072916|dbj|BAI47766.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  207 bits (526), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 136/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVKQATA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVVRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY+A+L+AL 
Sbjct: 181 DWVNLEIDQLARYVAKLFALK 201


>gi|169659036|dbj|BAG12727.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  207 bits (526), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 135/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVQQAAA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R++N+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLSNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVARQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+AL 
Sbjct: 181 DRVNLEIDQLARYAAKLFALK 201


>gi|262072892|dbj|BAI47755.1| riboflavin synthase [Bartonella sp. Okinawa 19-1]
          Length = 205

 Score =  207 bits (526), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 135/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+R ++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGVRFKISTRYAAESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEEALRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V ++ FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVPKGSVALNGTSLTVNGVEESVFDVLIIRHTLEMTTWGHAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+N+E+D + RY A+L++L 
Sbjct: 181 DLVNLEIDQLARYAAKLFSLK 201


>gi|169659020|dbj|BAG12719.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLSQWTTGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIPFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L  L 
Sbjct: 181 DQVNLEIDQLSRYAAKLLTLK 201


>gi|257153185|dbj|BAI23147.1| riboflavin synthase [Bartonella washoensis]
 gi|257153187|dbj|BAI23148.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVENVQSLNQGVHLNISTRYDIESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPRQLTPFIVNKGSIALNGTSLTVNSVEDRIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+E+D + RY A+L
Sbjct: 181 DQINLEIDQLARYAAKL 197


>gi|262072899|dbj|BAI47758.1| riboflavin synthase [Bartonella sp. Shimane 84-1]
          Length = 206

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+R +V T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGVRFKVSTRYAVESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEEALRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V ++ FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKISRQFMPFIVPKGSVALNGTSLTVNGVEESVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L++L 
Sbjct: 181 DWVNLEIDQLARYAAKLFSLK 201


>gi|240850689|ref|YP_002972089.1| riboflavin synthase subunit alpha [Bartonella grahamii as4aup]
 gi|169659034|dbj|BAG12726.1| riboflavin synthase [Bartonella grahamii]
 gi|240267812|gb|ACS51400.1| riboflavin synthase subunit alpha [Bartonella grahamii as4aup]
          Length = 205

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 135/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVKQATA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVVRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+AL 
Sbjct: 181 DWVNLEIDQLARYAAKLFALK 201


>gi|257153167|dbj|BAI23138.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 134/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLTPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|257153169|dbj|BAI23139.1| riboflavin synthase [Bartonella washoensis]
 gi|257153173|dbj|BAI23141.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCIEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRFMPFIINKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGRAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|257153171|dbj|BAI23140.1| riboflavin synthase [Bartonella washoensis]
          Length = 206

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCIEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRFMPFIINKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGRAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|169659022|dbj|BAG12720.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+RL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQSLKKGVRLKISTRYAIESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWTTGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN +    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVNKGSIALNGTSLTVNGIEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           +LIN+E+D + RY A+L  L 
Sbjct: 181 NLINLEIDQLARYAAKLLTLK 201


>gi|34391420|gb|AAM77481.1| riboflavin synthase [Bartonella koehlerae]
          Length = 206

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 1/198 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSV 59
           MFTGIVTDIG +  +  + +GMR  + T Y    +++G SIA +GICLT+V R  ++ + 
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGMRFIISTRYGIEDLEIGASIACSGICLTIVERGLKQQTK 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            NW+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     
Sbjct: 61  TNWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKME 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD++   L +  +   FIA KGS+ LNG SLTVN V  + FDVL+IRHT+E TTW   ++
Sbjct: 121 GDAVRFFLQVSKHFMPFIANKGSIALNGTSLTVNCVEDHIFDVLIIRHTLEMTTWGQAEI 180

Query: 180 GDLINIEVDSMMRYIARL 197
           GDL+N+E+D   RY ARL
Sbjct: 181 GDLVNLEIDQFARYAARL 198


>gi|257153163|dbj|BAI23136.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  204 bits (519), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 134/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDIQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|49474162|ref|YP_032204.1| riboflavin synthase subunit alpha [Bartonella quintana str.
           Toulouse]
 gi|6572111|emb|CAB63094.1| riboflavin synthase alpha chain [Bartonella quintana]
 gi|49239666|emb|CAF26037.1| Riboflavin synthase alpha chain [Bartonella quintana str. Toulouse]
          Length = 206

 Score =  204 bits (519), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 134/202 (66%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSV 59
           MFTGIVTDIG +  +  + +G+R  + T Y+   +++G SIA +GICLT+V R S++ + 
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGVRFNISTHYDMESLEIGASIACSGICLTIVERGSKQKAK 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            NW+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     
Sbjct: 61  TNWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKE 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW    +
Sbjct: 121 GDAVRFFLQVPTKFTPFIVNKGSIALNGTSLTVNCVKDRIFDVLIIRHTLEMTTWGQANI 180

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +N+E+D + RY A+L    
Sbjct: 181 GDRVNLEIDQLARYAAKLSGFK 202


>gi|257153157|dbj|BAI23133.1| riboflavin synthase [Bartonella washoensis]
 gi|257153161|dbj|BAI23135.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 134/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|257153165|dbj|BAI23137.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 135/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V+   + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVKRGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDCIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|262072908|dbj|BAI47762.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  204 bits (518), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+  W  GTF+NLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLVQWIKGTFVNLERSLRLGDEMGGHLVFGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+ L 
Sbjct: 181 DRVNLEIDQLARYAAKLFTLK 201


>gi|163868465|ref|YP_001609674.1| riboflavin synthase subunit alpha [Bartonella tribocorum CIP
           105476]
 gi|125213043|dbj|BAF46398.1| riboflavin synthase [Bartonella tribocorum]
 gi|161018121|emb|CAK01679.1| Riboflavin synthase alpha chain [Bartonella tribocorum CIP 105476]
          Length = 205

 Score =  204 bits (518), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGIRLKISTRYAVESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+A W  GTFINLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFIVEAWEEALRLTNLAQWKKGTFINLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVPKGSVALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGHAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+A  
Sbjct: 181 DWVNLEIDQLARYAAKLFAFK 201


>gi|133778399|dbj|BAF49204.1| riboflavin synthase [Bartonella rattimassiliensis]
          Length = 205

 Score =  204 bits (518), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDIQSLKQGVRLKISTRYAIESLAIGASIACSGICLTIVERGLKQKNS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFIVEAWEETLRLTNLVQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN+V    FDVL+IRHT+E TTW+  K+G
Sbjct: 121 DAIRFYLKVSRQFIPFIVNKGSLALNGTSLTVNVVEDCIFDVLIIRHTLEMTTWRQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+N+E+D   RY A+L  L 
Sbjct: 181 DLVNLEIDQFARYSAKLLTLK 201


>gi|310697237|gb|ADP06548.1| RibC [Bartonella sp. E3-106]
 gi|310697239|gb|ADP06549.1| RibC [Bartonella sp. Ew-111]
          Length = 187

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/187 (50%), Positives = 127/187 (67%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G + A  P+ KG+RL + T YN   +++G SIA +G+CLT+V L  E +  NW+ VE W 
Sbjct: 1   GCVEAAKPLNKGVRLNISTCYNADSLRVGASIACSGVCLTIVELGSEKTARNWFSVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           ET R+TN+A W  GTF+NLERS++ GD + GHLVSGHIDG  +I+     GD++   +  
Sbjct: 61  ETLRLTNLAQWMKGTFVNLERSLRFGDEVGGHLVSGHIDGLAKIVDKSNEGDAVRFYMQA 120

Query: 130 PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDS 189
           P  L  FI  KGS+ LNGVSLTVN V  N FDVL+IRHT+E TTW    +GD +N+E+D 
Sbjct: 121 PTRLLPFITRKGSIALNGVSLTVNCVEDNIFDVLIIRHTLEMTTWGQANIGDQVNLEIDQ 180

Query: 190 MMRYIAR 196
           + RY+AR
Sbjct: 181 LARYVAR 187


>gi|319784161|ref|YP_004143637.1| riboflavin synthase subunit alpha [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170049|gb|ADV13587.1| riboflavin synthase, alpha subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 205

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + ++ P+ +G+ LR+ T+Y+   + +G SI+  G+CLTV  L +  S  
Sbjct: 1   MFTGIVTDVGTVASVKPLREGVGLRIDTAYDPQTIAIGASISCGGVCLTVTALPDSVSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T  + W  GT +NLER++K+GD L GH+VSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTASGWKSGTKVNLERALKIGDELGGHIVSGHVDGMAEIIERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P +L +FIA KGSV L+G SLTVN V    FDVLLI H++  TTW   KVG
Sbjct: 121 DAVRFTLEAPRDLAKFIAPKGSVALDGTSLTVNKVEGARFDVLLIHHSLTVTTWGERKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D+M RY ARL
Sbjct: 181 DRVNLEIDTMARYAARL 197


>gi|218678529|ref|ZP_03526426.1| riboflavin synthase subunit alpha [Rhizobium etli CIAT 894]
          Length = 193

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/182 (53%), Positives = 128/182 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV T+Y+ S + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDIGTIESVSALKEGIKLRVATAYDPSTIDMGASISHSGICLTVTGLPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWQQGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DL 182
           D 
Sbjct: 181 DF 182


>gi|34391418|gb|AAM77480.1| riboflavin synthase [Bartonella elizabethae]
          Length = 205

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +GMR+++ T Y    + +G SIA +GICLTVV    +    
Sbjct: 1   MFTGIITDIGCVEDVQFLKQGMRVKISTRYAIESLAIGASIACSGICLTVVERGFKQEDF 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVSKGSVALNGTSLTVNSVEDCVFDVLIIRHTLEVTTWGEAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L++  
Sbjct: 181 DWVNLEIDQLARYAAKLFSFK 201


>gi|34391412|gb|AAM77477.1| riboflavin synthase [Bartonella alsatica]
          Length = 205

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI++DIG +  +  + +G+RL++ T Y+   +K+G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIISDIGCVEDVQSLKQGLRLKISTCYDIESLKIGTSIACSGICLTIVERGSKQAKT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFXVEAWEETLRLTNLMQWTKGTFVNLERSLRLGDEVGGHLVSGHIDGLAEIIDKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN +    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFFLQVPKQFTPFIVNKGSLALNGTSLTVNCIEDCIFDVLIIRHTLEVTTWGQTKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY  +     
Sbjct: 181 DKVNLEIDQLARYAVKFSGFK 201


>gi|257153179|dbj|BAI23144.1| riboflavin synthase [Bartonella washoensis]
 gi|257153181|dbj|BAI23145.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 132/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVENVQSLNQGVHLNISTCYDIESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEEALRLTNLTQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLT+N V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTINSVEDRIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|310697235|gb|ADP06547.1| RibC [Bartonella sp. E2-114]
          Length = 187

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 131/187 (70%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ KG+RL + T Y+   +++G SIA +GICLTVV L+ ++SV+NW+ VE W 
Sbjct: 1   GCVEDIEPLQKGVRLNISTHYDMDSLEIGTSIACSGICLTVVGLAPQNSVNNWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           ET R+TN+A W  GTF+NLERS++ G  + GHLVSGHIDG  EI+     GD++   L +
Sbjct: 61  ETLRLTNLAHWKKGTFVNLERSLRFGAEMGGHLVSGHIDGLAEIIDEKSEGDAVRFFLQV 120

Query: 130 PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDS 189
           P  +  FI  KGSV LNG SLTVN V  + FDVL+IRHT+E TTW   KVGD +N+E+D 
Sbjct: 121 PTRITPFIVNKGSVALNGTSLTVNCVESDVFDVLIIRHTLEVTTWGQAKVGDQVNLEIDQ 180

Query: 190 MMRYIAR 196
           + RY+AR
Sbjct: 181 LARYVAR 187


>gi|190569842|dbj|BAG48883.1| riboflavin synthase [Bartonella japonica]
          Length = 201

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 131/200 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y    +++G SIA +GICLT+V         
Sbjct: 1   MFTGIITDIGCVEEVMSLEQGVRLNISTFYAIESLEIGASIACSGICLTIVERGIHQENR 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GTFINLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTFINLERSLRLGDEMGGHLVSGHVDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQIPTQFVPFIVNKGSVALNGTSLTVNSVENCIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+E+D + RY A+  AL
Sbjct: 181 DQVNLEIDQLARYAAKFLAL 200


>gi|34391416|gb|AAM77479.1| riboflavin synthase [Bartonella birtlesii]
 gi|124358780|dbj|BAF46059.1| riboflavin synthase [Bartonella capreoli]
          Length = 205

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 132/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTV+    +    
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIERELKQVNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W E   +TNIA W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  NCFVVEAWKEALCLTNIAQWTKGTFVNLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKASMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|257153159|dbj|BAI23134.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  201 bits (511), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFT I+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTEIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|124358782|dbj|BAF46060.1| riboflavin synthase [Bartonella chomelii]
          Length = 205

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTV+    + +  
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIEHELKQANV 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W E   +TNIA W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  NCFVVEAWKEALCLTNIAQWTKGTFVNLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKASMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|257153175|dbj|BAI23142.1| riboflavin synthase [Bartonella washoensis]
          Length = 206

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 132/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGVRLDISTRYDIESLEIGASIACSGICLTIVERGLKQATT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++ G+ + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRFGNEMGGHLVSGHIDGLAEIIDKRNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNGVSLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPKQFVPFIVNKGSIALNGVSLTVNCVENYIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|34391408|gb|AAM77475.1| riboflavin synthase [Bartonella schoenbuchensis]
 gi|319408449|emb|CBI82104.1| Riboflavin synthase alpha chain [Bartonella schoenbuchensis R1]
          Length = 205

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/197 (50%), Positives = 132/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTV+    + +  
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIERELKQANA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W E   +TNIA W  GTF+NLERS++LGD + GHLV GH+DG  EI+     G
Sbjct: 61  NCFVVEAWKEALCLTNIAQWTKGTFVNLERSLRLGDEIGGHLVFGHVDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKASMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|34391414|gb|AAM77478.1| riboflavin synthase [Bartonella vinsonii subsp. arupensis]
          Length = 205

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+RL + T Y+ + +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEEVQSLKKGVRLNISTRYDMASLEIGSSIACSGICLTIVERGSKQENM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAKWTKGTCINLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P   + FI  KGS+ LNG SLTVN +    FD+L+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLKVPMRFKPFIVSKGSIALNGTSLTVNCIEDCIFDILVIRHTLKMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|257153189|dbj|BAI23149.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/204 (46%), Positives = 132/204 (64%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L++ T Y+   +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDIQSLNQGVHLKISTRYDIESLEIGASIACSGICLTIVERGLKQVTA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GH VSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHFVSGHIDGLAEIIDKRNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNGVSLTVN V    FD+L+IRHT+E TTW   K+G
Sbjct: 121 DAIRFFLQVPKEFVPFIVNKGSIALNGVSLTVNCVEDCIFDILIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E+D + RY A+L      +
Sbjct: 181 DQVNLEIDQLARYAAKLSGFKMKE 204


>gi|34391426|gb|AAM77484.1| riboflavin synthase [Bartonella bovis]
          Length = 205

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/197 (50%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTVV    + +  
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVVERELKQTNI 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W ET  +TN+A W  GTF+NLERS++LGD + GHLVSGH+D   EI+     G
Sbjct: 61  NCFVVEAWKETLYLTNLAKWTKGTFVNLERSLRLGDEIGGHLVSGHVDDLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLT+N +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKTSMRLAPFIAEKGSIALNGTSLTINSIEDNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|257153177|dbj|BAI23143.1| riboflavin synthase [Bartonella washoensis]
          Length = 206

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 132/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGVRLDISTRYDIESLEIGASIACSGICLTIVERGLKQATT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++ G+ + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFVVEAWEEALRLTNLAQWTKGTFVNLERSLRFGNEMGGHLVSGHIDGLAEIIDKRNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNGVSLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPKQFVPFIVNKGSIALNGVSLTVNCVENYIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|34391422|gb|AAM77482.1| riboflavin synthase [Bartonella taylorii]
          Length = 205

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 128/201 (63%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y    ++LG SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLNITTRYAIESLELGASIACSGICLTIVERGSKQADT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLER ++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTSINLERPLRLGDEVGGHLVFGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAVRFFLQIPTRFTSFIVNKGSIALNGTSLTVNCVEDCIFDVLIIRHTLEMTTWGQAQIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D   RY A+     
Sbjct: 181 DQVNLEIDQFARYAAKFSGFK 201


>gi|110618421|gb|ABG78838.1| riboflavin synthase [Bartonella washoensis subsp. cynomysii]
          Length = 195

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 132/195 (67%)

Query: 6   VTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEV 65
           +TDIG +  +  + KG+ L + T Y+   +++G SIA +G+CLT+V    + +  +W+ V
Sbjct: 1   LTDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGVCLTIVERGSKQANTHWFAV 60

Query: 66  EVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYC 125
           E W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++  
Sbjct: 61  EAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEGDAVRF 120

Query: 126 RLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINI 185
            L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW+  K+GD +N+
Sbjct: 121 FLQVPTRLTPFIVNKGSIALNGTSLTVNCVEGRIFDVLIIRHTLQMTTWRQAKIGDQVNL 180

Query: 186 EVDSMMRYIARLYAL 200
           E+D + RY+ARL + 
Sbjct: 181 EIDQLARYVARLSSF 195


>gi|34391424|gb|AAM77483.1| riboflavin synthase [Bartonella vinsonii subsp. vinsonii]
          Length = 205

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 129/201 (64%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  +  + KG+R  V T Y    +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCIEDIQSLKKGVRFNVSTRYAVESLEIGSSIACSGICLTIVGRGSKQANM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLVSGHIDG  E +     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTCINLERSLRLGDEMGGHLVSGHIDGLAETIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FD+L+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTQFTPFIVNKGSIALNGTSLTVNCVEGCIFDILIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY+A+     
Sbjct: 181 DQVNLEIDPLARYVAKFSGFK 201


>gi|34391410|gb|AAM77476.1| riboflavin synthase [Bartonella vinsonii subsp. berkhoffii]
          Length = 205

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 128/201 (63%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+R  + T Y    +++G SIA +GICLT+V    + S  
Sbjct: 1   MFTGIITDIGCVEDIQSLKKGVRFNISTRYAVESLEIGSSIACSGICLTIVERGSKQSNM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLVSGHID   EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTCINLERSLRLGDEMGGHLVSGHIDSLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN +    FD+L+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTRFTPFIVSKGSIALNGTSLTVNCIEDCIFDILIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D   RY+A+     
Sbjct: 181 DQVNLEIDPFARYVAKFSGFK 201


>gi|110618425|gb|ABG78840.1| riboflavin synthase [Bartonella sp. CL6418co]
          Length = 195

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 131/195 (67%)

Query: 6   VTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEV 65
           +TDIG +  +  + KG+ L + T Y+   +++G SIA +G+CLT+V    + +  NW+ V
Sbjct: 1   LTDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGVCLTIVERGSKQANINWFAV 60

Query: 66  EVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYC 125
           E W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++  
Sbjct: 61  EAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEGDAVRF 120

Query: 126 RLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINI 185
            L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+GD +N+
Sbjct: 121 FLQVPTRLTPFIVNKGSIALNGTSLTVNCVEGRIFDVLIIRHTLQMTTWGEAKIGDQVNL 180

Query: 186 EVDSMMRYIARLYAL 200
           E+D + RY+ARL + 
Sbjct: 181 EIDQLARYVARLSSF 195


>gi|110618423|gb|ABG78839.1| riboflavin synthase [Bartonella sp. CL6416co]
          Length = 196

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 131/194 (67%)

Query: 6   VTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEV 65
           +TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  +W+ V
Sbjct: 1   LTDIGCVEDVQSLNKGVHLNISTRYDMKSLEIGASIACSGICLTIVERGSKQANTHWFAV 60

Query: 66  EVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYC 125
           E W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++  
Sbjct: 61  EAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEGDAVRF 120

Query: 126 RLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINI 185
            L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+GD +N+
Sbjct: 121 FLQVPTRLTPFIVNKGSIALNGTSLTVNCVEDCIFDVLIIRHTLQMTTWGQAKIGDQVNL 180

Query: 186 EVDSMMRYIARLYA 199
           E+D + RY+ARL +
Sbjct: 181 EIDQLARYVARLSS 194


>gi|190569849|dbj|BAG48886.1| riboflavin synthase [Bartonella silvatica]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 128/200 (64%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y    +++G SIA +GICLTVV    +    
Sbjct: 1   MFTGIITDIGCVEEVQSLKQGVRLNISTRYAVQSLEIGASIACSGICLTVVERGSKQMNM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN++ W  GT+INLERS+K GD + GH VSGH+DG  EI+     G
Sbjct: 61  SWFVVEAWEEALRLTNLSQWTKGTYINLERSLKFGDEVGGHFVSGHVDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPKRFASFIVNKGSIALNGTSLTVNNVDDCIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+E+D   RY A+   +
Sbjct: 181 DCVNLEIDQFARYAAKFSGI 200


>gi|260466842|ref|ZP_05813026.1| riboflavin synthase, alpha subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259029344|gb|EEW30636.1| riboflavin synthase, alpha subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 246

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 130/190 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + A+  +++G+ LR+ T+Y+ + + +G SI+  G+CLTV  L +  S  
Sbjct: 42  MFTGIVTDVGTVAAIKSLSEGVGLRIDTAYDPTTIAIGASISCGGVCLTVTALPDHGSNA 101

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T  + W  GT +NLER++K+GD L GH+VSGH+DGT EI+     G
Sbjct: 102 RWFEVEAWEEALRLTTASGWKSGTKVNLERALKIGDELGGHIVSGHVDGTAEIVERKDEG 161

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P +LE+FIA KGSV L+G SLTVN V    FDVLLI H++  TTW   K G
Sbjct: 162 DAVRFTLEAPRHLEKFIAPKGSVALDGTSLTVNKVEGTRFDVLLIHHSLTVTTWGERKAG 221

Query: 181 DLINIEVDSM 190
           D +N+E+D+M
Sbjct: 222 DRVNLEIDTM 231


>gi|304391941|ref|ZP_07373883.1| riboflavin synthase, alpha subunit [Ahrensia sp. R2A130]
 gi|303296170|gb|EFL90528.1| riboflavin synthase, alpha subunit [Ahrensia sp. R2A130]
          Length = 200

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 129/197 (65%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I ++  + +G R  V T+Y+   + +G SIAHAG+CLTVV   +     
Sbjct: 1   MFTGIITDIGTIESVEQLPQGRRFTVATAYDVDGIDIGASIAHAGVCLTVVEKGQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+VE W E  R+T  A W +GT +NLER++K+GD L GH+V+GH+DG   ++ +   G
Sbjct: 56  GTYQVEAWEEALRLTTAADWTMGTRLNLERALKVGDELGGHIVAGHVDGMANVVSVKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L  P NL +FIA KGSV L+G SLTVN +    FDVLLI H++  TTW   K G
Sbjct: 116 DATRFTLEAPENLARFIAEKGSVALDGTSLTVNGIDGVRFDVLLITHSLSVTTWGYMKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D+M RY ARL
Sbjct: 176 DRVNLEIDTMARYAARL 192


>gi|257153183|dbj|BAI23146.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 129/197 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFT I+TDI  +  +  + +G+ L + T Y+   +++G SIA + ICLT+V    + +  
Sbjct: 1   MFTEIITDISCVENVQSLNQGVHLNISTCYDIESLEIGASIACSRICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEEALRLTNLTQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLT+N V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTINSVEDRIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY A+L
Sbjct: 181 DQVNLEIDQLARYAAKL 197


>gi|37725761|gb|AAO32828.1| riboflavin synthase alpha chain [Bartonella grahamii]
          Length = 205

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 130/201 (64%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFT  + +IG +  + P+ +G+RL   T Y+   +++G SIA + ICLT+V    + +  
Sbjct: 1   MFTRTIMNIGYVDDVQPLKQGVRLNFSTRYDIQSLEIGASIACSWICLTIVERGVKQATA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVVRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L+AL 
Sbjct: 181 DWVNLEIDQLARYAAKLFALK 201


>gi|84687682|ref|ZP_01015555.1| riboflavin synthase subunit alpha [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664265|gb|EAQ10756.1| riboflavin synthase subunit alpha [Rhodobacterales bacterium
           HTCC2654]
          Length = 196

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG+I  +T   + +R R+ T+Y+TS+++LG SIA  G+CLTV RL       
Sbjct: 1   MFTGIITDIGRIAEVTR-TEDLRARIATAYDTSRIELGASIASDGVCLTVTRLGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV V  ET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E+  +   G
Sbjct: 55  DWYEVFVSGETLTKTNLGGWEVGRRVNLERALKVGDELGGHIVSGHVDGVAEVTDVHDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS      +P +L +FIA KGSV LNG SLTVN V  + F V LI HT E TTW   +VG
Sbjct: 115 DSTRISFKVPGDLARFIAPKGSVALNGTSLTVNEVEGDTFGVNLITHTKEVTTWGDVRVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DKVNLEIDTLARYVARL 191


>gi|118587986|ref|ZP_01545396.1| riboflavin synthase subunit alpha [Stappia aggregata IAM 12614]
 gi|118439608|gb|EAV46239.1| riboflavin synthase subunit alpha [Stappia aggregata IAM 12614]
          Length = 203

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I+A+  I  GMR R+ T+Y+T    +G SI+ AG+C TV    +  S  
Sbjct: 1   MFTGIVTDLGEILAIDKIPAGMRTRIRTAYDTESFDIGASISCAGVCHTVT-AKDNGSNG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EVE  AET  +TN+A+W +G  +NLERS+ +G  L GHLV GH+DG   +   +   
Sbjct: 60  NWFEVESAAETLALTNVAAWKVGQKLNLERSLTMGAELGGHLVLGHVDGLATVTKREDHP 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+Y +   P     FIA KGSV L+G SLTVN V    F V LI HT+E TTW   +VG
Sbjct: 120 DSVYFQFEAPAEAAPFIAKKGSVALDGTSLTVNEVDGLLFSVFLIPHTLEVTTWSDRQVG 179

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+EVD M RY ARL
Sbjct: 180 DKINLEVDMMARYAARL 196


>gi|126738751|ref|ZP_01754447.1| riboflavin synthase subunit alpha [Roseobacter sp. SK209-2-6]
 gi|126719932|gb|EBA16639.1| riboflavin synthase subunit alpha [Roseobacter sp. SK209-2-6]
          Length = 195

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 130/198 (65%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ TSY+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIVTDIGTITHLEQQGD-LRARIKTSYDTSGIDMGASIASDGVCLTVVELGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TNI +W  G  +NLER++K+GD L GH+VSGH+DG  E++ L+  G
Sbjct: 55  DWYDVQISAETVSKTNIGAWEAGKRVNLERALKVGDELGGHIVSGHVDGVAEVVKLEDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   K+G
Sbjct: 115 DSTRVTLRAPEELARFIASKGSVALNGTSLTVNDVAGCDFGINFIPHTKEVTTWGDVKLG 174

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E+D++ RY+ARL+
Sbjct: 175 DQVNLEIDTLARYVARLH 192


>gi|86137882|ref|ZP_01056458.1| riboflavin synthase subunit alpha [Roseobacter sp. MED193]
 gi|85825474|gb|EAQ45673.1| riboflavin synthase subunit alpha [Roseobacter sp. MED193]
          Length = 195

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 130/198 (65%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ T+Y TS + LG SIA  G+CLTV+ L +     
Sbjct: 1   MFTGIVTDIGTIAQLDQQGD-LRARIATNYETSGIDLGASIASDGVCLTVIELGK----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+ +W IG  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWYDVQISAETVSKTNVGAWKIGKRVNLERALKVGDELGGHIVSGHVDGVAEVVELQDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   K+G
Sbjct: 115 DSTRVTLRAPKELARFIAPKGSVALNGTSLTVNDVQGCDFGINFIPHTKEVTTWGDVKLG 174

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E+D++ RY+ARL+
Sbjct: 175 DQVNLEIDTLARYVARLH 192


>gi|260434092|ref|ZP_05788063.1| riboflavin synthase, alpha subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417920|gb|EEX11179.1| riboflavin synthase, alpha subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 195

 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 131/200 (65%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG II +      +R R+ T Y+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGTIIELEQQGD-LRARIKTGYDTAGIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVQISAETVSKTNLDGWQVGKRVNLERALKVGDELGGHIVSGHVDGVAEVIAVADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   KVG
Sbjct: 115 DSTRVTLRAPRDLARFIAPKGSVALNGTSLTVNDVDGCDFGINFIPHTKENTTWGDVKVG 174

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+E+D++ RY+ARL  +
Sbjct: 175 DRVNLEIDTLARYVARLSEM 194


>gi|310697233|gb|ADP06546.1| RibC [Bartonella sp. E1-105]
          Length = 187

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 124/187 (66%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  +  + +G+RL + T Y+   +++G SIA +GICLT+V  + + S + W+ VE W 
Sbjct: 1   GCVEEVKSLKQGVRLNISTHYDIESLEIGASIACSGICLTIVERAPKESANTWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GTFINLERS++ G  + GHLVSGHIDG  E++     GD++   L +
Sbjct: 61  EALRLTNLAQWTTGTFINLERSLRFGAEVGGHLVSGHIDGLAEVIEKKSEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDS 189
           P     FI  KGS+ LNG SLT+N V  N FDVL+IRHT++ TTW   K+GD +N+E+D 
Sbjct: 121 PTRFTPFIVNKGSIALNGTSLTINCVKDNIFDVLIIRHTLDMTTWGQAKIGDQVNLEIDQ 180

Query: 190 MMRYIAR 196
           + RY+AR
Sbjct: 181 LARYVAR 187


>gi|83955705|ref|ZP_00964285.1| riboflavin synthase subunit alpha [Sulfitobacter sp. NAS-14.1]
 gi|83839999|gb|EAP79175.1| riboflavin synthase subunit alpha [Sulfitobacter sp. NAS-14.1]
          Length = 195

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 131/201 (65%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGKI  +      +R R+ T Y+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDIGKITKLEQQGD-LRARIETGYDTSGIDMGASIASDGVCLTVVDLGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV++ AET   TN+ +W +G  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWYEVQISAETVDKTNLGAWEVGRRLNLERALKVGDELGGHIVSGHVDGVAEVVALRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    +G
Sbjct: 115 DSTRVTLRAPEDLARFIAPKGSVALNGTSLTVNEVDGCDFGINFIPHTKEVTTWGDVAIG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D++ RY+ARL  ++
Sbjct: 175 DRINLEIDTLARYVARLAEMS 195


>gi|133778401|dbj|BAF49205.1| riboflavin synthase [Bartonella phoceensis]
          Length = 205

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 126/197 (63%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L + T Y    +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGLCLNISTRYAVESLEIGASIACSGICLTIVERGLKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT++NLERS+KLGD L GH V GH+DG  EI+     G
Sbjct: 61  SWFVVEAWEEALRLTNLAQWKKGTYVNLERSLKLGDELGGHFVFGHVDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN +    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAVRFFLKVPTQFTPFIVNKGSIALNGTSLTVNSIEDYIFDVLIIRHTLEMTTWGQAQIG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D   RY  + 
Sbjct: 181 DQVNLEIDQFARYAVKF 197


>gi|254476472|ref|ZP_05089858.1| riboflavin synthase, alpha subunit [Ruegeria sp. R11]
 gi|214030715|gb|EEB71550.1| riboflavin synthase, alpha subunit [Ruegeria sp. R11]
          Length = 195

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 131/198 (66%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ TSY+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGTIAELEQQGD-LRARIKTSYDTAGIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+ SW +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVQISAETVSKTNLDSWVVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVNIADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   K+G
Sbjct: 115 DSTRVTLRAPAALAKFIAPKGSVALNGTSLTVNDVEGADFGINFIPHTKEVTTWGDVKLG 174

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E+D++ RY+ARL+
Sbjct: 175 DAVNLEIDTLARYVARLH 192


>gi|114771640|ref|ZP_01449044.1| riboflavin synthase subunit alpha [alpha proteobacterium HTCC2255]
 gi|114547712|gb|EAU50602.1| riboflavin synthase subunit alpha [alpha proteobacterium HTCC2255]
          Length = 206

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 137/211 (64%), Gaps = 12/211 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV---RLSEEH 57
           MFTGI+TDIG I  +   A  ++ R+ TSY+   + +G SIA  G+CLTV+   R+ E+ 
Sbjct: 1   MFTGIITDIGTIAELKQ-AGDLKARINTSYDVDNIDIGASIACNGVCLTVITKGRIEEQ- 58

Query: 58  SVDNWYEVEVWAETNRITNIAS----WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
              NW++VE+ AE+  ITNI+S    W IG  +NLER++K+GD L GH+VSGH+DG   I
Sbjct: 59  ---NWFDVEISAESISITNISSGRKAWSIGQSVNLERALKMGDELGGHIVSGHVDGVAVI 115

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
             +   GDS      +P++L  FIA KGSV L+G SLTVN V  N F V LI HT + TT
Sbjct: 116 TDIKTSGDSTVVNFQIPNDLSHFIAQKGSVTLDGTSLTVNDVSANTFKVNLISHTKDNTT 175

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           W   +VGD IN+E+D++ RY+ARL  +  S+
Sbjct: 176 WNDIEVGDQINLEIDTLARYVARLADVRNSK 206


>gi|56696636|ref|YP_166997.1| riboflavin synthase subunit alpha [Ruegeria pomeroyi DSS-3]
 gi|56678373|gb|AAV95039.1| riboflavin synthase, alpha subunit [Ruegeria pomeroyi DSS-3]
          Length = 195

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG ++ +      +R R+ T Y+TS + +G SIA  G+CLTV+ L       
Sbjct: 1   MFTGIVTDIGTVVELEQRGD-LRARIRTGYDTSGIDIGASIASDGVCLTVIALGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+VE+ AET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVEISAETVSKTNLGGWSVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVAMADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPADLARFIAPKGSVALNGTSLTVNAVEGAEFGINFIPHTKEATTWGGVAVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY+ARL
Sbjct: 175 DRVNLEIDMLARYVARL 191


>gi|254488941|ref|ZP_05102146.1| riboflavin synthase, alpha subunit [Roseobacter sp. GAI101]
 gi|214045810|gb|EEB86448.1| riboflavin synthase, alpha subunit [Roseobacter sp. GAI101]
          Length = 195

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/201 (47%), Positives = 130/201 (64%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+GKI ++      +R R+ T Y+T ++ +G SIA  G+CLTVV +       
Sbjct: 1   MFTGIITDVGKIASLAQEGD-LRARITTGYDTDRIDMGASIASDGVCLTVVDMGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV++ AET   TN+  W  G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYEVQISAETVEKTNLGGWVPGKRLNLERALKVGDELGGHIVSGHVDGVAEVVAMRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPQALARFIAPKGSVALNGTSLTVNEVDGCDFGINFIPHTKEVTTWGDVAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DLIN+E+D++ RY+ARL  ++
Sbjct: 175 DLINLEIDTLARYVARLAEMS 195


>gi|84515385|ref|ZP_01002747.1| riboflavin synthase subunit alpha [Loktanella vestfoldensis SKA53]
 gi|84510668|gb|EAQ07123.1| riboflavin synthase subunit alpha [Loktanella vestfoldensis SKA53]
          Length = 198

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/197 (47%), Positives = 129/197 (65%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+++A+      +R R+ T Y+ + + +G SIA  G+CLTV+ L  +    
Sbjct: 1   MFTGIVTDIGRVLALDQQGD-LRARIGTGYDVAGIDIGASIACNGVCLTVIALGRDPQ-- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW++V++ AET   TN++ W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 58  NWFDVQISAETVGATNVSGWTVGKRLNLERALKVGDELGGHIVSGHVDGVAEVVAMRDEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS       P  L +FIA KGSV L+G SLTVN V    F +  I HT   TTW    VG
Sbjct: 118 DSTRVTFRAPEALARFIAPKGSVALDGTSLTVNEVAGRDFGINFIPHTKTATTWGDVAVG 177

Query: 181 DLINIEVDSMMRYIARL 197
           DLINIE+D+M RY+ARL
Sbjct: 178 DLINIEIDTMARYVARL 194


>gi|83941146|ref|ZP_00953608.1| riboflavin synthase subunit alpha [Sulfitobacter sp. EE-36]
 gi|83846966|gb|EAP84841.1| riboflavin synthase subunit alpha [Sulfitobacter sp. EE-36]
          Length = 195

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (64%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGKI  +      +R R+ T Y+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDIGKITKLEQQGD-LRARIETGYDTSGIDMGASIASDGVCLTVVDLGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV++ AET   TN+ +W +G  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWYEVQISAETVDKTNLGAWEVGRRLNLERALKVGDELGGHIVSGHVDGVAEVVALRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPEVLARFIAPKGSVALNGTSLTVNEVDGCDFGINFIPHTKEVTTWGDVAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D++ RY+ARL  ++
Sbjct: 175 DRINLEIDTLARYVARLAEMS 195


>gi|254465336|ref|ZP_05078747.1| riboflavin synthase, alpha subunit [Rhodobacterales bacterium Y4I]
 gi|206686244|gb|EDZ46726.1| riboflavin synthase, alpha subunit [Rhodobacterales bacterium Y4I]
          Length = 195

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 129/198 (65%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I  +      +R R+ T Y+T+ + +G SIA  G+CLTVV L      D
Sbjct: 1   MFTGIITDVGTIAELEQQGD-LRARIRTGYDTATIDIGASIASDGVCLTVVALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V+V AET   TN+ +W +G  +NLER++K+GD L GH+VSGH+DG   ++ +   G
Sbjct: 55  DWYDVQVSAETVSKTNLGAWTVGKRVNLERALKVGDELGGHIVSGHVDGVAGVVAMTDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   KVG
Sbjct: 115 DSTRVTLRAPEALARFIAPKGSVALNGTSLTVNDVDGCDFGINFIPHTKEVTTWGDVKVG 174

Query: 181 DLINIEVDSMMRYIARLY 198
           D IN+E+D++ RY+ARL+
Sbjct: 175 DQINLEIDTLARYVARLH 192


>gi|183179302|gb|ACC44142.1| riboflavin synthase alpha chain [Bartonella clarridgeiae]
          Length = 182

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 120/180 (66%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           + P+ +G+RL + T Y+   +K+G SIA +GICLT+V  + + +  +W+ VE W E   +
Sbjct: 3   IQPLKQGIRLNISTHYDVESLKIGASIACSGICLTIVERALKSTATHWFAVEAWEEALCL 62

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+  W  GTF+NLERS++LGD + GHLV GHIDG  EI+     GD+    L +P  L 
Sbjct: 63  TNLTQWTKGTFVNLERSLRLGDEIGGHLVFGHIDGLAEIIEKKNEGDATRFHLQVPMQLA 122

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYI 194
            FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E T W   +VGD +N+EVD + RY+
Sbjct: 123 PFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTIWGQAEVGDQVNLEVDQLARYV 182


>gi|260426229|ref|ZP_05780208.1| riboflavin synthase, alpha subunit [Citreicella sp. SE45]
 gi|260420721|gb|EEX13972.1| riboflavin synthase, alpha subunit [Citreicella sp. SE45]
          Length = 195

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 132/201 (65%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I A+   A  +  R+ TSY+T+ + LG SIA  G+CLTVV L      D
Sbjct: 1   MFTGIVTDMGEIRALQQ-AGDLTARIGTSYDTAGIDLGASIACDGVCLTVVDLG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+EV++ AET   TN+ SW  G  INLER++++GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWFEVQISAETLSKTNLGSWAEGRRINLERALRVGDELGGHIVSGHVDGLAEVISIADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS   +   P  L +FIA KGSV LNG SLTVN V    F + +I HT + TTW     G
Sbjct: 115 DSTRIQFRAPDALAKFIAPKGSVALNGTSLTVNEVQGAVFGINVIPHTKDATTWGQVGEG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D+M RY+ARL  ++
Sbjct: 175 DKVNLEIDTMARYVARLAEMS 195


>gi|126513825|gb|ABO16009.1| riboflavin synthase [Bartonella sp. Sm7688bgl]
          Length = 187

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 122/185 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+R ++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGVRFKISTRYAAESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEEALRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V ++ FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVPKGSVALNGTSLTVNGVEESVFDVLIIRHTLEMTTWGHAKIG 180

Query: 181 DLINI 185
           DL+ +
Sbjct: 181 DLVQL 185


>gi|89067935|ref|ZP_01155379.1| riboflavin synthase subunit alpha [Oceanicola granulosus HTCC2516]
 gi|89046533|gb|EAR52589.1| riboflavin synthase subunit alpha [Oceanicola granulosus HTCC2516]
          Length = 203

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 126/199 (63%), Gaps = 4/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++IA+      +R R+ T+Y    M +G SIA  G+CLTVV    E   D
Sbjct: 1   MFTGIVTDVGEVIALERRGD-LRARIATAYPAETMDIGASIACDGVCLTVVARGTEAGRD 59

Query: 61  NWYEVEVWAETNRITNIA--SWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            W++V++ AET   TNI    W  G  INLER++K+GD L GH+VSGH+DG  E++    
Sbjct: 60  -WFDVDISAETVAKTNIGRNGWAAGKRINLERALKVGDELGGHIVSGHVDGVAEVVASAR 118

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P  L +FIA KGSV LNG SLTVN V    F + LI HT E TTW    
Sbjct: 119 EGDSTRLTLRAPEALARFIAPKGSVALNGTSLTVNDVDGRDFGINLIPHTQEVTTWGEAG 178

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD+M RY+ARL
Sbjct: 179 VGDAVNLEVDTMARYVARL 197


>gi|254511752|ref|ZP_05123819.1| riboflavin synthase, alpha subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221535463|gb|EEE38451.1| riboflavin synthase, alpha subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 195

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +      +R R+ T Y T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGTVTELDQQGD-LRARIRTGYETAGIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+++W IG  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVQISAETVSKTNLSTWRIGKRVNLERALKVGDELGGHIVSGHVDGVAEVVAVADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVALRAPSELARFIAPKGSVALNGTSLTVNDVDGCNFGINFIPHTKEVTTWGDVAVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DRVNLEIDTLARYVARL 191


>gi|163747440|ref|ZP_02154792.1| riboflavin synthase subunit alpha [Oceanibulbus indolifex HEL-45]
 gi|161379293|gb|EDQ03710.1| riboflavin synthase subunit alpha [Oceanibulbus indolifex HEL-45]
          Length = 195

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/198 (48%), Positives = 128/198 (64%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G +  +      +R R+ T Y+T  + +G SIA  G+CLTVV L      D
Sbjct: 1   MFTGIITDVGTVTKLEQEGD-LRARIQTRYDTRGIDMGASIASDGVCLTVVGLG-----D 54

Query: 61  NWYEVEVWAETNRITNIAS-WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +WYEV++ AET   TN+   W  G  +NLER++K+GD L GH+VSGH+DG  EI+ +   
Sbjct: 55  DWYEVQISAETVGKTNLGQHWAEGRRVNLERALKVGDELGGHIVSGHVDGVAEIIEMKDE 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   KV
Sbjct: 115 GDSTRVTLRAPKDLARFIAPKGSVALNGTSLTVNDVDGCDFGINFIPHTKEVTTWGDAKV 174

Query: 180 GDLINIEVDSMMRYIARL 197
           GDL+N+E+D++ RY+ARL
Sbjct: 175 GDLVNLEIDTLARYVARL 192


>gi|99081971|ref|YP_614125.1| riboflavin synthase subunit alpha [Ruegeria sp. TM1040]
 gi|99038251|gb|ABF64863.1| riboflavin synthase alpha subunit [Ruegeria sp. TM1040]
          Length = 201

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 130/203 (64%), Gaps = 12/203 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I  +   A  +R R+ T+Y+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGTITELEQ-AGDLRARIQTAYDTSSIDMGASIASDGVCLTVVALGP----- 54

Query: 61  NWYEVEVWAETNRITNIAS------WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           +WY+V++ AET   TNI +      W +G  +NLER++K+GD L GH+VSGH+DG  E++
Sbjct: 55  DWYDVQISAETTSKTNIDARGTHKGWFVGKRVNLERALKVGDELGGHIVSGHVDGVAEVV 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW 174
            +   GDS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW
Sbjct: 115 AMRDEGDSTRVTLRAPKELARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKEVTTW 174

Query: 175 KMHKVGDLINIEVDSMMRYIARL 197
               VGDLIN+E+D++ RY+ARL
Sbjct: 175 GDVAVGDLINLEIDTLARYVARL 197


>gi|58983158|gb|AAW83493.1| riboflavin synthase [Bartonella henselae]
 gi|315936247|gb|ADU55797.1| riboflavin synthase subunit alpha [Bartonella henselae]
          Length = 178

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 122/177 (68%), Gaps = 1/177 (0%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSVDNWYEVEVWAETNR 73
           +  + +GMR  + T Y+   +++G SIA +G+CLT+V R S++ +  NW+ VE W E  R
Sbjct: 1   IQSLKQGMRFNISTRYSIENLEIGASIACSGVCLTIVERGSKQQAKINWFAVEAWEEALR 60

Query: 74  ITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNL 133
           +TN+  W  GTFINLERS++LGD + GHLVSGHIDG  EI+     GD++   L +P   
Sbjct: 61  LTNLTQWTKGTFINLERSLRLGDEMGGHLVSGHIDGLAEIIDQKSEGDAVRFFLQVPKRF 120

Query: 134 EQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSM 190
             FI  KGS+ LNG SLTVN V ++ FDVL+IRHT+E TTW+  K+GDL+N+E+D +
Sbjct: 121 IPFIVNKGSIALNGTSLTVNCVEEHIFDVLIIRHTLEMTTWRQAKIGDLVNLEIDQL 177


>gi|254505270|ref|ZP_05117421.1| riboflavin synthase, alpha subunit [Labrenzia alexandrii DFL-11]
 gi|222441341|gb|EEE48020.1| riboflavin synthase, alpha subunit [Labrenzia alexandrii DFL-11]
          Length = 203

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 122/197 (61%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I +   I  G R R+ T Y+T    +G SI+  G+C TV    E  S  
Sbjct: 1   MFTGIVTDLGEIQSALDIPAGKRTRIKTLYDTDSFDIGASISCDGVCHTVT-AKENSSGG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EVE  AET  +TN+++W  G  +NLERS+ +G  L GHLV GH+DG  EI   +   
Sbjct: 60  NWFEVESAAETLALTNVSNWKEGQTLNLERSLTMGAELGGHLVLGHVDGVAEITKREDHP 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+Y +   P  + +FIA KGSV LNG SLTVN V    F V LI HT+E T W   K G
Sbjct: 120 DSVYFQFRAPEGVAKFIAKKGSVALNGTSLTVNEVDGLLFSVFLIPHTLEVTNWSNSKAG 179

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD M RY ARL
Sbjct: 180 DRVNLEVDMMARYAARL 196


>gi|126513823|gb|ABO16008.1| riboflavin synthase [Bartonella sp. Sm7680bgl]
          Length = 185

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 121/185 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+  ++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGVHFKISTRYAAESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEEALRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V ++ FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKVSRQFMPFIVPKGSVALNGTSLTVNGVEESVFDVLIIRHTLEMTTWGHAKVG 180

Query: 181 DLINI 185
           D +N+
Sbjct: 181 DWVNL 185


>gi|312226855|gb|ADQ50173.1| riboflavin synthase C [Bartonella henselae]
 gi|312226857|gb|ADQ50174.1| riboflavin synthase C [Bartonella henselae]
          Length = 169

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 119/169 (70%), Gaps = 1/169 (0%)

Query: 28  TSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFI 86
           T Y+   +++G SIA +G+CLT+V R S++ +  NW+ VE W E  R+TN+  W  GTFI
Sbjct: 1   TRYSIENLEIGASIACSGVCLTIVERGSKQQAKINWFAVEAWEEALRLTNLTQWTKGTFI 60

Query: 87  NLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLN 146
           NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +P     FI  KGS+ LN
Sbjct: 61  NLERSLRLGDEMGGHLVSGHIDGLAEIIDQKSEGDAVRFFLQVPKRFIPFIVNKGSIALN 120

Query: 147 GVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIA 195
           G SLTVN V ++ FDVL+IRHT+E TTW+  K+GDL+N+E+D + RY+A
Sbjct: 121 GTSLTVNCVEEHIFDVLIIRHTLEMTTWRQAKIGDLVNLEIDQLARYVA 169


>gi|254451762|ref|ZP_05065199.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 238]
 gi|198266168|gb|EDY90438.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 238]
          Length = 202

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 130/199 (65%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+++A+      +R R+ T Y+ S + +G SIA  G+CLTVV    +   D
Sbjct: 1   MFTGIVTDVGRVLALENRGD-LRARIATRYDISGIDIGASIASDGVCLTVVAKGVDLDRD 59

Query: 61  N--WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +  WY+V++ AET   T++A+W +G  +NLERS+K+GD L GH+VSGH+DG   I+ +  
Sbjct: 60  SQGWYDVDISAETVSKTSLAAWAVGKRVNLERSLKVGDELGGHIVSGHVDGVAMIVGMVD 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            G S    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT   TTW   K
Sbjct: 120 DGASTRVTLQAPDDLGRFIAPKGSVALNGTSLTVNEVDGARFGINFIPHTKSVTTWGDAK 179

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD+M RY+ARL
Sbjct: 180 VGDPVNLEVDTMARYVARL 198


>gi|126733194|ref|ZP_01748941.1| riboflavin synthase subunit alpha [Roseobacter sp. CCS2]
 gi|126716060|gb|EBA12924.1| riboflavin synthase subunit alpha [Roseobacter sp. CCS2]
          Length = 198

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 126/197 (63%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK++ +      +R R+ T Y+   + +G SIA  G+CLTV+ L    +  
Sbjct: 1   MFTGIITDIGKVLELEQRGD-LRARIGTGYDIGGIDIGASIACNGVCLTVIALGS--APQ 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW++VE+ AET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 58  NWFDVEISAETVGATNVGDWALGVRLNLERALKVGDELGGHIVSGHVDGVAEVVAMTDEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS       P +L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    VG
Sbjct: 118 DSTRVTFRTPGDLAKFIAPKGSVALNGTSLTVNEVDGVDFGINFIPHTKAATTWGDTSVG 177

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+E+D+M RY+ARL
Sbjct: 178 DHINLEIDTMARYVARL 194


>gi|323138568|ref|ZP_08073636.1| riboflavin synthase, alpha subunit [Methylocystis sp. ATCC 49242]
 gi|322396202|gb|EFX98735.1| riboflavin synthase, alpha subunit [Methylocystis sp. ATCC 49242]
          Length = 199

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 131/198 (66%), Gaps = 3/198 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+I+A+ P  +  RLR+  +Y+   + LG SIA AG CLTVV ++ E +  
Sbjct: 1   MFTGIVTDIGEIVAVEPRGELRRLRIACNYDADGIALGASIACAGTCLTVVAVAREGA-R 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL-DFI 119
             ++V+  AET   T +  W +GT INLER++++GD L GH+V+GHIDG   I+   DF 
Sbjct: 60  TVFDVDAAAETLARTTVGIWAVGTRINLERALRIGDELGGHIVTGHIDGIARIMSRDDFD 119

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G + Y  +  PH L +F+A KGSV L+G SLTVN V  + F +LLI HT+  TT+   K 
Sbjct: 120 GMARYW-IETPHELSRFVAQKGSVALDGASLTVNEVEGDRFSILLIPHTLAVTTFGARKA 178

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD M RY ARL
Sbjct: 179 GDALNIEVDLMARYAARL 196


>gi|328543538|ref|YP_004303647.1| riboflavin synthase subunit alpha [polymorphum gilvum SL003B-26A1]
 gi|326413282|gb|ADZ70345.1| Riboflavin synthase subunit alpha [Polymorphum gilvum SL003B-26A1]
          Length = 201

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 121/197 (61%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G I+ +  I  G R R+ T+Y+   + +G SIA  G C TV        V 
Sbjct: 1   MFTGIVTDVGTILRVESIPAGRRTRIATAYDPDTIDIGASIACGGPCHTVTAKGRTGGV- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EVE  AET R+T ++ W  G  +NLERS+ LG  L GHLV GH+DGT  IL      
Sbjct: 60  NWFEVESGAETLRLTTVSDWTAGMRLNLERSLMLGAELGGHLVLGHVDGTATILERRDHP 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S+Y R   P  L +FIA KGSV L+G SLTVN V  + F V LI HT++ TTW     G
Sbjct: 120 ESVYFRFEAPAGLARFIARKGSVALDGTSLTVNEVEGDSFSVFLIPHTLQVTTWAERHAG 179

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD M RY ARL
Sbjct: 180 DRVNLEVDMMARYAARL 196


>gi|255264316|ref|ZP_05343658.1| riboflavin synthase, alpha subunit [Thalassiobium sp. R2A62]
 gi|255106651|gb|EET49325.1| riboflavin synthase, alpha subunit [Thalassiobium sp. R2A62]
          Length = 195

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG+++  T     +R R+ TSY+T+ + +G SIA  G+CLT ++L      D
Sbjct: 1   MFTGIITDIGEVVE-TEQRGDLRARIKTSYDTATIDIGASIACDGVCLTAIKLG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++VE+ AE+   TN+ +W  G  +NLER++KLGD L GH+VSGH+DG  +++ +   G
Sbjct: 55  GWFDVEISAESVSKTNLTTWAPGKRLNLERALKLGDELGGHIVSGHVDGVAQVVDIKEEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    +G
Sbjct: 115 DSTRVTLRAPEALAKFIAPKGSVALNGTSLTVNEVNGKDFGINFIPHTKVATTWGDVAMG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DPVNLEIDTLARYVARL 191


>gi|304653527|gb|ADM47775.1| riboflavin synthase [Bartonella capreoli]
          Length = 185

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 120/181 (66%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + +G+RL + T Y+   +++G SIA +GICLTVV    + +  N + VE W E   +
Sbjct: 5   IQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVVERELKQANANCFVVEAWKEALCL 64

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     GD++   L     L 
Sbjct: 65  TNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEGDAIRFYLKASMRLA 124

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYI 194
            FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVGD +N+EVD + RY+
Sbjct: 125 PFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVGDQVNLEVDQLARYV 184

Query: 195 A 195
           A
Sbjct: 185 A 185


>gi|315936251|gb|ADU55799.1| riboflavin synthase subunit alpha [Bartonella clarridgeiae]
          Length = 177

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 117/176 (66%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           + P+ +G+RL + T Y+   +K+G SIA +GICLT+V  + + +  +W+ VE W E   +
Sbjct: 1   IQPLKQGIRLNISTHYDVESLKIGASIACSGICLTIVERALKSTATHWFAVEAWEEALCL 60

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+  W  GTF+NLERS++LGD + GHLV GHIDG  EI+     GD+    L +P  L 
Sbjct: 61  TNLTQWTKGTFVNLERSLRLGDEIGGHLVFGHIDGLAEIIEKKNEGDATRFHLQVPMQLA 120

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSM 190
            FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E T W   +VGD +N+EVD +
Sbjct: 121 PFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTIWGQAEVGDQVNLEVDQL 176


>gi|163742961|ref|ZP_02150344.1| riboflavin synthase subunit alpha [Phaeobacter gallaeciensis 2.10]
 gi|161383644|gb|EDQ08030.1| riboflavin synthase subunit alpha [Phaeobacter gallaeciensis 2.10]
          Length = 249

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/200 (47%), Positives = 129/200 (64%), Gaps = 8/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ T Y+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 53  MFTGIVTDIGIITELEQQGD-LRARIRTGYDTASIDIGASIASDGVCLTVIALG-----D 106

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +WY+V++ AET   TNI    W +G  +NLER++K+GD L GH+VSGH+DG  E++ +  
Sbjct: 107 DWYDVQISAETVSKTNIGGNGWTVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVDIRD 166

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    
Sbjct: 167 EGDSTRVTLRAPEDLARFIAPKGSVALNGTSLTVNDVEGCDFGINFIPHTKEVTTWGDVA 226

Query: 179 VGDLINIEVDSMMRYIARLY 198
           VG+ +N+E+D++ RY+ARL+
Sbjct: 227 VGNAVNLEIDTLARYVARLH 246


>gi|307945263|ref|ZP_07660599.1| riboflavin synthase, alpha subunit [Roseibium sp. TrichSKD4]
 gi|307771136|gb|EFO30361.1| riboflavin synthase, alpha subunit [Roseibium sp. TrichSKD4]
          Length = 203

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 123/203 (60%), Gaps = 1/203 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I ++  +  G+R R+ T Y+   + +G SIA  G C TVV    + +  
Sbjct: 1   MFTGIVTDLGEITSVEKVPAGLRTRIRTQYDPEGIDIGASIACGGPCHTVVAKGTDDA-G 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EV+  AET  +T ++ W  G  +NLERS+K+G  L GHLV GH+DG   I   +   
Sbjct: 60  NWFEVDSAAETRALTTVSDWKQGMKLNLERSLKMGTELGGHLVLGHVDGLATITKREDHE 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+Y +   P     FIA KGSV L+G SLTVN    + F V LI HT+E TTW    VG
Sbjct: 120 DSVYFQFQAPMEFAPFIAKKGSVALDGTSLTVNEADGDLFSVFLIPHTLEVTTWSERHVG 179

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD M RY ARL   + +
Sbjct: 180 DKVNLEVDMMARYAARLAEFSKA 202


>gi|259416636|ref|ZP_05740556.1| riboflavin synthase, alpha subunit [Silicibacter sp. TrichCH4B]
 gi|259348075|gb|EEW59852.1| riboflavin synthase, alpha subunit [Silicibacter sp. TrichCH4B]
          Length = 201

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 128/203 (63%), Gaps = 12/203 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I  +      +R R+ T+Y+T  + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGTITELEQTGD-LRARIQTAYDTGSIDMGASIASDGVCLTVVALGP----- 54

Query: 61  NWYEVEVWAETNRITNI------ASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           +WY+V++ AET   TNI        W +G  +NLER++K+GD L GH+VSGH+DG  E++
Sbjct: 55  DWYDVQISAETISKTNIDGRGNHKGWFVGKRVNLERALKVGDELGGHIVSGHVDGVAEVV 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW 174
            +   GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW
Sbjct: 115 EMRDEGDSTRVTLRAPKDLARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKEVTTW 174

Query: 175 KMHKVGDLINIEVDSMMRYIARL 197
               VGDLIN+E+D++ RY+ARL
Sbjct: 175 GDVSVGDLINLEIDTLARYVARL 197


>gi|163738653|ref|ZP_02146067.1| riboflavin synthase, alpha subunit [Phaeobacter gallaeciensis
           BS107]
 gi|161387981|gb|EDQ12336.1| riboflavin synthase, alpha subunit [Phaeobacter gallaeciensis
           BS107]
          Length = 197

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/200 (47%), Positives = 129/200 (64%), Gaps = 8/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ T Y+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGIITELEQQGD-LRARIRTGYDTATIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +WY+V++ AET   TNI    W +G  +NLER++K+GD L GH+VSGH+DG  E++ +  
Sbjct: 55  DWYDVQISAETVSKTNIGGNGWTVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVDIRD 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    
Sbjct: 115 EGDSTRVTLRAPEDLARFIAPKGSVALNGTSLTVNDVEGCDFGINFIPHTKEVTTWGDVA 174

Query: 179 VGDLINIEVDSMMRYIARLY 198
           VG+ +N+E+D++ RY+ARL+
Sbjct: 175 VGNAVNLEIDTLARYVARLH 194


>gi|254441128|ref|ZP_05054621.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 307]
 gi|198251206|gb|EDY75521.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 307]
          Length = 202

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 132/201 (65%), Gaps = 7/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+++A+  +   +R R+ T Y+ S + +G SIA  G+CLTVV        D
Sbjct: 1   MFTGIITDVGRVLALEDLGD-LRARIATRYDISGIDIGASIASDGVCLTVVAKGTSLDCD 59

Query: 61  --NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WY+V++ AET   T++ +W +G  +NLERS+K+GD L GH+VSGH+DG    + +D 
Sbjct: 60  PQGWYDVDISAETVSKTSLVAWVVGKRVNLERSLKVGDELGGHIVSGHVDGVA--MIVDM 117

Query: 119 IGDSMYCRLSL--PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
           + D    R++L  P++L +FIA KGSV LNG S+TVN V    F +  I HT   TTW  
Sbjct: 118 VDDGASTRVTLEAPNDLGRFIAPKGSVALNGTSVTVNEVDGARFGINFIPHTKSVTTWGD 177

Query: 177 HKVGDLINIEVDSMMRYIARL 197
            KVGD +N+EVD+M RY+ARL
Sbjct: 178 TKVGDPVNLEVDTMARYVARL 198


>gi|154248199|ref|YP_001419157.1| riboflavin synthase, alpha subunit [Xanthobacter autotrophicus Py2]
 gi|154162284|gb|ABS69500.1| riboflavin synthase, alpha subunit [Xanthobacter autotrophicus Py2]
          Length = 203

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 121/197 (61%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G ++A+    +   L + T+Y  + + +G SIAHAG+CLTV  ++      
Sbjct: 1   MFTGIVTDMGDLVAVETKGEVKTLTIATAYEAAGIDVGASIAHAGVCLTVTSVTAGGPRG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET  IT +  W  G  INLERS+KLGD L GH+VSGH+D T  ++  + +G
Sbjct: 61  TLFTVDAGPETLAITTVGGWTPGQRINLERSLKLGDELGGHMVSGHVDSTARVVSREDLG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      +P  L +F+AVKGSV L+G SLTVN V  N F  LLI HT+  TTW   K G
Sbjct: 121 STTRFVFEVPEQLARFVAVKGSVGLDGTSLTVNTVEGNTFSCLLIPHTLAVTTWGGVKAG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N EVD M RY ARL
Sbjct: 181 DTVNFEVDLMARYAARL 197


>gi|148357797|gb|ABQ59234.1| riboflavin synthase [Bartonella melophagi]
          Length = 189

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/188 (47%), Positives = 122/188 (64%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  +  + +G+RL + T Y+   +++G SIA +GICLTVV    +H+  N + VE W 
Sbjct: 1   GCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVVERELKHANANCFVVEAWK 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E   +TN+  W  GTF+NLERS++LG  + GHLVSGH+DG  EI+     GD++   L  
Sbjct: 61  EALCLTNLVQWTKGTFVNLERSLRLGGEIGGHLVSGHVDGLAEIIDQKNEGDAIRFYLRA 120

Query: 130 PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDS 189
              L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KV D +N+EVD 
Sbjct: 121 SMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVRDQVNLEVDQ 180

Query: 190 MMRYIARL 197
           + RY+ARL
Sbjct: 181 LARYVARL 188


>gi|89055908|ref|YP_511359.1| riboflavin synthase subunit alpha [Jannaschia sp. CCS1]
 gi|88865457|gb|ABD56334.1| riboflavin synthase alpha subunit [Jannaschia sp. CCS1]
          Length = 196

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 129/197 (65%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++ A+      +R R+ T Y+ + + LG SIA  G+CLTVV +       
Sbjct: 1   MFTGIVTDLGEVRALEHRGD-LRARIGTGYDMATVDLGASIACDGVCLTVVAMGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AE+   TNI +W +G  +NLER++K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 55  DWFDVDISAESVSRTNIGAWEVGARLNLERALKVGDELGGHIVSGHVDGVAEILSVVDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS       P  L +F+A KGSV LNG SLTVN V  + F V +I HT E TTW + K G
Sbjct: 115 DSTRFTFRAPGELGRFVAPKGSVALNGTSLTVNEVDGSEFGVNIIPHTKEVTTWGVAKAG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N E+D++ RY+ARL
Sbjct: 175 DRVNFEIDTLARYVARL 191


>gi|85816036|gb|ABC84382.1| riboflavin synthase [Bartonella bovis]
          Length = 181

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 120/181 (66%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + +G+RL + T Y+   +++G SIA +GICLTVV    + +  N + VE W ET  +
Sbjct: 1   IQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVVERELKQTNINCFVVEAWKETLYL 60

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTF+NLERS++LGD + GHLVSGH+D   EI+     GD++   L     L 
Sbjct: 61  TNLAKWTKGTFVNLERSLRLGDEIGGHLVSGHVDDLAEIVDQKNEGDAIRFYLKTSMRLA 120

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYI 194
            FIA KGS+ LNG SLT+N +  N FDVL+IRHT+E TTW   KVGD +N+EVD + RY+
Sbjct: 121 PFIAEKGSIALNGTSLTINSIEDNIFDVLIIRHTLEMTTWGQAKVGDQVNLEVDQLARYV 180

Query: 195 A 195
           A
Sbjct: 181 A 181


>gi|260575724|ref|ZP_05843721.1| riboflavin synthase, alpha subunit [Rhodobacter sp. SW2]
 gi|259022122|gb|EEW25421.1| riboflavin synthase, alpha subunit [Rhodobacter sp. SW2]
          Length = 200

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 127/198 (64%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+TDIG+++A     KG +R R+ T Y+ + + +G SIA  G+CLTVV +  +   
Sbjct: 1   MFTGIITDIGQVLACD--RKGDLRARIGTRYDVAGIDIGASIACDGVCLTVVAVGSDPQ- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W+EV++  ET   TN+  W  G+ +NLER+++LGD L GH+VSGH+DG  E++ L   
Sbjct: 58  -GWFEVQISGETVSKTNLGGWQAGSRVNLERALRLGDELGGHIVSGHVDGLAEVVGLHPE 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GDS+      P  L +FIA KGSV LNG SLTVN V    F V  I HT   TTW    +
Sbjct: 117 GDSLRVTFRAPEALAKFIAPKGSVALNGTSLTVNEVEGCDFGVNFIPHTRSATTWGSVAL 176

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD+M RY+ARL
Sbjct: 177 GDRVNLEVDTMARYVARL 194


>gi|219689346|gb|ACL31693.1| riboflavin synthase [Bartonella sp. Tel Aviv Rr]
          Length = 179

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 88/177 (49%), Positives = 115/177 (64%)

Query: 18  IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNI 77
           + +GMR+++ T Y    + +G SIA +GICLTVV    +    NW+ VE W ET R+TN+
Sbjct: 3   LKQGMRVKISTHYAVESLVIGASIACSGICLTVVERGFKQEDSNWFVVEAWEETLRLTNL 62

Query: 78  ASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFI 137
           A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +      FI
Sbjct: 63  AQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEGDAIRFYLKVSRQFMPFI 122

Query: 138 AVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYI 194
             KGSV LNG SLTVN V    FDVL+I HT+E TTW   K+GD +N+E D + RY+
Sbjct: 123 VPKGSVALNGTSLTVNSVEDCVFDVLIILHTLEVTTWGEAKIGDWVNLETDQLARYV 179


>gi|114767005|ref|ZP_01445913.1| riboflavin synthase subunit alpha [Pelagibaca bermudensis HTCC2601]
 gi|114540789|gb|EAU43853.1| riboflavin synthase subunit alpha [Roseovarius sp. HTCC2601]
          Length = 195

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 132/201 (65%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++ ++   A  +  R+ T Y+TS +++G SIA  G+CLTV+ L       
Sbjct: 1   MFTGIVTDMGEVRSLEQ-AGDLTARIGTGYDTSGIEIGASIACDGVCLTVIDLGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN+ +W  G  INLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWFDVQISAETVSKTNLDAWTEGRRINLERALKVGDELGGHIVSGHVDGLAEVVAMRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   +VG
Sbjct: 115 DSTRVTLRAPEALARFIAPKGSVALNGTSLTVNEVDGCEFGINFIPHTKEVTTWGGVEVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D++ RY+ARL  ++
Sbjct: 175 DRINLEIDTLARYVARLAEMS 195


>gi|110618427|gb|ABG78841.1| riboflavin synthase [Bartonella sp. CL8135co]
          Length = 182

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/182 (47%), Positives = 121/182 (66%)

Query: 6   VTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEV 65
           +TDIG +  +  + KG+ L + T Y+   +++G SIA +G+CLT+V    + +  NW+ V
Sbjct: 1   LTDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGVCLTIVERGSKQANINWFAV 60

Query: 66  EVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYC 125
           E W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  E++     GD++  
Sbjct: 61  EAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEVIDQKNEGDAVRF 120

Query: 126 RLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINI 185
            L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+GD  N+
Sbjct: 121 FLQVPTRLTPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGEAKIGDHDNL 180

Query: 186 EV 187
           E+
Sbjct: 181 EI 182


>gi|294678592|ref|YP_003579207.1| riboflavin synthase subunit alpha [Rhodobacter capsulatus SB 1003]
 gi|294477412|gb|ADE86800.1| riboflavin synthase, alpha subunit [Rhodobacter capsulatus SB 1003]
          Length = 196

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I+A+      +R R+   Y+   +++G SIAHAG+CLTV+         
Sbjct: 1   MFTGIVTDLGEILALENTGD-LRARIRCGYDMKTVEIGASIAHAGVCLTVIATGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+  W +G+ INLER++K+GD L GH+VSGH+DG  EI  L   G
Sbjct: 55  DWYDVQISAETVSKTNLGGWTVGSRINLERALKVGDELGGHIVSGHVDGVAEITALRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S       P  L ++IA KGSV L+G SLTVN V    F + +I HT   TT+   +VG
Sbjct: 115 ESTRFSFRAPEALAKYIAPKGSVALDGASLTVNEVDGCTFGINIIPHTKAVTTFGTARVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DKVNLEIDTLARYVARL 191


>gi|209884996|ref|YP_002288853.1| riboflavin synthase, alpha subunit [Oligotropha carboxidovorans
           OM5]
 gi|209873192|gb|ACI92988.1| riboflavin synthase, alpha subunit [Oligotropha carboxidovorans
           OM5]
          Length = 202

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/199 (45%), Positives = 127/199 (63%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+TD+G+I+++TP A+G   RL +   Y+ + +  G SIA  G+CLTVVR   E  
Sbjct: 1   MFTGIITDVGEILSITPTAQGQLHRLHIGCHYDQTTIADGASIACNGVCLTVVRSGVEAG 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+E +  AET R+T    W  G+ +NLER++K+GD L GH+VSGH+DG   +   + 
Sbjct: 61  -RTWFEADAAAETLRLTTARDWTQGSHLNLERALKIGDELGGHIVSGHVDGIATVTLRED 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L  P +L +FIA KGSV L+G SLTVN    + F VL+I HT++ TT +  +
Sbjct: 120 LPDMARFELRAPRDLAKFIAAKGSVTLDGASLTVNTAVNDTFSVLIIPHTLQVTTLQSWQ 179

Query: 179 VGDLINIEVDSMMRYIARL 197
           VG  +NIE+D M RY ARL
Sbjct: 180 VGSEVNIEIDVMARYAARL 198


>gi|126732571|ref|ZP_01748369.1| riboflavin synthase subunit alpha [Sagittula stellata E-37]
 gi|126707017|gb|EBA06085.1| riboflavin synthase subunit alpha [Sagittula stellata E-37]
          Length = 198

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 127/200 (63%), Gaps = 9/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G++ A+      +R R+ TSY T+ + +G SIA  G+CLTV+ L  +    
Sbjct: 1   MFTGIITDVGEVRALERRGD-LRARIGTSYETASIDMGASIACNGVCLTVIGLGAD---- 55

Query: 61  NWYEVEVWAETNRITNIAS---WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
            W+EV++ AET   TNI     W  G+ INLER++K+GD L GH+VSGH+DG   ++ + 
Sbjct: 56  -WFEVDISAETLSKTNIGGNDGWTEGSKINLERALKVGDELGGHIVSGHVDGVATVIGMA 114

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             GDS       P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW + 
Sbjct: 115 DEGDSTRVTFDAPTELARFIAPKGSVALNGTSLTVNEVDDTTFGINFIPHTKEVTTWGLT 174

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VGD IN+E+D++ RY+ARL
Sbjct: 175 AVGDRINLEIDTLARYVARL 194


>gi|254460313|ref|ZP_05073729.1| riboflavin synthase, alpha subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206676902|gb|EDZ41389.1| riboflavin synthase, alpha subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 197

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 129/199 (64%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +   T +   + +R+ T Y TS + +G SIA  G+CLTV+ L  +    
Sbjct: 1   MFTGIITDIGDV-RETELRGDLWVRIGTRYETSGIDIGASIACDGVCLTVIELGAD---- 55

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            W++V++ AE+   TNI +  W +G  +NLER++K+GD L GH+VSGH+DG  EI+ +  
Sbjct: 56  -WFDVQISAESVSKTNIGTTNWSVGRRLNLERALKVGDELGGHIVSGHVDGVAEIIAMHE 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            G+S    L  P NL +FIA KGSV LNG SLTVN V +  F +  I HT   TTW   K
Sbjct: 115 EGESTRVTLRAPENLAKFIAPKGSVALNGTSLTVNEVTRTDFGINFIPHTKTATTWGDAK 174

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+E+D++ RY+ARL
Sbjct: 175 VGDAVNLEIDTLARYVARL 193


>gi|312226853|gb|ADQ50172.1| riboflavin synthase C [Bartonella clarridgeiae]
          Length = 168

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 112/168 (66%)

Query: 28  TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFIN 87
           T Y+   +K+G SIA +GICLT+V  + + +  +W+ VE W E   +TN+  W  GTF+N
Sbjct: 1   THYDVESLKIGASIACSGICLTIVERALKSTATHWFAVEAWEEALCLTNLTQWTKGTFVN 60

Query: 88  LERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNG 147
           LERS++LGD + GHLV GHIDG  EI+     GD+    L +P  L  FIA KGS+ LNG
Sbjct: 61  LERSLRLGDEIGGHLVFGHIDGLAEIIEKKNEGDATRFHLQVPMQLAPFIAEKGSIALNG 120

Query: 148 VSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIA 195
            SLTVN V  N FDVL+IRHT+E T W   +VGD +N+EVD + RY+A
Sbjct: 121 TSLTVNYVENNIFDVLIIRHTLEMTIWGQAEVGDQVNLEVDQLARYVA 168


>gi|85705015|ref|ZP_01036115.1| riboflavin synthase subunit alpha [Roseovarius sp. 217]
 gi|85670337|gb|EAQ25198.1| riboflavin synthase subunit alpha [Roseovarius sp. 217]
          Length = 195

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+      +R R+ T Y+T ++ +G SIA  G+CLTVV L  +    
Sbjct: 1   MFTGIITDVGRIQAVEHRGD-LRARIGTGYDTGRIDIGASIACDGVCLTVVALGSD---- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V++ AET   TN++ W  G  +NLER++++GD L GH+VSGH+DG  E++ L   G
Sbjct: 56  -WFDVDISAETLSKTNLSGWDAGRRVNLERALRVGDELGGHIVSGHVDGLAEVVGLRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    +G
Sbjct: 115 DSTRVILRAPDALARFIAPKGSVALNGTSLTVNEVEGRDFGINFIPHTKAVTTWGDVALG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D+IN+E+D++ RY+ARL
Sbjct: 175 DMINLEIDTLARYVARL 191


>gi|299135083|ref|ZP_07028274.1| riboflavin synthase, alpha subunit [Afipia sp. 1NLS2]
 gi|298590060|gb|EFI50264.1| riboflavin synthase, alpha subunit [Afipia sp. 1NLS2]
          Length = 202

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 131/199 (65%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+T+IG I+++ P A+G   RLR+  +Y+ + +  G SIA  G+CLTVVR   E  
Sbjct: 1   MFTGIITEIGDILSIKPSAQGQLHRLRIGCAYDQTTIADGASIACNGVCLTVVRSGVEAG 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+  AET R+T+  +W  G  +NLER++K+GD L GH+VSGH+DG   I+  + 
Sbjct: 61  -RTWFEVDAAAETLRMTSAKNWREGGRLNLERALKIGDELGGHIVSGHVDGIATIVVREN 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L  P  L +FIA KGSV L+GVSLTVN   ++ F VL+I HT++ TT +  +
Sbjct: 120 LPDMACFELRAPRELAKFIAAKGSVTLDGVSLTVNKAVEDIFSVLIIPHTLQVTTLQGWQ 179

Query: 179 VGDLINIEVDSMMRYIARL 197
           VG  +N+E+D M RY ARL
Sbjct: 180 VGSEVNLEIDVMARYAARL 198


>gi|28894492|gb|AAO61230.1| riboflavin synthase [Bartonella elizabethae]
          Length = 177

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (65%)

Query: 18  IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNI 77
           + +GMR+++ T Y    + +G SIA +GICLTVV    +    NW+ VE W ET R+TN+
Sbjct: 4   LKQGMRVKISTRYAIESLAIGASIACSGICLTVVERGFKQEDFNWFVVEAWEETLRLTNL 63

Query: 78  ASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFI 137
           A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +      FI
Sbjct: 64  AQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEGDAIRFYLKVSRQFMPFI 123

Query: 138 AVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSM 190
             KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+GD +N+E+D +
Sbjct: 124 VSKGSVALNGTSLTVNSVEDCVFDVLIIRHTLEVTTWGEAKIGDWVNLEIDQL 176


>gi|149202383|ref|ZP_01879356.1| riboflavin synthase subunit alpha [Roseovarius sp. TM1035]
 gi|149144481|gb|EDM32512.1| riboflavin synthase subunit alpha [Roseovarius sp. TM1035]
          Length = 195

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+      +R R+ T Y+T ++ +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGRIEAVEHRGD-LRARIGTGYDTGRIDIGASIACDGVCLTVVALGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V++ AET   TN++ W  G  +NLER++++GD L GH+VSGHIDG  E++ L   G
Sbjct: 55  GWFDVDISAETLSKTNLSGWAEGRRVNLERALRVGDELGGHIVSGHIDGLAEVVGLRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    +G
Sbjct: 115 DSTRVTLRAPQALARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKSVTTWGDVAMG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E+D++ RY+ARL
Sbjct: 175 DMVNLEIDTLARYVARL 191


>gi|126727896|ref|ZP_01743724.1| riboflavin synthase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
 gi|126702837|gb|EBA01942.1| riboflavin synthase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
          Length = 204

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 126/197 (63%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+      +R R+ +SY  + + +G SIA  G+CLTVV      +  
Sbjct: 1   MFTGIITDVGRIEALENRGD-LRARLSSSYPLAGIDMGASIACDGVCLTVVGKGSTENDG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN+ +W     +NLER++K+GD L GH+VSGH+DG  EI+ +   G
Sbjct: 60  SWFDVDISAETLSKTNLHTWAEARAVNLERALKVGDELGGHIVSGHVDGLAEIIEITDEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  PH L  FIA KGSV LNG SLTVN V    F +  I HT   TTW    VG
Sbjct: 120 DSTRVTLRAPHALAGFIASKGSVALNGASLTVNDVQCTDFGINFIPHTKSVTTWGRIAVG 179

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+E+D++ RY+ARL
Sbjct: 180 DLVNLEIDTLARYVARL 196


>gi|71738255|gb|AAZ40213.1| riboflavin synthase [Bartonella sp. lm4]
          Length = 177

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/177 (49%), Positives = 117/177 (66%)

Query: 17  PIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITN 76
            + +G+RL + T Y+   +++G SIA +GICLTV+    + +  N + VE W ET  +TN
Sbjct: 1   SLKQGIRLSISTHYDVKTIEIGASIACSGICLTVIERELKQANANCFVVEAWKETLCLTN 60

Query: 77  IASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQF 136
           +A W  GTFINLERS++LGD + GHLVSGH+DG  EI+     GD++   L     L  F
Sbjct: 61  LAQWTKGTFINLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEGDAIRFYLKASVRLAPF 120

Query: 137 IAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRY 193
           IA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVGD +N+EVD +  Y
Sbjct: 121 IAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVGDQVNLEVDQLAGY 177


>gi|217978261|ref|YP_002362408.1| riboflavin synthase, alpha subunit [Methylocella silvestris BL2]
 gi|217503637|gb|ACK51046.1| riboflavin synthase, alpha subunit [Methylocella silvestris BL2]
          Length = 207

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/197 (45%), Positives = 125/197 (63%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+++D+G+I  + P     R R++ SY    + +G SIA +G CLTVV        D
Sbjct: 1   MFTGLISDVGQIAHIEPRGALRRARIICSYPFHTIAIGASIACSGPCLTVVDAGALGG-D 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EV+V AET   T  ++W  G  +NLERS+K+GD L GH+V+GH+DGT EI+++D   
Sbjct: 60  AWFEVDVAAETLARTTASAWTSGDRVNLERSLKIGDELGGHIVTGHVDGTAEIIWIDDFD 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +  P  L +FIA KGS+ L+G SLTVN V  + F VLLI HT++ TTW   + G
Sbjct: 120 GMKRFAIRAPRQLSRFIAEKGSIALDGTSLTVNAVEGDVFSVLLIPHTLKVTTWGDRRAG 179

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+EVD M RY ARL
Sbjct: 180 EAVNLEVDLMARYAARL 196


>gi|182678212|ref|YP_001832358.1| riboflavin synthase, alpha subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634095|gb|ACB94869.1| riboflavin synthase, alpha subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 202

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 124/198 (62%), Gaps = 1/198 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+++D+G++ A+    +  RLR+  SY    + LG SIA  G CLTVV   +E S +
Sbjct: 1   MFTGLISDVGEVGAVEERGQLRRLRIFCSYPAESVVLGASIACNGPCLTVVAFDQEKSSN 60

Query: 61  N-WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W+EV+V AET   T    W  GT +NLERS+K+GD L GH+V+GH+D   EI  +D  
Sbjct: 61  RIWFEVDVGAETLARTTAEHWTPGTKLNLERSLKVGDELGGHIVTGHVDAVAEITAIDDF 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                  + +P +L +FIA KGSV L+G SLTVN V  N F VLLI HT+  TTW   +V
Sbjct: 121 DGMRRFSIRVPESLARFIAEKGSVSLDGTSLTVNSVEGNVFSVLLIPHTLAVTTWGGKQV 180

Query: 180 GDLINIEVDSMMRYIARL 197
            D +N+EVD M RY ARL
Sbjct: 181 EDRVNLEVDLMARYAARL 198


>gi|149914269|ref|ZP_01902800.1| riboflavin synthase, alpha subunit [Roseobacter sp. AzwK-3b]
 gi|149811788|gb|EDM71621.1| riboflavin synthase, alpha subunit [Roseobacter sp. AzwK-3b]
          Length = 195

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 126/201 (62%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G++  +  +   +R R+ T Y+   + +G SIA  G+CLTVV         
Sbjct: 1   MFTGIITDVGQV-RLVEMRGDLRARIGTRYDMQSVDIGASIACDGVCLTVVDKGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN+  W  G  INLER++K+GD L GH+VSGH+DG  EI+ +   G
Sbjct: 55  DWFDVDISAETVSKTNVKGWTEGHRINLERALKVGDELGGHIVSGHVDGLAEIVAVRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT + TTW    VG
Sbjct: 115 DSTRVSLRAPEALAKFIAPKGSVALNGTSLTVNEVEGCTFGINFIPHTKQSTTWGQAAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D++ RY+ARL  ++
Sbjct: 175 DAVNLEIDTLARYVARLQEMS 195


>gi|296448858|ref|ZP_06890692.1| riboflavin synthase, alpha subunit [Methylosinus trichosporium
           OB3b]
 gi|296253637|gb|EFH00830.1| riboflavin synthase, alpha subunit [Methylosinus trichosporium
           OB3b]
          Length = 199

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 125/198 (63%), Gaps = 3/198 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTDIG+I+++ P  +  R+ +  SY    + LG SIA +G CLT V L  E    
Sbjct: 1   MFTGLVTDIGEIVSVEPRGELRRIAISCSYPLESIALGASIACSGPCLTAVDLRREGG-R 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL-DFI 119
             +EV+  AET   T    W +G  INLERS+K+GD L GH+V+GH+DG   IL   DF 
Sbjct: 60  TVFEVDAAAETLARTTAGQWTVGRRINLERSLKIGDELGGHIVTGHVDGVATILSREDFD 119

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S +  +  PH L +FIA KGSV L+G SLTVN V  + F VL+I HT+  TTW  ++ 
Sbjct: 120 GMSRFW-IEAPHGLARFIAEKGSVALDGTSLTVNAVEGDRFSVLIIPHTLAVTTWGEYRA 178

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD M RY ARL
Sbjct: 179 GDRLNLEVDLMARYAARL 196


>gi|188582603|ref|YP_001926048.1| riboflavin synthase, alpha subunit [Methylobacterium populi BJ001]
 gi|179346101|gb|ACB81513.1| riboflavin synthase, alpha subunit [Methylobacterium populi BJ001]
          Length = 212

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 127/204 (62%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G++++M    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSMEGSDRLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             + V+  AET   T + +W  GT INLERS+KLGD L GHLV+GH+DG  EIL  + + 
Sbjct: 60  CRFAVDAAAETLARTTVGTWREGTRINLERSLKLGDELGGHLVTGHVDGIAEILARETVT 119

Query: 120 ------GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
                 G S    L  P  L  FIA KGS+CL+G SLTVN V    F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPSALAGFIAEKGSICLDGTSLTVNAVSGADFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
           W+  + GD IN+EVD + RY ARL
Sbjct: 180 WEERRAGDRINLEVDLLARYAARL 203


>gi|312226843|gb|ADQ50167.1| riboflavin synthase C [Bartonella clarridgeiae]
          Length = 168

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 110/166 (66%)

Query: 28  TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFIN 87
           T Y+   +K+G SIA +GICLT+V  + + +  +W+ VE W E   +TN+  W  GTF+N
Sbjct: 1   THYDVESLKIGASIACSGICLTIVERALKSTATHWFAVEAWEEALCLTNLTQWTKGTFVN 60

Query: 88  LERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNG 147
           LERS++LGD + GHLV GHIDG  EI+     GD+    L +P  L  FIA KGS+ LNG
Sbjct: 61  LERSLRLGDEIGGHLVFGHIDGLAEIIEKKNEGDATRFHLQVPMQLAPFIAEKGSIALNG 120

Query: 148 VSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRY 193
            SLTVN V  N FDVL+IRHT+E T W   +VGD +N++VD + RY
Sbjct: 121 TSLTVNYVENNIFDVLIIRHTLEMTIWGQAEVGDQVNLQVDQLARY 166


>gi|84502766|ref|ZP_01000885.1| riboflavin synthase subunit alpha [Oceanicola batsensis HTCC2597]
 gi|84389161|gb|EAQ01959.1| riboflavin synthase subunit alpha [Oceanicola batsensis HTCC2597]
          Length = 198

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 127/199 (63%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +      +R R+ T+Y+TS + LG SI   G+CLTV+    +    
Sbjct: 1   MFTGIITDIGTVREVEKRGD-LRARIGTAYDTSGIDLGASICCDGVCLTVIETGAD---- 55

Query: 61  NWYEVEVWAETNRITNIA--SWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            W++VE+ AET   TNI+  +W  G  +NLER++K+GD L GH+VSGH+DG  E++ L  
Sbjct: 56  -WFDVEISAETVSKTNISHNTWDPGRRVNLERALKVGDELGGHIVSGHVDGVAELIALVD 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS       P +L +F+A KGSV LNG SLTVN V    F + +I HT   TTW   +
Sbjct: 115 DGDSTRATFRAPEDLARFVAPKGSVALNGTSLTVNDVDGAEFGINMIPHTKTVTTWGDAR 174

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD IN+E+D++ RY+ARL
Sbjct: 175 VGDRINLEIDTLARYVARL 193


>gi|110679097|ref|YP_682104.1| riboflavin synthase subunit alpha [Roseobacter denitrificans OCh
           114]
 gi|109455213|gb|ABG31418.1| riboflavin synthase, alpha subunit [Roseobacter denitrificans OCh
           114]
          Length = 197

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 116/179 (64%), Gaps = 5/179 (2%)

Query: 22  MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWG 81
           +R R+ T Y+TS + +G SIA  G+CLTVV L       +WY+V++ AET   TN+  W 
Sbjct: 21  LRARIRTGYDTSGIDMGASIASDGVCLTVVDLGP-----DWYDVQISAETVSKTNLTQWA 75

Query: 82  IGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKG 141
           +G  +NLER++++GD L GH+VSGH+DG  E++ +   GDS    L  P  L +FIA KG
Sbjct: 76  VGGRVNLERALRVGDELGGHIVSGHVDGVAEVIAVTEEGDSTRVTLRAPEALARFIAPKG 135

Query: 142 SVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYAL 200
           SV LNG SLTVN V    F +  I HT E TTW   +VGD +N+E+D++ RY+ARL  +
Sbjct: 136 SVALNGTSLTVNEVDGRDFGINFIPHTKEVTTWGGVRVGDAVNLEIDTLARYVARLAEM 194


>gi|146341343|ref|YP_001206391.1| riboflavin synthase subunit alpha [Bradyrhizobium sp. ORS278]
 gi|146194149|emb|CAL78170.1| riboflavin synthase alpha chain [Bradyrhizobium sp. ORS278]
          Length = 202

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 128/199 (64%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I+++TP  +G   RLR+ ++Y+ S +  G SIA+ G+CLTVV+ S    
Sbjct: 1   MFTGIVTDIGEIVSLTPRTEGKLHRLRIASAYDQSTIADGASIANNGVCLTVVQ-SGIAD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+  AET  +T    W +GT +NLER++K+GD L GH+VSGH+DG   I+  + 
Sbjct: 60  GKTWFEVDAAAETLALTTAKHWRVGTKLNLERALKIGDELGGHIVSGHVDGIATIVSREN 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D           L +FIA KGS+ L+GVSLTVN V +  F VL+I HT+  TT    +
Sbjct: 120 LPDMARFVFRTTRELARFIATKGSITLDGVSLTVNTVDELTFSVLIIPHTLAVTTLSSWQ 179

Query: 179 VGDLINIEVDSMMRYIARL 197
            G  +NIEVD M RY ARL
Sbjct: 180 TGSEVNIEVDLMARYAARL 198


>gi|154253351|ref|YP_001414175.1| riboflavin synthase subunit alpha [Parvibaculum lavamentivorans
           DS-1]
 gi|154157301|gb|ABS64518.1| riboflavin synthase, alpha subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 208

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 123/206 (59%), Gaps = 11/206 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+       R  + T+Y T  + +G SIA AG CLTVV    + S D
Sbjct: 1   MFTGIITDVGRIRAVEKRGD-ARFVIGTAYGTDGIDIGASIACAGCCLTVVEKGRDSSGD 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V AE+   T +  W  GT +NLER++K GD L GH+VSGH+DG   I  +   G
Sbjct: 60  -WFAVDVSAESLTCTTLGGWAEGTRVNLERALKAGDELGGHIVSGHVDGICHIREIRPEG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV---------GKNFFDVLLIRHTIEE 171
           DSM      P +L +FIA KGSV LNG SLTVN V         G   F V +I HT   
Sbjct: 119 DSMRFVFEAPGDLGRFIAPKGSVTLNGTSLTVNEVEDRKAGGNAGSTLFGVNIIPHTQAV 178

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           TTW M K GD +N+E+D + RY+ARL
Sbjct: 179 TTWGMAKAGDPVNLEIDMLARYVARL 204


>gi|90424161|ref|YP_532531.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           BisB18]
 gi|90106175|gb|ABD88212.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           BisB18]
          Length = 202

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 128/202 (63%), Gaps = 9/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+TD G+I A+TP A+G   RLR+   Y+ + +  G SIA  GICLTVV       
Sbjct: 1   MFTGIITDQGEITALTPTAQGSLHRLRIACGYDRAGIADGASIAANGICLTVV----GSG 56

Query: 59  VDN---WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
           +DN   WYEV+  AET  +T+   W +GT +NLER++K+GD L GH+V+GH+DG   ++ 
Sbjct: 57  LDNGKTWYEVDAGAETLAVTSAKHWRVGTRLNLERALKIGDELGGHIVTGHVDGIATVVS 116

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            + + +     L+   +L +FIA KGSV L+GVSLTVN      F VL+I HT+E TT  
Sbjct: 117 REELPEMARFELTTSRDLARFIAAKGSVTLDGVSLTVNTAVDTTFSVLIIPHTLEVTTLS 176

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
             + G  IN+E+D M RY ARL
Sbjct: 177 NWQPGSAINLEIDLMARYAARL 198


>gi|23008227|ref|ZP_00049760.1| COG0307: Riboflavin synthase alpha chain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 212

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 127/204 (62%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTD+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVTDVGRVVSIEGSDRLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGTG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             + V+  AET   T +++W  GT +NLERS+KLGD + GHLV+GH+DG  EIL  + + 
Sbjct: 60  CRFAVDAAAETLARTTVSAWREGTRVNLERSLKLGDEMGGHLVTGHVDGVAEILARETVT 119

Query: 120 ------GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
                 G S    L  P  L  FIA KGSVCL+G SLTVN V    F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPAALAGFIAEKGSVCLDGTSLTVNAVSGTDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
           W   + GD IN+EVD + RY ARL
Sbjct: 180 WDERRAGDRINLEVDLIARYAARL 203


>gi|159044795|ref|YP_001533589.1| riboflavin synthase subunit alpha [Dinoroseobacter shibae DFL 12]
 gi|157912555|gb|ABV93988.1| riboflavin synthase, alpha subunit [Dinoroseobacter shibae DFL 12]
          Length = 200

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 121/197 (61%), Gaps = 2/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG + A+   A  +  R+  SY    + LG SIA  G+CLTVV   ++ +  
Sbjct: 1   MFTGIITDIGTVRALEQ-AGDLHARIGCSYAPGSIALGASIACNGVCLTVVDKGQDDT-S 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V + AE+   TNI  W  G  +NLER++K+GD L GH+VSGH+DG  EI  +   G
Sbjct: 59  PWFDVTISAESVDKTNIGDWRPGARVNLERALKVGDELGGHIVSGHVDGVAEITAMAQEG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S       P  L +FIA KGSV L+G SLTVN V    F V  I HT   TTW   KVG
Sbjct: 119 ESTRVTFRAPEALARFIAPKGSVALDGTSLTVNEVDGAEFGVNFIPHTKSATTWGGVKVG 178

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+E+D++ RY+ARL
Sbjct: 179 DRINLEIDTLARYVARL 195


>gi|170750356|ref|YP_001756616.1| riboflavin synthase, alpha subunit [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656878|gb|ACB25933.1| riboflavin synthase, alpha subunit [Methylobacterium radiotolerans
           JCM 2831]
          Length = 207

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 126/202 (62%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G + +++     +R+ +  SY+ + + LG SIA AG CLT V + E  +  
Sbjct: 1   MFTGLVSDVGTVASVSGDGDLLRIAIRASYDPATIALGASIACAGPCLTAVSV-EPTAGG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL-----F 115
             + V+  AET   T + +W  GT INLERS+K+GD L GHLV+GH+DG  EI+      
Sbjct: 60  CVFAVDAAAETLARTTVGAWVAGTRINLERSLKIGDELGGHLVTGHVDGVAEIVERETVT 119

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            D  G S    L  P  L +FIA KGSVCL+G SLTVN V  + F VLLI HT++ TTW 
Sbjct: 120 ADAWGASERFTLRAPAALAKFIAEKGSVCLDGTSLTVNAVQGDLFSVLLIPHTLQVTTWG 179

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
             + GD +N+EVD + RY ARL
Sbjct: 180 ERRQGDRLNLEVDLIARYAARL 201


>gi|28894494|gb|AAO61231.1| riboflavin synthase [Bartonella vinsonii subsp. berkhoffii]
          Length = 177

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 112/176 (63%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + KG+R  + T Y    +++G SIA +GICLT+V    + S  +W+ VE W E  R+
Sbjct: 1   IQSLKKGVRFNISTRYAVESLEIGSSIACSGICLTIVERGSKQSNMSWFAVEAWEEALRL 60

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GT INLERS++LGD + GHLVSGHID   EI+     GD++   L +P    
Sbjct: 61  TNLAQWTKGTCINLERSLRLGDEMGGHLVSGHIDSLAEIIDQKNEGDAVRFFLQVPTRFT 120

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSM 190
            FI  KGS+ LNG SLTVN +    FD+L+IRHT+E TTW   K+GD +N+E+D  
Sbjct: 121 PFIVSKGSIALNGTSLTVNCIEDCIFDILIIRHTLEMTTWGQAKIGDQVNLEIDPF 176


>gi|86749754|ref|YP_486250.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris HaA2]
 gi|86572782|gb|ABD07339.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           HaA2]
          Length = 202

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 95/203 (46%), Positives = 125/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I A+TP A+G   RLR+  SY+ + +  G SIA  GIC+TVV  S    
Sbjct: 1   MFTGIVTDIGEIEALTPTAQGQLHRLRIGCSYDQATIADGASIASNGICMTVVG-SGTAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET  +T    WG+GT +NLER++K+GD L GH+V+GH+DG   ++  + 
Sbjct: 60  GRTWYEVDAGAETLALTTAKHWGVGTRLNLERALKIGDELGGHIVTGHVDGIATVVARED 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + +     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPEMARFTLETTRELARFIAPKGSVTLDGTSLTVNTVEGTRFSVLIIPHTLSATILGGWR 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           V   +NIEVD M RY ARL  + 
Sbjct: 180 VDSEVNIEVDLMARYAARLSEMK 202


>gi|225728462|gb|ACO24288.1| riboflavin synthase [Bartonella koehlerae]
          Length = 176

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSVDNWYEVEVWAETNR 73
           +  + +GMR  + T Y    +++G SIA +GICLT+V R  ++ +  NW+ VE W E  R
Sbjct: 5   VQSLKQGMRFIISTRYGIEDLEIGASIACSGICLTIVERGLKQQTKTNWFAVEAWEEALR 64

Query: 74  ITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNL 133
           +TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +  + 
Sbjct: 65  LTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKMEGDAVRFFLQVSKHF 124

Query: 134 EQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINI 185
             FIA KGS+ LNG SLTVN V  + FDVL+IRHT+E TTW   ++GDL+N+
Sbjct: 125 MPFIANKGSIALNGTSLTVNCVEDHIFDVLIIRHTLEMTTWGQAEIGDLVNL 176


>gi|163852583|ref|YP_001640626.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           PA1]
 gi|240139917|ref|YP_002964394.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           AM1]
 gi|163664188|gb|ABY31555.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           PA1]
 gi|240009891|gb|ACS41117.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           AM1]
          Length = 212

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 128/204 (62%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSVEGSERLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             + V+  AET   T + +W  GT +NLERS+KLGD L GHLV+GH+DG  EIL  + + 
Sbjct: 60  CRFSVDAAAETLARTTVGAWREGTRLNLERSLKLGDELGGHLVTGHVDGVAEILARETVT 119

Query: 120 ------GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
                 G S    L  P  L  FIA KGS+CL+G SLTVN V  + F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPAALAGFIAEKGSICLDGTSLTVNAVSGHDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
           W+  + GD IN+EVD + RY ARL
Sbjct: 180 WEERREGDRINLEVDLLARYAARL 203


>gi|85816034|gb|ABC84381.1| riboflavin synthase [Bartonella bovis]
 gi|85816038|gb|ABC84383.1| riboflavin synthase [Bartonella bovis]
 gi|85816040|gb|ABC84384.1| riboflavin synthase [Bartonella bovis]
 gi|85816046|gb|ABC84387.1| riboflavin synthase [Bartonella bovis]
          Length = 177

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (65%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + +G+RL + T Y+   +++G SIA +GICLTVV    + +  N + VE W ET  +
Sbjct: 1   IQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVVERELKQTNINCFVVEAWKETLYL 60

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTF+NLERS++LGD + GHLVSGH+D   EI+     GD++   L     L 
Sbjct: 61  TNLAKWTKGTFVNLERSLRLGDEIGGHLVSGHVDDLAEIVDQKNEGDAIRFYLKTSMRLA 120

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSM 190
            FIA KGS+ LNG SLT+N +  N FDVL+IRHT+E TTW   KVGD +N+EVD +
Sbjct: 121 PFIAEKGSIALNGTSLTINSIEDNIFDVLIIRHTLEMTTWGQAKVGDQVNLEVDQL 176


>gi|298291640|ref|YP_003693579.1| riboflavin synthase, subunit alpha [Starkeya novella DSM 506]
 gi|296928151|gb|ADH88960.1| riboflavin synthase, alpha subunit [Starkeya novella DSM 506]
          Length = 196

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 119/197 (60%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  + P     RL + + Y+T+ ++LG SIA +G+CLTVV L       
Sbjct: 1   MFTGIVTDIGTLRRVEPRNDVRRLTIASRYDTATIELGASIACSGVCLTVVALQP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EVE   ET  +T    W  G  +NLER++K+GD L GH+V GH+DG   ++  + IG
Sbjct: 56  DAFEVEAAPETLAVTTARDWTEGRRLNLERALKIGDELGGHVVQGHVDGVATVIAREDIG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++       P  L  FIAVKGSV L+G SLTVN V    F  LLI HT+  TTW     G
Sbjct: 116 ETTRFVFDAPEALAPFIAVKGSVTLDGTSLTVNEVDGTRFSCLLIPHTLAHTTWGDVHAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD M RY ARL
Sbjct: 176 DHVNIEVDMMARYAARL 192


>gi|91977145|ref|YP_569804.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           BisB5]
 gi|91683601|gb|ABE39903.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           BisB5]
          Length = 202

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 125/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  +TP+A+G   RLR++ S++ + +  G SIA  G+C+TVV  S    
Sbjct: 1   MFTGIVTDIGEIEKLTPVAQGQLHRLRILCSFDQTTIADGASIASNGVCMTVVG-SGVAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET  +T    W +GT +NLER++K+GD L GH+V+GH+DG   I   + 
Sbjct: 60  GRTWYEVDAGAETLGLTTAKHWSVGTRLNLERALKIGDELGGHIVTGHVDGIATIESREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     LS    L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLSTSRELARFIAAKGSVTLDGTSLTVNTVDDTRFSVLIIPHTLSATILSGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  +N+EVD M RY ARL  + 
Sbjct: 180 QGSEVNLEVDLMARYAARLSEMK 202


>gi|163733977|ref|ZP_02141418.1| riboflavin synthase subunit alpha [Roseobacter litoralis Och 149]
 gi|161392513|gb|EDQ16841.1| riboflavin synthase subunit alpha [Roseobacter litoralis Och 149]
          Length = 197

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 115/179 (64%), Gaps = 5/179 (2%)

Query: 22  MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWG 81
           +R R+ T Y+TS + +G SIA  G+CLTVV L  +     WY+V++ AET   TN+  W 
Sbjct: 21  LRARIRTGYDTSGIDMGASIASDGVCLTVVDLGPD-----WYDVQISAETVSKTNLTHWA 75

Query: 82  IGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKG 141
           +G  +NLER++++GD L GH+VSGH+DG  E++ +   GDS    L  P  L +FIA KG
Sbjct: 76  VGGHVNLERALRVGDELGGHIVSGHVDGVAEVVAVMDEGDSTRVTLRAPEALARFIAPKG 135

Query: 142 SVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYAL 200
           SV LNG SLTVN V    F +  I HT E TTW    VGD +N+E+D++ RY+ARL  +
Sbjct: 136 SVALNGTSLTVNEVDGRDFGINFIPHTKEVTTWGGVSVGDAVNLEIDTLARYVARLAEM 194


>gi|83951491|ref|ZP_00960223.1| riboflavin synthase subunit alpha [Roseovarius nubinhibens ISM]
 gi|83836497|gb|EAP75794.1| riboflavin synthase subunit alpha [Roseovarius nubinhibens ISM]
          Length = 195

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 125/201 (62%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD G+I  +      +R R+   Y+   + +G SIA  G+CLTVV +       
Sbjct: 1   MFTGIITDQGEIRDLEQRGD-LRARIGCHYDMDGVDMGASIACDGVCLTVVAMGA----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V+V AET   TN+ +W  G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWFDVDVSAETVSKTNLDTWAKGRTVNLERALKVGDELGGHIVSGHVDGVAEVISVKDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPKALARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKEVTTWGRVAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D++ RY+ARL+  +
Sbjct: 175 DRVNLEIDTLARYVARLHEAD 195


>gi|302382997|ref|YP_003818820.1| riboflavin synthase, subunit alpha [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193625|gb|ADL01197.1| riboflavin synthase, alpha subunit [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 196

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 122/196 (62%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG++ ++   A+  R  V T+++ S + LG SI+HAG CLTVV   E     
Sbjct: 1   MFTGIITDIGRVRSVAETARDRRYEVETAWDVSGIDLGASISHAGCCLTVVEKGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  WG GT +NLER+ K+GD L GH+VSGH+DG   ++ +   G
Sbjct: 56  GWFAVEVSGETLDKTTLGRWGTGTPVNLERATKVGDELGGHIVSGHVDGLGTVVEITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    L  P  L ++IA KGS+ ++GVSLTVN V    F + +I HT E TT     VG
Sbjct: 116 GSHRLTLEAPAPLHRYIAAKGSITVDGVSLTVNSVDGQRFGLNIIPHTWEATTLGRLSVG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E+D + RY+AR
Sbjct: 176 DPVNLEIDMLARYLAR 191


>gi|27380141|ref|NP_771670.1| riboflavin synthase subunit alpha [Bradyrhizobium japonicum USDA
           110]
 gi|27353295|dbj|BAC50295.1| riboflavin synthase alpha chain [Bradyrhizobium japonicum USDA 110]
          Length = 202

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 125/199 (62%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTD+G+I++ TP A+G   RLR+  SY+ + +  G SIA  G+CLTVV  S    
Sbjct: 1   MFTGIVTDLGEIVSFTPTAQGQLHRLRIACSYDQTTIADGASIACNGVCLTVV-ASGVAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W++V+  AET  +T    W +GT +NLER++K+GD L GH+V+GH DG   I+  + 
Sbjct: 60  GKAWFDVDAAAETLALTTAKHWRVGTRLNLERALKIGDELGGHIVAGHADGIATIVSRED 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     LS    L +FIA KGS+ L+GVSLTVN V    F VL+I HT+  TT    K
Sbjct: 120 LPDMARFVLSTTRELARFIATKGSITLDGVSLTVNTVADVTFSVLIIPHTLTVTTIGGWK 179

Query: 179 VGDLINIEVDSMMRYIARL 197
            G  +NIEVD M RY ARL
Sbjct: 180 AGAEVNIEVDLMARYAARL 198


>gi|218531423|ref|YP_002422239.1| riboflavin synthase, subunit alpha [Methylobacterium
           chloromethanicum CM4]
 gi|218523726|gb|ACK84311.1| riboflavin synthase, alpha subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 212

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 128/204 (62%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSVEGSERLRRIVIESAYDPAGIALGASIACSGPCLTAVTV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             + V+  AET   T + +W  GT +NLERS+KLGD L GHLV+GH+DG  EIL  + + 
Sbjct: 60  CRFSVDAAAETLARTTVGAWREGTRLNLERSLKLGDELGGHLVTGHVDGVAEILVRETVT 119

Query: 120 ------GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
                 G +    L  P  L  FIA KGS+CL+G SLTVN V  + F VLLI H++  TT
Sbjct: 120 GEDNPWGATERFTLRAPAALAGFIAEKGSICLDGTSLTVNAVSGHDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
           W+  + GD IN+EVD + RY ARL
Sbjct: 180 WEDRREGDRINLEVDLLARYAARL 203


>gi|192291383|ref|YP_001991988.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           TIE-1]
 gi|192285132|gb|ACF01513.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 202

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 124/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  + P+A+G   RLR+  +Y+ + +  G SIA  GIC+TVV  S    
Sbjct: 1   MFTGIVTDIGEIETVKPVAQGQLHRLRIRCAYDQTTIADGASIASNGICMTVVG-SGTAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET   T   +W  GT +NLER++K+GD L GH+V+GH+DG  +++  + 
Sbjct: 60  GKTWYEVDAGAETLAKTTAKAWTAGTRLNLERALKIGDELGGHIVTGHVDGIAKVVAREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLETSRELARFIAPKGSVTLDGTSLTVNTVEDTKFSVLIIPHTLSATILGGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG  +NIEVD M RY ARL  + 
Sbjct: 180 VGSEVNIEVDLMARYAARLSEMK 202


>gi|39935794|ref|NP_948070.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           CGA009]
 gi|39649647|emb|CAE28169.1| riboflavin synthase alpha chain [Rhodopseudomonas palustris CGA009]
          Length = 202

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 124/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  + P+A+G   RLR+  +Y+ S +  G SIA  GIC+TVV  S    
Sbjct: 1   MFTGIVTDIGEIETVKPVAQGQLHRLRIRCAYDQSTIADGASIASNGICMTVVG-SGTAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET   T   +W  GT +NLER++K+GD L GH+V+GH+DG  +++  + 
Sbjct: 60  GKTWYEVDAGAETLAKTTAKAWIAGTRLNLERALKIGDELGGHIVTGHVDGIAKVVAREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLETSRELARFIAPKGSVTLDGTSLTVNTVEDTKFSVLIIPHTLSATILGGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG  +NIEVD M RY ARL  + 
Sbjct: 180 VGSEVNIEVDLMARYAARLSEMK 202


>gi|148255995|ref|YP_001240580.1| riboflavin synthase subunit alpha [Bradyrhizobium sp. BTAi1]
 gi|146408168|gb|ABQ36674.1| riboflavin synthase alpha chain [Bradyrhizobium sp. BTAi1]
          Length = 202

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 125/199 (62%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I+++TP  +G   RLR+  SY+ + +  G SIA+ G+CLTVV+ S    
Sbjct: 1   MFTGIVTDIGEIVSLTPRTEGKLHRLRIACSYDQATIADGASIANNGVCLTVVQ-SGVLD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+  AET  +T    W +GT +NLER++K+GD L GH+VSGH+DG   I+  + 
Sbjct: 60  GKTWFEVDAAAETLALTTARHWRVGTRLNLERALKIGDELGGHIVSGHVDGIATIVSREN 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D           L +FIA KGS+ L+GVSLTVN V    F VL+I HT+  TT     
Sbjct: 120 LPDMARFVFKTTRELARFIATKGSITLDGVSLTVNTVDDLTFSVLIIPHTLSVTTLSSWH 179

Query: 179 VGDLINIEVDSMMRYIARL 197
            G  +NIEVD M RY ARL
Sbjct: 180 AGSDVNIEVDLMARYAARL 198


>gi|94503763|gb|ABF29692.1| riboflavin synthase [Bartonella sp. TR-77]
          Length = 177

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 113/176 (64%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + +G+RL + T Y+   +++G SIA +GICLTV+         N + VE W E   +
Sbjct: 2   IQSLKQGVRLSISTHYDVENIEIGASIACSGICLTVIERKLNQMNTNCFVVEAWKEALCL 61

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTFINLERS++LGD + GHLV GH+DG  EI+     GD++   L +   L 
Sbjct: 62  TNLAQWTKGTFINLERSLRLGDEIGGHLVFGHVDGLAEIVDQKNEGDAIRFYLKVSERLA 121

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSM 190
            FIA KGS+ LNG SLTVN    N FDVL+IRHT+E TTW   KVGD +N+EVD +
Sbjct: 122 PFIAEKGSIALNGTSLTVNCTENNVFDVLIIRHTLEMTTWGQAKVGDQMNLEVDQL 177


>gi|254562341|ref|YP_003069436.1| riboflavin synthase subunit alpha [Methylobacterium extorquens DM4]
 gi|254269619|emb|CAX25590.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           DM4]
          Length = 212

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 127/204 (62%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSVEGSERLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             + V+  AET   T + +W  GT +NLERS+KLGD L GHLV+GH+DG  EIL  + + 
Sbjct: 60  CRFSVDAAAETLARTTVGAWREGTRLNLERSLKLGDELGGHLVTGHVDGVAEILARETVT 119

Query: 120 ------GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
                 G S    L  P  L   IA KGS+CL+G SLTVN V  + F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPAALAGLIAEKGSICLDGTSLTVNAVSGHDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
           W+  + GD IN+EVD + RY ARL
Sbjct: 180 WEDRREGDRINLEVDLLARYAARL 203


>gi|77464334|ref|YP_353838.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides 2.4.1]
 gi|221640220|ref|YP_002526482.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides KD131]
 gi|77388752|gb|ABA79937.1| Lumazine-binding protein [Rhodobacter sphaeroides 2.4.1]
 gi|221161001|gb|ACM01981.1| Riboflavin synthase, alpha subunit [Rhodobacter sphaeroides KD131]
          Length = 198

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 120/197 (60%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV+DIG+++ +      +R R+ T+Y+   + +G SIA  G+CLTVV    E S  
Sbjct: 1   MFTGIVSDIGRVLELERTGD-LRARIATAYDVEAIDIGASIACDGVCLTVVATGTEPSA- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V +  ET   T I  W  G  INLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 59  -WFDVNISGETLSKTVIGDWEPGRRINLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSLRVTFRAPEALARFIAPKGSVALNGTSLTVNEVDGAEFGINFIPHTQEVTTWSGIAPG 177

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E+D++ RY+ARL
Sbjct: 178 LRVNLEIDTLARYVARL 194


>gi|92117362|ref|YP_577091.1| riboflavin synthase subunit alpha [Nitrobacter hamburgensis X14]
 gi|91800256|gb|ABE62631.1| riboflavin synthase, alpha subunit [Nitrobacter hamburgensis X14]
          Length = 202

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 123/199 (61%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  +T  A+G   RLR++  Y+ S + +G SIA  G+CLT V  S    
Sbjct: 1   MFTGIVTDIGEIENLTQTAQGRLHRLRILCRYDQSTIAVGASIACNGVCLTTV-ASGVAD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W++V+V AET  +T    W  GT +NLER++K+GD L GH+V+GH DG   I+  D 
Sbjct: 60  GRTWFDVDVGAETLDVTTAKHWAAGTRLNLERALKIGDELGGHIVAGHADGIAAIVARDD 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +       L    +L +FIA KGSV L+GVSLTVN V    F VL+I HT+  TT  + +
Sbjct: 120 LHGMARFELRTNRDLARFIAAKGSVTLDGVSLTVNTVRDEAFSVLIIPHTLSSTTLSVWR 179

Query: 179 VGDLINIEVDSMMRYIARL 197
            G  +NIEVD M RY ARL
Sbjct: 180 AGSEVNIEVDMMARYAARL 198


>gi|332559226|ref|ZP_08413548.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides WS8N]
 gi|332276938|gb|EGJ22253.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides WS8N]
          Length = 198

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 120/197 (60%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV+DIG+++ +      +R R+ T+Y+   + +G SIA  G+CLTVV    E S  
Sbjct: 1   MFTGIVSDIGRVLELERTGD-LRARIATAYDVQAIDIGASIACDGVCLTVVATGTEPSA- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V +  ET   T I  W  G  INLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 59  -WFDVNISGETLSKTVIGDWEPGRRINLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSVRVTFRAPEALARFIAPKGSVALNGTSLTVNEVDGAEFGINFIPHTQEVTTWSGIAPG 177

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E+D++ RY+ARL
Sbjct: 178 LRVNLEIDTLARYVARL 194


>gi|316934110|ref|YP_004109092.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris DX-1]
 gi|315601824|gb|ADU44359.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 202

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 123/203 (60%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  + P+A+G   RLR+  +Y+ S +  G SIA  GIC+TVV    E  
Sbjct: 1   MFTGIVTDIGEIETVRPVAQGQLHRLRIRCAYDQSTIVDGASIASNGICMTVVGSGTEGG 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET   T   +W  GT +NLER++K+GD L GH+V+GH+DG  +++  + 
Sbjct: 61  -RTWYEVDAGAETLAKTTAKAWSAGTRLNLERALKIGDELGGHIVTGHVDGIAKVVAREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLEASRELARFIAPKGSVTLDGTSLTVNTVEDTKFTVLIIPHTLSATILGGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           V   +NIEVD M RY ARL  + 
Sbjct: 180 VDSEVNIEVDLMARYAARLSEMK 202


>gi|126463177|ref|YP_001044291.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104841|gb|ABN77519.1| riboflavin synthase, alpha subunit [Rhodobacter sphaeroides ATCC
           17029]
          Length = 198

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/197 (44%), Positives = 120/197 (60%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV+DIG+++ +      +R R+ T+Y+   + +G SIA  G+CLTVV    E S  
Sbjct: 1   MFTGIVSDIGRVLELERTGD-LRARIATAYDVEAIDIGASIACDGVCLTVVATGTEPSA- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V +  ET   T I  W  G  +NLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 59  -WFDVNISGETLSKTVIGDWEPGRRVNLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSLRVTFRAPEALARFIAPKGSVALNGTSLTVNEVDGAEFGINFIPHTQEVTTWSGIAPG 177

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E+D++ RY+ARL
Sbjct: 178 LRVNLEIDTLARYVARL 194


>gi|220925140|ref|YP_002500442.1| riboflavin synthase subunit alpha [Methylobacterium nodulans ORS
           2060]
 gi|219949747|gb|ACL60139.1| riboflavin synthase, alpha subunit [Methylobacterium nodulans ORS
           2060]
          Length = 213

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 129/205 (62%), Gaps = 9/205 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G++IA+    +  R+ + ++Y+ + + LG SIA +G CLT V +   H   
Sbjct: 1   MFTGLVSDVGRVIAVEGGERLRRITIESAYDPATIALGASIACSGPCLTAVEVVP-HGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             + V+  AET   T +  WG GT +NLERS+++GD L GHLV+GH+DG  EI+  + + 
Sbjct: 60  CRFSVDAAAETLARTTVGRWGPGTRVNLERSLRMGDELGGHLVTGHVDGLAEIVAREAVT 119

Query: 120 GD-------SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
           GD       S    L  P +L +FIA KGSV L+G SLTVN V  + F +LLI HT+  T
Sbjct: 120 GDGSDGWAPSDRFVLRAPASLSRFIAEKGSVSLDGTSLTVNGVEGDTFTILLIPHTLAVT 179

Query: 173 TWKMHKVGDLINIEVDSMMRYIARL 197
           TW   +VGD +N+EVD + RY ARL
Sbjct: 180 TWGERRVGDAVNLEVDLIARYAARL 204


>gi|315499925|ref|YP_004088728.1| riboflavin synthase, alpha subunit [Asticcacaulis excentricus CB
           48]
 gi|315417937|gb|ADU14577.1| riboflavin synthase, alpha subunit [Asticcacaulis excentricus CB
           48]
          Length = 196

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 125/196 (63%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG + A+     G R  V T+Y+ S + +G S+AH+G CLTVV    +    
Sbjct: 1   MFTGIITDIGTLTAIDRHEGGARFEVQTAYDLSTVDIGASVAHSGCCLTVVEKRGDR--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y +++  ET  +T + +W +G  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 58  --YTLDLSNETLAVTTLDNWRVGDRVNLERALKVGDELGGHIVSGHVDGVGELIALTEDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   ++ +P  L ++IA KGS+ L+G+SLTVN V  + F V +I HT   TT    KVG
Sbjct: 116 DAYRLKVRVPRPLHRYIAHKGSIALDGISLTVNEVEDDVFGVAIIPHTWTHTTLSDRKVG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E+D M RY AR
Sbjct: 176 DKLNLEIDLMARYAAR 191


>gi|146276469|ref|YP_001166628.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554710|gb|ABP69323.1| riboflavin synthase, alpha subunit [Rhodobacter sphaeroides ATCC
           17025]
          Length = 198

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/198 (44%), Positives = 123/198 (62%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIVTDIG+++ +    +G +R R+ T Y    + +G SIA  G+CLTVV  +   + 
Sbjct: 1   MFTGIVTDIGRVLELE--CRGDLRARIATGYRVETIDIGASIACDGVCLTVV--ATGTAP 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +NW+EV +  ET   T +  W +G  +NLER++K+GD L GH+VSGH+DG  E++     
Sbjct: 57  ENWFEVNISGETLSKTVLGGWQVGHRVNLERALKVGDELGGHIVSGHVDGVAEVVRAVPE 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GDS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     
Sbjct: 117 GDSLRVTFRAPEALARFIAPKGSVALNGTSLTVNEVEGAEFGINFIPHTQEVTTWGGIAP 176

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D++ RY+ARL
Sbjct: 177 GLRVNLEIDTLARYVARL 194


>gi|225728469|gb|ACO24291.1| riboflavin synthase [Bartonella henselae]
          Length = 144

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (70%)

Query: 54  SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
           S++ +  NW+ VE W E  R+TN+  W  GTFINLERS++LGD + GHLVSGHIDG  EI
Sbjct: 1   SKQQAKINWFAVEAWEEALRLTNLTQWTKGTFINLERSLRLGDEMGGHLVSGHIDGLAEI 60

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
           +     GD++   L +P     FI  KGS+ LNG SLTVN V ++ FDVL+IRHT+E TT
Sbjct: 61  IDQKSEGDAVRFFLQVPKRFIPFIVNKGSIALNGTSLTVNCVEEHIFDVLIIRHTLEMTT 120

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
           W+  K+GDL+N+E+D + RY+ARL
Sbjct: 121 WRQAKIGDLVNLEIDQLARYVARL 144


>gi|115524817|ref|YP_781728.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           BisA53]
 gi|115518764|gb|ABJ06748.1| Lumazine-binding protein [Rhodopseudomonas palustris BisA53]
          Length = 202

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 122/199 (61%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+TD G+IIA+TP  +G   RLR+   Y+   +  G SIA  GICLTVV    +  
Sbjct: 1   MFTGIITDQGEIIALTPTVQGNLHRLRIACGYDRVTIADGASIAANGICLTVVGTGVDAG 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET  +T    WG+GT +NLER++K+GD L GH+V+GH+DG   +     
Sbjct: 61  -RTWYEVDAGAETLAMTTAKHWGVGTRLNLERALKIGDELGGHIVTGHVDGVAMVTERRE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +   +   L  P +L +FIA KGSV L+GVSLTVN V    F VL+I HT+  TT    +
Sbjct: 120 LEGMVRFELDAPRDLARFIATKGSVTLDGVSLTVNSVEDTKFSVLIIPHTLAVTTLNGWR 179

Query: 179 VGDLINIEVDSMMRYIARL 197
               IN+E+D M RY ARL
Sbjct: 180 TVGEINLEIDLMARYAARL 198


>gi|119384297|ref|YP_915353.1| riboflavin synthase subunit alpha [Paracoccus denitrificans PD1222]
 gi|119374064|gb|ABL69657.1| riboflavin synthase, alpha subunit [Paracoccus denitrificans
           PD1222]
          Length = 197

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 126/199 (63%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG++ +   +   MR R+   Y  + + LG SIA  GICLTVV   E+ S  
Sbjct: 1   MFTGIITDIGEV-SRVEMRGDMRARISCHYEMAGVDLGASIACDGICLTVV---EKGS-- 54

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +W++V++ AET   TNI +  W  G  +NLER++++GD L GH+VSGH+DG   I  +  
Sbjct: 55  DWFDVDISAETISKTNIGANGWAPGRRLNLERALRVGDELGGHIVSGHVDGVAVIEEMRD 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P  L +FIA KGSV LNG SLTVN V  + F V +I HT   TTW   +
Sbjct: 115 EGDSTRITLRAPEALARFIAPKGSVALNGTSLTVNEVEGDRFGVNVIPHTQAATTWGEVQ 174

Query: 179 VGDLINIEVDSMMRYIARL 197
            GD +N+E+D++ RY+ARL
Sbjct: 175 AGDEVNLEIDTLARYVARL 193


>gi|329889481|ref|ZP_08267824.1| riboflavin synthase, alpha subunit [Brevundimonas diminuta ATCC
           11568]
 gi|328844782|gb|EGF94346.1| riboflavin synthase, alpha subunit [Brevundimonas diminuta ATCC
           11568]
          Length = 196

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 122/196 (62%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG++ ++    +  R  V T ++T+ + LG SI+HAG CLTV    E     
Sbjct: 1   MFTGIVTDIGRVRSVRETNRDRRYEVETVWDTATIDLGASISHAGCCLTVTEKGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  W   T +NLER+ KLGD L GH+VSGH+DG  E++ +   G
Sbjct: 56  GWFAVEVSGETLSKTKLGDWTENTRVNLERAAKLGDELGGHIVSGHVDGLGEVVSITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    +  P  L +FIA KGS+ ++GVSLTVN V +  FDV +I HT + TT    KVG
Sbjct: 116 GSHRIVIEAPAPLHRFIAPKGSITVDGVSLTVNGVHERRFDVNIIPHTWDATTLGGLKVG 175

Query: 181 DLINIEVDSMMRYIAR 196
           + +N+E+D + RY+AR
Sbjct: 176 ERVNLEIDMLARYLAR 191


>gi|158422888|ref|YP_001524180.1| riboflavin synthase alpha chain [Azorhizobium caulinodans ORS 571]
 gi|158329777|dbj|BAF87262.1| riboflavin synthase alpha chain [Azorhizobium caulinodans ORS 571]
          Length = 203

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 117/197 (59%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I+ +    +     + T Y  S + +G SIA +G+CLTV ++ +     
Sbjct: 1   MFTGIVTDLGEIVDLEVHNEVRTFGIATDYKPSSIDIGASIACSGVCLTVTKVKKRGPKR 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET  IT +A W  G  INLERS+ +G  L GHLV+GH+DG   ++  D   
Sbjct: 61  AVFYVDAAPETLAITTVAKWREGARINLERSLTIGGELGGHLVTGHVDGIARVVARDDFE 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++       P  L +FIA KGSVCL+G SLTVN V  N F  LLI HT+  TTW + +  
Sbjct: 121 ETSRFTFEAPEPLARFIAAKGSVCLDGTSLTVNTVKGNRFSCLLIPHTLAVTTWGVVQAE 180

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+EVD M RY ARL
Sbjct: 181 DEINLEVDLMARYAARL 197


>gi|197105133|ref|YP_002130510.1| riboflavin synthase, alpha subunit [Phenylobacterium zucineum HLK1]
 gi|196478553|gb|ACG78081.1| riboflavin synthase, alpha subunit [Phenylobacterium zucineum HLK1]
          Length = 196

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 121/196 (61%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++ ++    +  R  + T+++TS + +G S++HAG CLT+V         
Sbjct: 1   MFTGIVTDVGRVRSVRETNRDRRFEIETAFDTSTLDIGASVSHAGCCLTIVEKG-----P 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  W +G  +NLER+ ++GD L GH+VSGH+DG  E++ ++  G
Sbjct: 56  GWFAVEVSGETLSRTTLDQWAVGRRVNLERAARVGDELGGHIVSGHVDGVGEVVSVESEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R+  P  L ++IA KGS+ + GVSLTVN V  + F V LI HT E TT      G
Sbjct: 116 GSHRVRIRAPRPLHRYIAEKGSIAVEGVSLTVNEVEDDVFGVNLIPHTWEVTTLGELAPG 175

Query: 181 DLINIEVDSMMRYIAR 196
             +N+E+D + RY+AR
Sbjct: 176 GRVNLEIDMLARYLAR 191


>gi|85816042|gb|ABC84385.1| riboflavin synthase [Bartonella bovis]
 gi|85816044|gb|ABC84386.1| riboflavin synthase [Bartonella bovis]
 gi|85816048|gb|ABC84388.1| riboflavin synthase [Bartonella bovis]
          Length = 167

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%)

Query: 20  KGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIAS 79
           +G+RL + T Y+   +++G SIA +GICLTVV    + +  N + VE W ET  +TN+A 
Sbjct: 2   QGIRLSISTHYDVETIEIGASIACSGICLTVVERELKQTNINCFVVEAWKETLYLTNLAK 61

Query: 80  WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAV 139
           W  GTF+NLERS++LGD + GHLVSGH+D   EI+     GD++   L     L  FIA 
Sbjct: 62  WTKGTFVNLERSLRLGDEIGGHLVSGHVDDLAEIVDQKNEGDAIRFYLKTSMRLAPFIAE 121

Query: 140 KGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINI 185
           KGS+ LNG SLT+N +  N FDVL+IRHT+E TTW   KVGD +N+
Sbjct: 122 KGSIALNGTSLTINSIEDNIFDVLIIRHTLEMTTWGQAKVGDQVNL 167


>gi|218661904|ref|ZP_03517834.1| riboflavin synthase subunit alpha [Rhizobium etli IE4771]
          Length = 149

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%)

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G  INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 7   RWFEVEAWEEALRLTTIGTWRAGRRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 66

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   + G
Sbjct: 67  DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERQAG 126

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 127 DFVNFEVDTMARYAARLAEFPSA 149


>gi|209964641|ref|YP_002297556.1| riboflavin synthase subunit alpha [Rhodospirillum centenum SW]
 gi|209958107|gb|ACI98743.1| riboflavin synthase, alpha subunit [Rhodospirillum centenum SW]
          Length = 196

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G + A+       R  + T Y+T+ + LG SIA  G CLTVV L     + 
Sbjct: 1   MFTGIITDVGHVAAIERRGD-TRFTIGTRYDTAAIDLGASIACNGCCLTVVEL-----LP 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET   T +  W +GT +NLER+++LGD L GH+VSGH+DG  E+L +   G
Sbjct: 55  GAFRVDASGETLSKTTLGDWQVGTPVNLERALRLGDELGGHIVSGHVDGVAEVLSVVPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS   R  +P  L +FIA KGSV L+GVSLTVN V    F V +I HT   TT+   + G
Sbjct: 115 DSTRWRFRVPDALARFIAPKGSVALDGVSLTVNEVDGPVFGVNIIPHTRAHTTFGTLRPG 174

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RY+ARL
Sbjct: 175 GRVNMEVDMLARYVARL 191


>gi|296532917|ref|ZP_06895578.1| riboflavin synthase subunit alpha [Roseomonas cervicalis ATCC
           49957]
 gi|296266747|gb|EFH12711.1| riboflavin synthase subunit alpha [Roseomonas cervicalis ATCC
           49957]
          Length = 207

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 122/200 (61%), Gaps = 8/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+T  G++  + P+  G  +R++ +      +  ++G SIA +G CLTVV L E  
Sbjct: 1   MFTGIITAQGEVAEIAPLGAGQDMRLVLATPQGWLAGAEIGASIACSGCCLTVVALEESR 60

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                + VEV AET   T +A W  GT +NLER++K+GD + GH+VSGH+DG  E+L + 
Sbjct: 61  -----FAVEVSAETLSKTTLARWRPGTVLNLERALKMGDEMGGHVVSGHVDGLGEVLSVA 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S+  ++ LP  L +F+A KGSV + GVSLTVN V    F V LI HT E TT    
Sbjct: 116 PENGSLRIQVRLPPELARFVAPKGSVTMEGVSLTVNEVQGLIFGVNLIPHTAEVTTLGRL 175

Query: 178 KVGDLINIEVDSMMRYIARL 197
             GD +NIE+D + RY+ARL
Sbjct: 176 AAGDAVNIEIDMLARYVARL 195


>gi|126636173|gb|ABO25737.1| riboflavin synthase [Bartonella bovis]
          Length = 159

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 106/158 (67%)

Query: 35  MKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKL 94
           +++G SIA +GICLTVV    + +  N + VE W ET  +TN+A W  GTF+NLERS++L
Sbjct: 2   IEIGASIACSGICLTVVERELKQTNINCFVVEAWKETLYLTNLAKWTKGTFVNLERSLRL 61

Query: 95  GDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNL 154
           GD + GHLVSGH+D   EI+     GD++   L     L  FIA KGS+ LNG SLT+N 
Sbjct: 62  GDEIGGHLVSGHVDDLAEIVDQKNEGDAIRFYLKTSMRLAPFIAEKGSIALNGTSLTINS 121

Query: 155 VGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMR 192
           +  N FDVL+IRHT+E TTW   KVGD +N+EVD + R
Sbjct: 122 IEDNIFDVLIIRHTLEMTTWGQAKVGDQVNLEVDQLAR 159


>gi|254419910|ref|ZP_05033634.1| riboflavin synthase, alpha subunit [Brevundimonas sp. BAL3]
 gi|196186087|gb|EDX81063.1| riboflavin synthase, alpha subunit [Brevundimonas sp. BAL3]
          Length = 196

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 118/196 (60%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG++  +    +  R  + T+++ S + LG SI+HAG CLTV     E   D
Sbjct: 1   MFTGIVTDIGRVRDVRETERDRRYEIQTAWDVSGIDLGASISHAGCCLTVT----EKGTD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  W  G  INLER+ KLGD + GH+VSGH+DG   ++ +   G
Sbjct: 57  -WFAVEVSNETLSKTTLGGWKAGDGINLERAAKLGDEMGGHVVSGHVDGLGRVVSITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    +  P  L ++IA KGS+ ++GVSLTVN V    F + +I HT + TT    K G
Sbjct: 116 GSHRLEVEAPAPLHRYIAAKGSITVDGVSLTVNSVAGQVFSLNIIPHTWDVTTLGRLKAG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E+D + RY+AR
Sbjct: 176 DPVNLEIDMLARYLAR 191


>gi|56551371|ref|YP_162210.1| riboflavin synthase subunit alpha [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761017|ref|ZP_04759106.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753017|ref|YP_003225910.1| riboflavin synthase subunit alpha [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542945|gb|AAV89099.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374636|gb|EER64097.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552380|gb|ACV75326.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 206

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 125/204 (61%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+I ++T      R+R+ T Y    +  G SIA +G+CLTVV   +  +  
Sbjct: 1   MFTGIVTDIGEITSVTQEGD-RRIRIATEYPMDTVPTGSSIACSGVCLTVV--DKGTTPR 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EV V  E+   T    W  G  +NLER++K+GD L GH+V+GH+DG  +++ +  +G
Sbjct: 58  NWFEVTVSGESVSRTAPGRWEKGQKLNLERALKIGDELGGHIVTGHVDGIGKVVSITAVG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
           DS    +     +   IA KGSV L+GVSLTVN V    GK  F + +I HT E+TT   
Sbjct: 118 DSHNFLIEAGPEVAPHIAEKGSVSLDGVSLTVNEVKDVDGKVLFSINIIPHTAEKTTLGD 177

Query: 177 HKVGDLINIEVDSMMRYIARLYAL 200
            K GD +NIE+D + RY+AR+ AL
Sbjct: 178 LKAGDFVNIEIDVLSRYLARMNAL 201


>gi|144897825|emb|CAM74689.1| riboflavin synthase, alpha subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 197

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 87/198 (43%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIA-KGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIVTD+G I  +   A K  R  + T+Y+ + + +G SIAH G+CLT+V    +   
Sbjct: 1   MFTGIVTDLGAIRRVVRNAGKETRFEINTAYDLNGIDIGASIAHNGVCLTIVDKGAD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             WY VEV AE+   T +  W  G  INLER++K+GD L GH+VSGH+DG   ++ +   
Sbjct: 58  --WYAVEVSAESISKTTLGDWVEGGRINLERAMKVGDELGGHIVSGHVDGVATVVSITDE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +S       P NL +F+A KGSV L+GVSLTVN V    F + +I HT   TT+   + 
Sbjct: 116 NESKRFVFEAPENLAKFVAPKGSVALDGVSLTVNEVDGRRFGINVIPHTQAVTTFGRLRQ 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+E+D + RY+ARL
Sbjct: 176 GDRVNMEIDMLARYVARL 193


>gi|170741290|ref|YP_001769945.1| riboflavin synthase subunit alpha [Methylobacterium sp. 4-46]
 gi|168195564|gb|ACA17511.1| riboflavin synthase, alpha subunit [Methylobacterium sp. 4-46]
          Length = 211

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 124/204 (60%), Gaps = 15/204 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT---SYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTG+V+D+G++IA   +  G RLR +T    Y+ + + +G SIA +G CLT V +  + 
Sbjct: 1   MFTGLVSDVGRVIA---VEGGDRLRRITIACGYDPATIAVGASIACSGPCLTAVEIVPQE 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                + V+  AET   T   +W  GT +NLERS+++GD L GHLV+GH+DG  EIL  +
Sbjct: 58  G-GCRFTVDAAAETLARTTAGAWQPGTRLNLERSLRMGDELGGHLVTGHVDGLAEILARE 116

Query: 118 FI----GDSMYCR----LSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTI 169
            +    GD+        L  P +L +FIA KGSV L+G SLTVN V  + F VLLI HT+
Sbjct: 117 AVTGGEGDASAASDRFVLRAPPDLARFIAEKGSVSLDGTSLTVNGVAGDTFTVLLIPHTL 176

Query: 170 EETTWKMHKVGDLINIEVDSMMRY 193
             TTW   + GD +N+EVD + RY
Sbjct: 177 AATTWGERRAGDRVNLEVDLIARY 200


>gi|83593159|ref|YP_426911.1| riboflavin synthase subunit alpha [Rhodospirillum rubrum ATCC
           11170]
 gi|83576073|gb|ABC22624.1| Lumazine-binding protein [Rhodospirillum rubrum ATCC 11170]
          Length = 196

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI++D+G +  +T  A   RL   T+Y T  + +G SIA +G CLTV+         
Sbjct: 1   MFTGIISDLGAVREITQ-AGDTRLTFSTAYETEGVAIGASIACSGCCLTVIDKGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+   ET   T +  W +G+ +N ER++ +GD L GH+VSGH+DG  E+L +   G
Sbjct: 55  GWFAVQASGETLSKTTLGLWTVGSPVNFERALAVGDELGGHIVSGHVDGVAEVLEVAPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   R  +P +L++FIA KGSV ++GVSLTVN V    F V +I HT + TT+     G
Sbjct: 115 ESHRFRFRVPEDLKKFIAPKGSVAIDGVSLTVNEVEGAVFGVNIIPHTFQATTFGRLAPG 174

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E+D + RY+ARL
Sbjct: 175 SRVNMEIDMLARYVARL 191


>gi|126636175|gb|ABO25738.1| riboflavin synthase [Bartonella bovis]
          Length = 161

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 105/160 (65%)

Query: 22  MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWG 81
           +RL + T Y+   +++G SIA +GICLTVV    + +  N + VE W ET  +TN+A W 
Sbjct: 1   IRLSISTHYDVETIEIGASIACSGICLTVVERELKQTNINCFVVEAWKETLYLTNLAKWT 60

Query: 82  IGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKG 141
            GTF+NLERS++LGD + GHLVSGH+D   EI+     GD++   L     L  FIA KG
Sbjct: 61  KGTFVNLERSLRLGDEIGGHLVSGHVDDLAEIVDQKNEGDAIRFYLKTSMRLAPFIAEKG 120

Query: 142 SVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           S+ LNG SLT+N +  N FDVL+IRHT+E TTW   KVGD
Sbjct: 121 SIALNGTSLTINSIEDNIFDVLIIRHTLEMTTWGQAKVGD 160


>gi|329850575|ref|ZP_08265420.1| riboflavin synthase, alpha subunit [Asticcacaulis biprosthecum C19]
 gi|328840890|gb|EGF90461.1| riboflavin synthase, alpha subunit [Asticcacaulis biprosthecum C19]
          Length = 192

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 119/187 (63%), Gaps = 5/187 (2%)

Query: 12  IIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAET 71
           + A+     G+RL +   ++ + + LG SI+HAG CLTVV + E+      Y+++V  ET
Sbjct: 1   MAALERSPGGVRLTMKVGFDLTDVALGASISHAGCCLTVVAIRED-----GYDLDVSNET 55

Query: 72  NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPH 131
            ++TN+ +W IGT +NLER++K+GD L GH+VSGH+DG  E++ +   GDS   +   P 
Sbjct: 56  LQVTNLNTWEIGTQVNLERALKIGDELGGHIVSGHVDGLGELVSVTQDGDSYRLKFRAPA 115

Query: 132 NLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMM 191
            L +FIA KGSV L+G+SLTVN V  + F V +I HT   TT    KVG  +N+EVD + 
Sbjct: 116 PLHRFIAPKGSVALDGISLTVNEVEGDLFGVNIIPHTWHYTTLSQTKVGGHVNLEVDRLA 175

Query: 192 RYIARLY 198
           RY AR +
Sbjct: 176 RYAARWF 182


>gi|288957858|ref|YP_003448199.1| riboflavin synthase alpha chain [Azospirillum sp. B510]
 gi|288910166|dbj|BAI71655.1| riboflavin synthase alpha chain [Azospirillum sp. B510]
          Length = 195

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G++ A+       R  + T+++T  + +G SIAH G+CLTV+         
Sbjct: 1   MFTGIITDVGRVRAVERQGD-TRFTIETAFDTETIAIGASIAHNGVCLTVIEKGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y ++   ET   T +  W  GT +NLER++K+GD L GH+VSGH+DG   ++ +   G
Sbjct: 55  GTYVIQASGETLSKTTLDGWEPGTRVNLERALKVGDELGGHIVSGHVDGVGRLVSVRPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S+      P  L ++IA KGSV ++GVSLTVN V  N F V +I HT   TT+     G
Sbjct: 115 ESLRLTFEAPATLAKYIASKGSVAIDGVSLTVNEVEGNRFGVNIIPHTQTATTFGGLTEG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY+ARL
Sbjct: 175 DAVNLEIDMLARYVARL 191


>gi|162139844|ref|YP_318337.2| riboflavin synthase subunit alpha [Nitrobacter winogradskyi Nb-255]
          Length = 209

 Score =  154 bits (388), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 119/199 (59%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I ++T  A+    RLR++  Y+   +  G SIA  G CLTVV       
Sbjct: 1   MFTGIVTDIGEIESVTLTAQNRLHRLRILCHYDQGTIADGASIACNGACLTVVASGVAAG 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +  W++V+V AET  +T    W +GT +NLER++K+GD L GH+V+GH+DG   IL  D 
Sbjct: 61  L-TWFDVDVGAETLDVTTAKHWSVGTRLNLERALKIGDELGGHIVAGHVDGIATILTRDD 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                    S    L +FIAVKGSV L+GVSLTVN V    F VL I  T++ TT    +
Sbjct: 120 QHGMARFEFSTAPKLARFIAVKGSVTLDGVSLTVNSVRNEAFSVLTIPRTLDLTTLGDWR 179

Query: 179 VGDLINIEVDSMMRYIARL 197
               +NIEVD M RY ARL
Sbjct: 180 PNSEVNIEVDLMARYAARL 198


>gi|23014660|ref|ZP_00054465.1| COG0307: Riboflavin synthase alpha chain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 197

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 123/201 (61%), Gaps = 12/201 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG----MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIVTD+G    +  I +G     R  + + Y+T+ + +G SIAH G+CLT++ +   
Sbjct: 1   MFTGIVTDLG---VVRRIVRGEGREARFEIASRYDTATIAIGASIAHNGVCLTIIEVGP- 56

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
               +W+ VE  AET   T +  W  G+ +NLER++K+GD L GH+VSGH+DG  +++ +
Sbjct: 57  ----DWHAVEASAETLSKTTLGGWVEGSKVNLERALKVGDELGGHIVSGHVDGVAKVVDI 112

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
               +S+      P +L  F+A KGSV L+GVSLTVN V    F V +I HT   TT+  
Sbjct: 113 RPENESLRFTFETPADLACFVAPKGSVALDGVSLTVNEVDGRRFGVNIIPHTQSVTTFGT 172

Query: 177 HKVGDLINIEVDSMMRYIARL 197
           ++ G  +N+E+D + RY+ARL
Sbjct: 173 YRPGHEVNMEIDMLARYVARL 193


>gi|297537848|ref|YP_003673617.1| riboflavin synthase subunit alpha [Methylotenera sp. 301]
 gi|297257195|gb|ADI29040.1| riboflavin synthase, alpha subunit [Methylotenera sp. 301]
          Length = 201

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 123/198 (62%), Gaps = 8/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +TP+   ++L +  T  +   +K+G SIA  G+CLT +   E H  
Sbjct: 1   MFTGIIQTVGQIERVTPMGDDVKLNISCTGLDMLDVKIGDSIAVNGVCLTAITFDESH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E  V  E+  +T      I   +NLE++++L DRL GHLVSGH+DG  E++F + +
Sbjct: 59  ---FEAHVSKESLSVTIGLDKPIA--VNLEKALRLSDRLGGHLVSGHVDGVGEVVFFEPL 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD     +  PH + ++I+VKGS+C+NGVSLTVN +  + F + LI HT+E T+ +  K 
Sbjct: 114 GDCWKLDIRAPHAISKYISVKGSICVNGVSLTVNTIASDVFSMNLIPHTLENTSLQFLKA 173

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ R+
Sbjct: 174 GSRVNLEVDQIARYVERM 191


>gi|85715453|ref|ZP_01046434.1| riboflavin synthase subunit alpha [Nitrobacter sp. Nb-311A]
 gi|85697648|gb|EAQ35524.1| riboflavin synthase subunit alpha [Nitrobacter sp. Nb-311A]
          Length = 232

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 119/199 (59%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I ++T  A+    RLR++  Y+ + +  G SIA  G CLTVV  S    
Sbjct: 24  MFTGIVTDIGEIESVTRTAQNQLHRLRILCHYDQTTIADGASIACNGACLTVV-ASGVAG 82

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W++V+V AET  +T    W +GT +NLER++K+GD L GH+V+GH+DG   IL  D 
Sbjct: 83  GSTWFDVDVGAETLNVTTAKHWAVGTRLNLERALKIGDELGGHIVAGHVDGIATILTRDD 142

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                    S    L +FIAVKGSV L+GVSLTVN V    F VL I  T+  TT    +
Sbjct: 143 QYGMARFEFSTAPKLARFIAVKGSVTLDGVSLTVNSVRHEAFSVLTIPRTLGLTTLGDWR 202

Query: 179 VGDLINIEVDSMMRYIARL 197
               +NIEVD M RY ARL
Sbjct: 203 QNSEVNIEVDLMARYAARL 221


>gi|74420786|gb|ABA04985.1| Lumazine-binding protein [Nitrobacter winogradskyi Nb-255]
          Length = 232

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 119/199 (59%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I ++T  A+    RLR++  Y+   +  G SIA  G CLTVV       
Sbjct: 24  MFTGIVTDIGEIESVTLTAQNRLHRLRILCHYDQGTIADGASIACNGACLTVVASGVAAG 83

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +  W++V+V AET  +T    W +GT +NLER++K+GD L GH+V+GH+DG   IL  D 
Sbjct: 84  L-TWFDVDVGAETLDVTTAKHWSVGTRLNLERALKIGDELGGHIVAGHVDGIATILTRDD 142

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                    S    L +FIAVKGSV L+GVSLTVN V    F VL I  T++ TT    +
Sbjct: 143 QHGMARFEFSTAPKLARFIAVKGSVTLDGVSLTVNSVRNEAFSVLTIPRTLDLTTLGDWR 202

Query: 179 VGDLINIEVDSMMRYIARL 197
               +NIEVD M RY ARL
Sbjct: 203 PNSEVNIEVDLMARYAARL 221


>gi|254492039|ref|ZP_05105217.1| riboflavin synthase, alpha subunit [Methylophaga thiooxidans
           DMS010]
 gi|224462854|gb|EEF79125.1| riboflavin synthase, alpha subunit [Methylophaga thiooxydans
           DMS010]
          Length = 212

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 130/198 (65%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG++ ++ P    +RL + T  ++ S +KLG SIA  G+CLTVV ++     
Sbjct: 1   MFTGIIAAIGQVDSVQPSEGDLRLNIATQKWDLSDVKLGDSIAVNGVCLTVVEMTSSQ-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +V  E+   T++     G+ +NLE+++ +GDRL GH+VSGH+DG  ++L ++  
Sbjct: 59  ---LSFDVSKESLDRTSLGLAIAGSKVNLEKALAVGDRLGGHMVSGHVDGLGKVLQMETS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+  R+ +P  LE++IA KGSVC++GVSLTVN +G+ +F+V +I HT++ET    +KV
Sbjct: 116 ARSVCFRIEVPPVLERYIAEKGSVCIDGVSLTVNNIGQGWFEVNIIPHTMQETIISDYKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTQVNLEVDLIARYLERL 193


>gi|254293741|ref|YP_003059764.1| riboflavin synthase subunit alpha [Hirschia baltica ATCC 49814]
 gi|254042272|gb|ACT59067.1| riboflavin synthase, alpha subunit [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 124/201 (61%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTD+G+I  +       R RV ++Y    +++G SI H+G+CLTVV   +++   
Sbjct: 1   MFTGLVTDLGRIADVKDDNGVRRFRVESAYPVDSIEMGASIMHSGVCLTVVGF-DQNDEG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++VE   ET   T +  W  GT +NLE+S+ LGD+L GH V GH+DG  E++ +   G
Sbjct: 60  CWFDVEAVQETLDRTVLGEWRGGTRVNLEQSLALGDKLGGHFVFGHVDGVGEVMSITPEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
            S   R S+P  L +++A KGS+ ++GVSLT+  V    G ++F+V +I HT E TT   
Sbjct: 120 GSRRIRFSIPAVLSKYVAEKGSIAIDGVSLTIAAVGIENGIDWFEVAVIPHTWEVTTIGE 179

Query: 177 HKVGDLINIEVDSMMRYIARL 197
            K G  +N+E D + RY+AR+
Sbjct: 180 MKPGRKVNLEADMLARYVARM 200


>gi|114570084|ref|YP_756764.1| riboflavin synthase subunit alpha [Maricaulis maris MCS10]
 gi|114340546|gb|ABI65826.1| riboflavin synthase, alpha subunit [Maricaulis maris MCS10]
          Length = 201

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 124/206 (60%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV---RLSEEH 57
           MFTGIVT  G++ +++  ++  R  +   Y+   + +G SIAHAG CLTVV   R  E  
Sbjct: 1   MFTGIVTAKGRVRSISGDSQ-RRFEIEAPYDPDGIAMGASIAHAGACLTVVGKGRTGE-- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
               W+ V+V  ET  +T + SW  G  INLER++ LG+ L GHLV+GH+DG  E++   
Sbjct: 58  --GCWFAVDVSPETLSLTTLGSWREGDAINLERALALGEELGGHLVTGHVDGIGELVGRR 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             GD +   +  P  L +FIA KGS+ ++GVSLTVN V    FD+++I HT + TT    
Sbjct: 116 DDGDWIVLTVKPPATLNKFIARKGSITVDGVSLTVNGVTDETFDLMIIPHTADVTTLGAL 175

Query: 178 KVGDLINIEVDSMMRYIARLYALNTS 203
           ++G  +N+EVD M RY ARL   + +
Sbjct: 176 QIGAHVNLEVDLMARYAARLSEFSPT 201


>gi|82701144|ref|YP_410710.1| riboflavin synthase subunit alpha [Nitrosospira multiformis ATCC
           25196]
 gi|82409209|gb|ABB73318.1| riboflavin synthase, alpha subunit [Nitrosospira multiformis ATCC
           25196]
          Length = 208

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 121/198 (61%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G+I    P   G+ LR+     + ++ K+G SIA  G+CLTV  L+     
Sbjct: 1   MFTGIVEAVGEIKTANPQKNGLSLRIAPGKLSLAETKVGDSIAVNGVCLTVTGLA----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           DN   V+V  ET + T       G  +NLE+S++L D LDGHLVSGH+DG  E+     +
Sbjct: 56  DNLLSVDVSGETLQCTQGLDK-PGGKVNLEKSLRLSDGLDGHLVSGHVDGVGEVTKFQPL 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    + LP +L ++IA KGS+ +NGVSLTVN V ++  ++ LI HT+ ETT K  K 
Sbjct: 115 GESSLLAIRLPDSLLKYIAKKGSITVNGVSLTVNRVERDELEINLIPHTLAETTLKELKA 174

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 175 GARVNVEVDMLARYVERL 192


>gi|294083734|ref|YP_003550491.1| Lumazine-binding protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663306|gb|ADE38407.1| Lumazine-binding protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 198

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 127/201 (63%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+T  G I+ +   A    L +   ++ + + +G SIA +GICLTVV   + HS  
Sbjct: 1   MFTGIITGQGHILDIHD-AGDRHLTIGCDWDCASIDIGASIACSGICLTVVA-RDAHS-- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++VE  +ET  ++ +  W  G  INLER++++GD L GH+VSGH+DG  E+L +   G
Sbjct: 57  --FKVEASSETISVSTLGDWQKGDKINLERALRMGDELGGHIVSGHVDGLAEVLSITPDG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    LS+P +L  F+A KGSV L+GVSLTVN V  + F + +I HT + T + +  VG
Sbjct: 115 DSHIVSLSVPADLAMFVAPKGSVTLDGVSLTVNNVTDDSFTINVIAHTWDVTQFGVLTVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+E+D + RY+ARL +LN
Sbjct: 175 QKMNMEIDMLARYVARLNSLN 195


>gi|190571514|ref|YP_001975872.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018916|ref|ZP_03334724.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357786|emb|CAQ55241.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995867|gb|EEB56507.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 198

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 125/197 (63%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF GI+ DIG I  +T      ++  + + N S +  G SI+ +G+CLTVV +     + 
Sbjct: 1   MFKGIIQDIGTITDITIHPNSDQIFHIETQNLSSINKGDSISCSGVCLTVVDI-----MS 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET +++N+  W IG  INLE+++KL DR+DGHLV GH+D T EIL ++   
Sbjct: 56  NVFTVQVSQETMKVSNLNMWKIGKKINLEQAMKLSDRIDGHLVQGHVDDTTEILTINQNL 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   RLS P  L +FI  KGSV L+GVSLTVN V    F V +I +T + TT++ +K G
Sbjct: 116 ESHEIRLSCPQELIKFITKKGSVTLDGVSLTVNSVVDQEFTVNIIPYTWKNTTFQHNKTG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+EVD + RY+ +L
Sbjct: 176 NYLNLEVDMIARYLDQL 192


>gi|312226845|gb|ADQ50168.1| riboflavin synthase C [Bartonella clarridgeiae]
          Length = 168

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/147 (48%), Positives = 96/147 (65%)

Query: 49  TVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID 108
           T+V  + + +  +W+ VE W E   +TN+  W  GTF+NLERS++LGD + GHLV GHID
Sbjct: 22  TIVERALKSTATHWFAVEAWEEALCLTNLTQWTKGTFVNLERSLRLGDEIGGHLVFGHID 81

Query: 109 GTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHT 168
           G  EI+     GD+    L +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT
Sbjct: 82  GLAEIIEKKNEGDATRFHLQVPMQLAPFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHT 141

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIA 195
           +E T W   +VGD +N+EVD + R++ 
Sbjct: 142 LEMTIWGQAEVGDQVNLEVDQLGRFVP 168


>gi|220934732|ref|YP_002513631.1| riboflavin synthase, alpha subunit [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996042|gb|ACL72644.1| riboflavin synthase, alpha subunit [Thioalkalivibrio sp. HL-EbGR7]
          Length = 220

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++  + P     RLR+ T   + S ++LG SIA  G+CLT V L      
Sbjct: 1   MFTGIIQAVGEVAGIEPRGGDCRLRIRTGKLDLSDVQLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T++ + G G+ +NLE+++    RL GHLVSGH+DG  E+L L   
Sbjct: 56  GDGFVADVSGETLSLTSLGALGKGSAVNLEKALTPTTRLGGHLVSGHVDGLGEVLSLKDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   +  P  L ++IA KGS+C++GVSLTVN V    F V ++ HT +ETT + ++ 
Sbjct: 116 GRSVRYEIRAPAGLARYIAPKGSICMDGVSLTVNRVDGAVFSVNIVPHTQQETTIRFYRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTRVNLEVDLIARYLERL 193


>gi|154183736|gb|ABS70710.1| riboflavin synthase [Bartonella sp. 'sheep blood one']
          Length = 157

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 100/156 (64%)

Query: 26  VMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTF 85
           + T Y+   +++G SIA +GICLTVV    +H+  N + VE W E   +TN+  W  GTF
Sbjct: 2   ISTHYDVETIEIGASIACSGICLTVVERELKHANANCFVVEAWKEALCLTNLVQWTKGTF 61

Query: 86  INLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCL 145
           +NLERS++LG  + GHLVSGH+DG  EI+     GD++   L     L  FIA KGS+ L
Sbjct: 62  VNLERSLRLGGEIGGHLVSGHVDGLAEIIDQKNEGDAIRFYLRASMRLAPFIAEKGSIAL 121

Query: 146 NGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           NG SLTVN +  N FDVL+IRHT+E TTW   KV D
Sbjct: 122 NGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVRD 157


>gi|300022487|ref|YP_003755098.1| riboflavin synthase, subunit alpha [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524308|gb|ADJ22777.1| riboflavin synthase, alpha subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 197

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++TD+G++I  +    G    + T+Y       G SI   G+CLT   +    S  
Sbjct: 1   MFTGLITDVGEVIDKS----GGTFTLRTAYALRPEDAGISICCNGVCLTATSIKPLAS-G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET   + ++ W  G+ +NLERS+K GD L GH+VSGH+DG  +I+ +   G
Sbjct: 56  SEFSVDVSNETLAKSTLSDWATGSRVNLERSLKAGDELGGHIVSGHVDGVAKIVSITQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S       P +L ++IA KGSV L+G SLTVN V +N F V LI H++  TTW     G
Sbjct: 116 ASKRFLFEAPEHLSRYIAPKGSVALDGTSLTVNEVSENRFGVNLIPHSLTVTTWGGKTPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+EVD   RY+ARL
Sbjct: 176 DLVNLEVDVFARYVARL 192


>gi|303258271|ref|ZP_07344278.1| riboflavin synthase, alpha subunit [Burkholderiales bacterium
           1_1_47]
 gi|331001109|ref|ZP_08324740.1| riboflavin synthase, alpha subunit [Parasutterella
           excrementihominis YIT 11859]
 gi|302859024|gb|EFL82108.1| riboflavin synthase, alpha subunit [Burkholderiales bacterium
           1_1_47]
 gi|329569414|gb|EGG51192.1| riboflavin synthase, alpha subunit [Parasutterella
           excrementihominis YIT 11859]
          Length = 202

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 126/206 (61%), Gaps = 14/206 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I     I  G+R+ V         +K+G SIA  G C+TVV + E+   
Sbjct: 1   MFTGIIQAVGRIRDNEEIGDGLRIHVEAPELGLDTVKIGDSIAINGACMTVVEVDEKK-- 58

Query: 60  DNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              ++VEV AE+ ++   +  WG   ++NLE++++LGDRLDGH+VSGH+DG  E+   + 
Sbjct: 59  ---FKVEVSAESLSKTAGLDGWG---YVNLEKAMRLGDRLDGHIVSGHVDGVGEVDAFEK 112

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTW 174
           + +S    +  P  L +F+A KGSV +NGVSLT+N V          + LI HT E T++
Sbjct: 113 VAESYRLVVRCPMKLAKFLAYKGSVAINGVSLTINEVEDTPAGTRISINLIPHTFEHTSF 172

Query: 175 KMHKVGDLINIEVDSMMRYIARLYAL 200
           K  K  DL+N+EVD++ RYI R+Y+L
Sbjct: 173 KYTKKRDLVNVEVDTVARYIERMYSL 198


>gi|253996013|ref|YP_003048077.1| riboflavin synthase subunit alpha [Methylotenera mobilis JLW8]
 gi|253982692|gb|ACT47550.1| riboflavin synthase, alpha subunit [Methylotenera mobilis JLW8]
          Length = 211

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 120/203 (59%), Gaps = 8/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I    P+   M L + ++  + S + LG SIA  G CLTV+ +SE H  
Sbjct: 1   MFTGIIQSVGAITQANPVGADMHLSIASAALDMSDVNLGDSIAVNGTCLTVINMSESH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E  V  ET  +T          +NLE++++L DRL GHLVSGH+DG  ++L    +
Sbjct: 59  ---FEAHVSQETLSVT--VGLDKPHPVNLEKALRLSDRLGGHLVSGHVDGVGKVLKFQSL 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+     +  PH + ++I++KGS+C+NGVSLTVN +  + F + LI HT+E TT  +   
Sbjct: 114 GECWQLDIRAPHAISKYISIKGSICVNGVSLTVNKISGDDFSINLIPHTLEHTTLDLLSE 173

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           G  +N+EVD + RY+ R+   +T
Sbjct: 174 GSPVNLEVDQIARYVERMTQWST 196


>gi|282890460|ref|ZP_06298983.1| hypothetical protein pah_c022o023 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499457|gb|EFB41753.1| hypothetical protein pah_c022o023 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 212

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 116/198 (58%), Gaps = 1/198 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G I  M    KGMR+ +      S  K+G SIA  G CLTV+ ++ + S  
Sbjct: 1   MFTGLIEEMGIIRNMIATEKGMRIEINAELVLSDAKIGDSIAVNGCCLTVIEITSDSSGT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+  +   ET + T++    IG  +NLERSVKL DRL GHLV GH+DG   I  +  + 
Sbjct: 61  QWWAADAVKETLQRTSLQQLKIGDAVNLERSVKLNDRLGGHLVQGHVDGIGTIETIRALP 120

Query: 121 D-SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           D S    ++ P NL ++I  KGS+ L+GVSLTV LV    F V LI HT   TTW   K 
Sbjct: 121 DGSHEFVIAPPQNLLRYIVEKGSITLDGVSLTVCLVNHRSFSVTLIPHTKAVTTWGQKKT 180

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + +Y+ +L
Sbjct: 181 GMFVNVEVDLLAKYMEKL 198


>gi|310697231|gb|ADP06545.1| RibC [Bartonella sp. R-191]
          Length = 129

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 72/129 (55%), Positives = 90/129 (69%)

Query: 68  WAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRL 127
           W ET R+TN+A W  GTF+NLERS+K GD + GHLVSGHIDG   I+     GD++   +
Sbjct: 1   WEETLRLTNLAQWTKGTFVNLERSLKFGDEVGGHLVSGHIDGLALIVNKSVEGDAVRFYI 60

Query: 128 SLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEV 187
             P  L  FIA KGSV LNGVSLTVN V  + FDVL+IRHT+E TTW    +GD +N+E+
Sbjct: 61  QAPTRLLPFIANKGSVALNGVSLTVNCVEDDIFDVLIIRHTLEMTTWGQANIGDQVNLEI 120

Query: 188 DSMMRYIAR 196
           D + RY+AR
Sbjct: 121 DQLARYVAR 129


>gi|114798806|ref|YP_760755.1| riboflavin synthase subunit alpha [Hyphomonas neptunium ATCC 15444]
 gi|114738980|gb|ABI77105.1| riboflavin synthase, alpha subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 206

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 115/205 (56%), Gaps = 2/205 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTD+G +          R  V + Y  +++ +G SI H+G+CLTVV   E     
Sbjct: 1   MFTGLVTDVGTVRKAEHRNGLTRFEVESGYPLAQIAMGASILHSGVCLTVVDKGEAER-G 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE   ET   T +  W  GT +NLE+S+KLGD L GH V GH+DG  EI+ ++  G
Sbjct: 60  AWFAVEAVPETLSKTILGGWQEGTRVNLEQSLKLGDELGGHFVFGHVDGVGEIVSVEAEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF-FDVLLIRHTIEETTWKMHKV 179
            S    +  P  + ++ A KGS  ++GVSLTV    +N  F V +I HT E TT    K 
Sbjct: 120 QSFRVTIRPPAAISRYFATKGSAAVDGVSLTVAAALENGDFQVAIIPHTWEVTTLAALKP 179

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+E+D + RY+AR+   +  Q
Sbjct: 180 GTKVNLEIDMLARYVARMIGADAPQ 204


>gi|262373930|ref|ZP_06067207.1| riboflavin synthase, alpha subunit [Acinetobacter junii SH205]
 gi|262310941|gb|EEY92028.1| riboflavin synthase, alpha subunit [Acinetobacter junii SH205]
          Length = 219

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTVV        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVVEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQAVNVEKAMLPTTRFGGHIVSGHVDGLGEITLVRHDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSLYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|83858226|ref|ZP_00951748.1| riboflavin synthase subunit alpha [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853049|gb|EAP90901.1| riboflavin synthase subunit alpha [Oceanicaulis alexandrii
           HTCC2633]
          Length = 210

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 124/206 (60%), Gaps = 20/206 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTG+V+ +G+I++   I  G   R+ V + Y+   + LG SIAHAG+CLTVV   +   
Sbjct: 1   MFTGLVSALGRIVS---IKDGDVRRMTVSSPYDADTIALGASIAHAGVCLTVVACRKTQ- 56

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDG-------TV 111
           +   Y+++V  ET   T + SW  G  +NLER++K+GD L GH+V GH+DG       T 
Sbjct: 57  MGAEYDLDVSPETLSKTTLGSWKAGDGVNLERALKVGDELGGHIVQGHVDGVGRVTARTD 116

Query: 112 EILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEE 171
           E  ++ FI       +  P +L  FIA KGS+ ++GVSLTVN V  + F++++I HT E 
Sbjct: 117 EDGWIRFI-------VEAPTDLSPFIAYKGSIAVDGVSLTVNRVEGDEFELMIIPHTAEV 169

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           TT    + G  +N+EVD M RY ARL
Sbjct: 170 TTLGALQAGTRVNLEVDVMARYAARL 195


>gi|302425320|gb|ADL39586.1| putative riboflavin synthase alpha subunit [Hyphomicrobium
           sulfonivorans]
          Length = 202

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 116/206 (56%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTV--VRLSEEHS 58
           MFTGIVT IG++I       G    +   Y    +++G S+A  G CLT+  +R+ +  +
Sbjct: 1   MFTGIVTGIGEVIGR----DGGSFTIRCPYAAETLEIGGSMACNGCCLTMTSIRVDDAGA 56

Query: 59  V--DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
           V   + +  +V  ET+  T I SW  GT INLER + +G  L GHLV+GH+DG   I  +
Sbjct: 57  VAGSSIFTADVSNETSAKTTIDSWQPGTRINLERPLAMGQELGGHLVTGHVDGVARIADI 116

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
              GDS    +  P +L  +IA KGSV L+GVSLTVN V  N F V +I HT+  TTW  
Sbjct: 117 IADGDSRRFVIEAPDHLAPYIAPKGSVALDGVSLTVNEVSDNCFGVNIIPHTLTVTTWGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLYALNT 202
              G  IN+EVD   RYIARL    T
Sbjct: 177 KTAGQSINLEVDLFSRYIARLLEFRT 202


>gi|262395033|ref|YP_003286887.1| riboflavin synthase subunit alpha [Vibrio sp. Ex25]
 gi|262338627|gb|ACY52422.1| riboflavin synthase alpha chain [Vibrio sp. Ex25]
          Length = 217

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 126/198 (63%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + + T + + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLAAITPKGEDITVTIETGTLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET + T  A + +G  +NLE+++    RL GH+VSGH+DG  EI+  + +
Sbjct: 57  -HYYSADLSLETLKKTGFAEYQVGDKVNLEKAMLPTTRLGGHIVSGHVDGVGEIVERNLV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|295696431|ref|YP_003589669.1| riboflavin synthase, alpha subunit [Bacillus tusciae DSM 2912]
 gi|295412033|gb|ADG06525.1| riboflavin synthase, alpha subunit [Bacillus tusciae DSM 2912]
          Length = 200

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  + P  +G+ L V         K+G SIA +G+CLTVV L     V 
Sbjct: 1   MFTGIVEEIGILREVRPTDQGVELTVQAHRVLEDAKIGDSIAVSGVCLTVVDL-----VA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET R T + +   G  +NLER++ L  RL GHLVSGH+DG   +  + F G
Sbjct: 56  EAFRVDVVAETLRRTTLGAASPGARLNLERALTLQTRLGGHLVSGHVDGVGIVEEVGFEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    + +P  L+++IA KGSV ++GVSLTV  V +  F V LI HT +ETT    + G
Sbjct: 116 DSAVVDVRVPAPLQKYIAEKGSVAVDGVSLTVMGVTEKGFRVALIPHTQKETTLGELRSG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RY+ RL
Sbjct: 176 SRVNLEVDVVARYVERL 192


>gi|91225068|ref|ZP_01260290.1| riboflavin synthase subunit alpha [Vibrio alginolyticus 12G01]
 gi|91190011|gb|EAS76282.1| riboflavin synthase subunit alpha [Vibrio alginolyticus 12G01]
          Length = 217

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 126/198 (63%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V T + + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLAAITPKGEDITVTVETGTLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET + T  A + +G  +NLE+++    RL GH+VSGH+DG  EI+  + +
Sbjct: 57  -HYYSADLSLETLKKTGFAEYQVGDKVNLEKAMLPTTRLGGHIVSGHVDGVGEIVERNSV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|269965077|ref|ZP_06179242.1| Riboflavin synthase alpha chain [Vibrio alginolyticus 40B]
 gi|269830380|gb|EEZ84605.1| Riboflavin synthase alpha chain [Vibrio alginolyticus 40B]
          Length = 217

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 126/198 (63%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V T + + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLAAITPKGEDITVTVETGTLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET + T  A + +G  +NLE+++    RL GH+VSGH+DG  EI+  + +
Sbjct: 57  -HYYSADLSLETLKKTGFADYQVGDKVNLEKAMLPTTRLGGHIVSGHVDGVGEIVERNSV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|162139875|ref|YP_744827.2| riboflavin synthase subunit alpha [Granulibacter bethesdensis
           CGDNIH1]
          Length = 207

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIVT +G +  ++P+  G  MRL + T     +    G SIA +G CLTVV    E 
Sbjct: 1   MFTGIVTGLGSVATISPLEGGSDMRLTITTPEGFLTGAVTGASIACSGCCLTVV----EF 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
           + D  +  EV AET   T + SW   + INLER++K+GD L GH+VSGH+DG  E++F+ 
Sbjct: 57  AGDTAFVAEVSAETLSKTTLGSWHQNSMINLERALKIGDELGGHIVSGHVDGVAEVIFVL 116

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S   R   P +L ++IA KGS+ ++GVSLTVN V  + F V +I HT   TT    
Sbjct: 117 PEHGSTRMRFRAPSHLARYIAQKGSIAVDGVSLTVNEVENDVFGVNVIPHTCSVTTIGTL 176

Query: 178 KVGDLINIEVDSMMRYIARL 197
             G  +NIE+D + RY+ RL
Sbjct: 177 VAGSRVNIEIDMLARYVDRL 196


>gi|325124199|gb|ADY83722.1| riboflavin synthase alpha chain [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 219

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYEVTAPAELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|148261111|ref|YP_001235238.1| riboflavin synthase subunit alpha [Acidiphilium cryptum JF-5]
 gi|146402792|gb|ABQ31319.1| riboflavin synthase, alpha subunit [Acidiphilium cryptum JF-5]
          Length = 204

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 116/205 (56%), Gaps = 13/205 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTS--------KMKLGCSIAHAGICLTVVR 52
           MFTGI+T +G +  + P       R++              ++ LG SIA +G CLTVV 
Sbjct: 1   MFTGIITGVGDVRDVRPADSVSDTRLVIGVPAGNPDWAGIGEVALGASIACSGCCLTVVE 60

Query: 53  LSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVE 112
              +     W+ VEV  ET   T + +W  GT INLER++++GD L GH+VSGH+DG  E
Sbjct: 61  RGPD-----WFAVEVSGETLSKTTLGAWRTGTRINLERALRMGDELGGHVVSGHVDGLGE 115

Query: 113 ILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
           ++ +   G S   R  +   L +FIA KGSV +NGVSLTVN V    F V +I HT   T
Sbjct: 116 VVSMRPEGGSTRWRFRVSRELARFIAPKGSVAVNGVSLTVNEVDGTEFGVNIIPHTETHT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARL 197
            +    VGD +NIE+D + RY+ARL
Sbjct: 176 NFATLAVGDAVNIEIDMLARYVARL 200


>gi|169634647|ref|YP_001708383.1| riboflavin synthase subunit alpha [Acinetobacter baumannii SDF]
 gi|169153439|emb|CAP02581.1| riboflavin synthase alpha chain [Acinetobacter baumannii]
          Length = 219

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SQVNLEVDVLARYIERL 192


>gi|293610034|ref|ZP_06692335.1| riboflavin synthase [Acinetobacter sp. SH024]
 gi|292827266|gb|EFF85630.1| riboflavin synthase [Acinetobacter sp. SH024]
          Length = 219

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYEVTAPTELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|293627834|gb|ADE58448.1| riboflavin synthase alpha-chain [Bartonella quintana]
          Length = 152

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 100/151 (66%), Gaps = 1/151 (0%)

Query: 6   VTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSVDNWYE 64
           VTDIG +  +  + +G+R  + T Y+   +++G SIA +GICLT+V R S++ +  NW+ 
Sbjct: 1   VTDIGCVEDIQSLKQGVRFNISTHYDMESLEIGASIACSGICLTIVERGSKQKAKTNWFA 60

Query: 65  VEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMY 124
           VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++ 
Sbjct: 61  VEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKEGDAVR 120

Query: 125 CRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV 155
             L +P     FI  KGS+ LNG SLTVN V
Sbjct: 121 FFLQVPTKFTPFIVNKGSIALNGTSLTVNCV 151


>gi|326404512|ref|YP_004284594.1| riboflavin synthase alpha chain [Acidiphilium multivorum AIU301]
 gi|325051374|dbj|BAJ81712.1| riboflavin synthase alpha chain [Acidiphilium multivorum AIU301]
          Length = 204

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 116/205 (56%), Gaps = 13/205 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTS--------KMKLGCSIAHAGICLTVVR 52
           MFTGI+T +G +  + P       R++              ++ LG SIA +G CLTVV 
Sbjct: 1   MFTGIITGVGDVRDVRPADSVSDTRLVIGVPAGNPDWAGIGEVALGASIACSGCCLTVVE 60

Query: 53  LSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVE 112
              +     W+ VEV  ET   T + +W  GT INLER++++GD L GH+VSGH+DG  E
Sbjct: 61  RGPD-----WFAVEVSGETLSKTTLGAWRTGTRINLERALRMGDELGGHVVSGHVDGLGE 115

Query: 113 ILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
           ++     G S   R  +  +L +FIA KGSV +NGVSLTVN V    F V +I HT   T
Sbjct: 116 VVSTRPEGGSTRWRFRVSRDLARFIAPKGSVAVNGVSLTVNEVDGTEFGVNIIPHTETHT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARL 197
            +    VGD +NIE+D + RY+ARL
Sbjct: 176 NFATLAVGDAVNIEIDMLARYVARL 200


>gi|159883554|emb|CAM84154.1| riboflavin synthase [Bartonella chomelii]
          Length = 159

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/155 (47%), Positives = 101/155 (65%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + +G+RL + T Y+   +++G SIA +GICLTV+    + +  N + VE W E   +
Sbjct: 5   IQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIEHELKQANVNCFVVEAWKEALCL 64

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TNIA W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     GD++   L     L 
Sbjct: 65  TNIAQWTKGTFVNLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEGDAIRFYLKASMRLA 124

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTI 169
            FIA KGS+ LNG SLTVN +  N FDVL+IRHT+
Sbjct: 125 PFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTL 159


>gi|162286754|ref|YP_001083300.2| riboflavin synthase subunit alpha [Acinetobacter baumannii ATCC
           17978]
 gi|169797508|ref|YP_001715301.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AYE]
 gi|184156568|ref|YP_001844907.1| riboflavin synthase subunit alpha [Acinetobacter baumannii ACICU]
 gi|213155678|ref|YP_002317723.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii AB0057]
 gi|215484943|ref|YP_002327184.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           AB307-0294]
 gi|239502076|ref|ZP_04661386.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB900]
 gi|260556400|ref|ZP_05828619.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii ATCC
           19606]
 gi|301346212|ref|ZP_07226953.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB056]
 gi|301512961|ref|ZP_07238198.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB058]
 gi|301595092|ref|ZP_07240100.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB059]
 gi|332851508|ref|ZP_08433505.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332866792|ref|ZP_08437196.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332874948|ref|ZP_08442799.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6014059]
 gi|169150435|emb|CAM88332.1| riboflavin synthase alpha chain [Acinetobacter baumannii AYE]
 gi|183208162|gb|ACC55560.1| Riboflavin synthase alpha chain [Acinetobacter baumannii ACICU]
 gi|193076095|gb|ABO10698.2| riboflavin synthase alpha chain [Acinetobacter baumannii ATCC
           17978]
 gi|213054838|gb|ACJ39740.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii AB0057]
 gi|213987419|gb|ACJ57718.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           AB307-0294]
 gi|260410455|gb|EEX03754.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii ATCC
           19606]
 gi|322506455|gb|ADX01909.1| ribC [Acinetobacter baumannii 1656-2]
 gi|323516334|gb|ADX90715.1| riboflavin synthase subunit alpha [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729961|gb|EGJ61292.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332734400|gb|EGJ65520.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332736891|gb|EGJ67867.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6014059]
          Length = 219

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|302392185|ref|YP_003828005.1| riboflavin synthase, alpha subunit [Acetohalobium arabaticum DSM
           5501]
 gi|302204262|gb|ADL12940.1| riboflavin synthase, alpha subunit [Acetohalobium arabaticum DSM
           5501]
          Length = 217

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 126/197 (63%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ ++   ++ + L +        +K+G SIA +G+CLTV    E     
Sbjct: 1   MFTGIVEEMGEVSSINRGSQSVELEIKADKVLEDVKIGDSIATSGVCLTVTDFGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++ V+V  ET R +++A   IG+ +NLER+++L DRL GHLVSGHIDGT +I       
Sbjct: 56  DYFTVDVMPETMRKSSLAELQIGSKVNLERALRLQDRLGGHLVSGHIDGTGKIKKKQRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +SLP +L++++  KGS+ ++G+SLT+  + +  F V LI HT +ETT     +G
Sbjct: 116 NAILVTVSLPSDLKRYLIPKGSITVDGISLTIAELEETEFIVSLIPHTAQETTLGQKSIG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ R+
Sbjct: 176 DTVNLEVDLIGKYVERM 192


>gi|294648977|ref|ZP_06726425.1| riboflavin synthase subunit alpha [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825112|gb|EFF83867.1| riboflavin synthase subunit alpha [Acinetobacter haemolyticus ATCC
           19194]
          Length = 219

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQAVNVEKAMLPTTRFGGHIVSGHVDGLGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSLYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 TKVNLEVDVLARYIERL 192


>gi|114315844|gb|ABI61904.1| riboflavin synthase alpha chain [Granulibacter bethesdensis
           CGDNIH1]
          Length = 282

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIVT +G +  ++P+  G  MRL + T     +    G SIA +G CLTVV    E 
Sbjct: 76  MFTGIVTGLGSVATISPLEGGSDMRLTITTPEGFLTGAVTGASIACSGCCLTVV----EF 131

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
           + D  +  EV AET   T + SW   + INLER++K+GD L GH+VSGH+DG  E++F+ 
Sbjct: 132 AGDTAFVAEVSAETLSKTTLGSWHQNSMINLERALKIGDELGGHIVSGHVDGVAEVIFVL 191

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S   R   P +L ++IA KGS+ ++GVSLTVN V  + F V +I HT   TT    
Sbjct: 192 PEHGSTRMRFRAPSHLARYIAQKGSIAVDGVSLTVNEVENDVFGVNVIPHTCSVTTIGTL 251

Query: 178 KVGDLINIEVDSMMRYIARL 197
             G  +NIE+D + RY+ RL
Sbjct: 252 VAGSRVNIEIDMLARYVDRL 271


>gi|159883548|emb|CAM84151.1| riboflavin synthase [Bartonella birtlesii]
          Length = 160

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 100/156 (64%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           +  + +G+RL + T Y+   +++G SIA +GICLT+V    + +  NW+ VE W E  R+
Sbjct: 5   VQSLKQGVRLNISTHYDLESLEIGASIACSGICLTLVERGSKCANLNWFAVEAWEEALRL 64

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+  W  GT INLERS+KLGD + GHLV GHIDG  E++     GD++   L +P    
Sbjct: 65  TNLTEWKKGTRINLERSLKLGDEIGGHLVFGHIDGLAEVIDQKNEGDAIRFFLKIPKQFT 124

Query: 135 QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIE 170
            FI  KGS+ LNG SLTVN +    F+VL+IRHT+E
Sbjct: 125 PFIVNKGSIALNGTSLTVNFIEDCIFNVLIIRHTLE 160


>gi|299771885|ref|YP_003733911.1| riboflavin synthase subunit alpha [Acinetobacter sp. DR1]
 gi|298701973|gb|ADI92538.1| riboflavin synthase subunit alpha [Acinetobacter sp. DR1]
          Length = 219

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYDVTAPTELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|90406962|ref|ZP_01215153.1| riboflavin synthase subunit alpha [Psychromonas sp. CNPT3]
 gi|90312004|gb|EAS40098.1| riboflavin synthase subunit alpha [Psychromonas sp. CNPT3]
          Length = 219

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 127/202 (62%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+   A  M + V + + + S +KLG SIAH G+CLT+  L +    
Sbjct: 1   MFTGIIEAVGTISAIKHHAHDMTISVDSGTLDLSDVKLGDSIAHNGVCLTITALHK---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y+V++  ET   +  AS  IG  +NLE+++++  R  GH+VSGH+DG  EI  +  +
Sbjct: 57  -NGYDVDISNETISRSGFASIKIGFKVNLEKAMQMSSRFGGHIVSGHVDGVGEITSMTRV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P +L ++IA KGS+ ++G+SLT N +  + F + +I HTI +TT + ++V
Sbjct: 116 GSAIEYWIKAPLDLAKYIAEKGSITIDGISLTTNAIDNSAFKLTIIPHTIAQTTMQDYQV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G L+N+EVD + RY+ RL + N
Sbjct: 176 GTLVNLEVDVIARYLERLISSN 197


>gi|134098692|ref|YP_001104353.1| riboflavin synthase subunit alpha [Saccharopolyspora erythraea NRRL
           2338]
 gi|133911315|emb|CAM01428.1| riboflavin synthase alpha chain [Saccharopolyspora erythraea NRRL
           2338]
          Length = 216

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 115/197 (58%), Gaps = 8/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A  P+A G RL V     TS    G SIA  G+CLTVV + E     
Sbjct: 1   MFTGIVEELGTVTAAEPLADGSRLTVAGPVVTSDAGHGDSIAVNGVCLTVVDVLE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET R +++   G+G  +NLER++ LGDRL GH+V GH+DGT  +   +  G
Sbjct: 56  GAFTVDVVAETLRRSSLKHVGVGDRVNLERAMALGDRLGGHIVQGHVDGTAVLRSAEADG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R  LP  L +++  KGS+ ++GVSLTV   G+  F V LI  T E TT      G
Sbjct: 116 ---LTRFDLPARLSRYVVEKGSITVDGVSLTVVEAGEESFSVALIPTTKELTTLGFRAPG 172

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD + +++ RL
Sbjct: 173 DEVNIEVDVLAKHVERL 189


>gi|71280235|ref|YP_267481.1| riboflavin synthase subunit alpha [Colwellia psychrerythraea 34H]
 gi|71145975|gb|AAZ26448.1| riboflavin synthase, alpha subunit [Colwellia psychrerythraea 34H]
          Length = 232

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 126/206 (61%), Gaps = 10/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+   A+G RL + T S + S +KLG SIA  GICLTVV  +     
Sbjct: 1   MFTGIIEAVGTISAINVNAQGARLVIATNSLDMSDVKLGDSIATNGICLTVVDFNNGKG- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +  Y  +V  ET + T  A + +G+ +NLE+++    R  GH+VSGH+DG  EIL ++  
Sbjct: 60  NGSYSADVSNETLQRTGFAGYKVGSKVNLEKAMLASTRFGGHMVSGHVDGVSEILAINNN 119

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG--------KNFFDVLLIRHTIEE 171
           G+S+   LS+P +L  +IA KGSV ++G SLTVN +         +  F + ++ HT++E
Sbjct: 120 GNSIEYWLSMPSDLAHYIAEKGSVTIDGTSLTVNALAEEGSKGHSQGSFRLTIVPHTVKE 179

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           T +  ++VG  +NIEVD + RY+ RL
Sbjct: 180 TIFAEYQVGSKVNIEVDLIARYLERL 205


>gi|257455157|ref|ZP_05620395.1| riboflavin synthase, alpha subunit [Enhydrobacter aerosaccus SK60]
 gi|257447490|gb|EEV22495.1| riboflavin synthase, alpha subunit [Enhydrobacter aerosaccus SK60]
          Length = 222

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 119/199 (59%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI+A+TP    +RL+V + Y + + +KLG SIA  GICLTVV   ++   
Sbjct: 1   MFTGIIEATGKIVAITPTQGDVRLKVQSDYLDFADVKLGDSIASNGICLTVVEQGKD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             WY V+V  ET   T +  W +G  +NLE+++    R  GH+V+GH+D T  +  +   
Sbjct: 58  --WYAVDVSRETLNKTAMQQWQVGDVVNLEKAMLPTTRFGGHIVTGHVDTTGTVKLIKND 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH-K 178
             S+Y  + +P +  +++A KGSV ++G+SLT NLV  N   + +I HT + T    H K
Sbjct: 116 SRSIYIEIEIPSDFTKYVATKGSVTVDGISLTSNLVEGNVISLNIIPHTAQVTNISRHWK 175

Query: 179 VGDLINIEVDSMMRYIARL 197
           V   +NIEVD + RY+ +L
Sbjct: 176 VATKVNIEVDVVARYLEKL 194


>gi|190572775|ref|YP_001970620.1| riboflavin synthase subunit alpha [Stenotrophomonas maltophilia
           K279a]
 gi|190010697|emb|CAQ44306.1| putative riboflavin synthase alpha chain [Stenotrophomonas
           maltophilia K279a]
          Length = 208

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 120/208 (57%), Gaps = 14/208 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKM-----KLGCSIAHAGICLTVVRLSE 55
           MFTGI+  +G+++A  PI   +R     ++N   +     ++G SIA  G+CLTV+    
Sbjct: 1   MFTGIIEGVGRLVAREPIGGDVRF----TFNVGNLPFDNVQMGESIAINGVCLTVIAFDT 56

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                N ++ +   ET  +T +   G G  INLER+++  DRL GHLVSGH+DG  ++L 
Sbjct: 57  -----NSFQADASTETLGLTTLGQLGEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVLS 111

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
           +     +   R   P  L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T + 
Sbjct: 112 IHEDARAQRWRFGAPAALRRYIAKKGSICVDGVSLTVNEVDDEGFEVALIPHTVANTAFS 171

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
              VG  +N+E+D + RY+ RL ++ T+
Sbjct: 172 ASGVGSAVNLEIDLVARYVERLISVPTN 199


>gi|103488467|ref|YP_618028.1| riboflavin synthase subunit alpha [Sphingopyxis alaskensis RB2256]
 gi|98978544|gb|ABF54695.1| riboflavin synthase, alpha subunit [Sphingopyxis alaskensis RB2256]
          Length = 205

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 83/204 (40%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I +        RL + T+++T+ + LG SIA +G CLTVV    +   D
Sbjct: 1   MFTGIITDIGTIRSREDRGD-TRLVIATAHDTATIDLGASIACSGACLTVVDKGRDADGD 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+  AET   T    W  G  +N+ER++K+GD L GH+V+GH+D    I+ ++ +G
Sbjct: 60  -WFAVDASAETLARTAPGMWDAGRRLNIERALKVGDELGGHIVTGHVDAVGRIVAVEPVG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
           DS+   +  P  L   IA KGS+ L+GVSLTVN V     G   F + +I HT   TT  
Sbjct: 119 DSVKLTVEAPAALAPHIAPKGSITLDGVSLTVNEVTDQPDGSAHFTLNIIPHTQAMTTLD 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYA 199
               G  +N+E+D + RY+AR+ A
Sbjct: 179 EAAAGRPVNLEIDILARYLARMQA 202


>gi|28897454|ref|NP_797059.1| riboflavin synthase subunit alpha [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260876414|ref|ZP_05888769.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260898685|ref|ZP_05907181.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260899220|ref|ZP_05907615.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ4037]
 gi|28805666|dbj|BAC58943.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308086938|gb|EFO36633.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308093013|gb|EFO42708.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308106683|gb|EFO44223.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ4037]
          Length = 217

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 125/198 (63%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V +   + S +KLG SIA  G+CLTV+        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVIDFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  SNYYSADLSLETLKKTGFANYQVGEKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|262280658|ref|ZP_06058441.1| riboflavin synthase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257558|gb|EEY76293.1| riboflavin synthase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
          Length = 219

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT + T     +VG
Sbjct: 116 RSIYYEVTAPAELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAKRTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|326388320|ref|ZP_08209916.1| riboflavin synthase subunit alpha [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207052|gb|EGD57873.1| riboflavin synthase subunit alpha [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 211

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 121/210 (57%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVR----LSEE 56
           MFTGIV ++GK++A+T      R+ + T      + +G SIA +G+CLTVV        E
Sbjct: 1   MFTGIVVEVGKVLAVTDRGD-RRITISTDRRQDTIAIGASIACSGVCLTVVEKGTGFGGE 59

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
             +  W+ V+V AET   T  A W  G  INLE ++K+GD L GH+V+GH+DG   +  +
Sbjct: 60  PGI-GWFAVDVSAETISRTCPAQWLEGAEINLEPALKVGDELGGHIVTGHVDGVGAVAAI 118

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEE 171
              G S       P +L  +IA KGS+ +NGVSLTVN +     G+  F + +I HT E 
Sbjct: 119 TPEGASRRIDFFAPADLAPYIASKGSIAINGVSLTVNGITDEADGRARFGINIIPHTAEV 178

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           TT    KVGD +N+E+D + RY+ R+ +L 
Sbjct: 179 TTLGALKVGDPVNLEIDVLARYLKRMQSLE 208


>gi|328472536|gb|EGF43399.1| riboflavin synthase subunit alpha [Vibrio parahaemolyticus 10329]
          Length = 217

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 125/198 (63%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V +   + S +KLG SIA  G+CLTV+        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVIDFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  SNYYSADLSLETLKKTGFANYQVGEKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEVSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|260551095|ref|ZP_05825299.1| riboflavin synthase subunit alpha [Acinetobacter sp. RUH2624]
 gi|260405862|gb|EEW99350.1| riboflavin synthase subunit alpha [Acinetobacter sp. RUH2624]
          Length = 219

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPITRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|57239465|ref|YP_180601.1| riboflavin synthase subunit alpha [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579443|ref|YP_197655.1| riboflavin synthase subunit alpha [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161544|emb|CAH58471.1| putative riboflavin synthase, alpha subunit [Ehrlichia ruminantium
           str. Welgevonden]
 gi|58418069|emb|CAI27273.1| Riboflavin synthase alpha chain [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 202

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MF GI+ DIG I+ +  I +      +  YN    SK++LG S+A +GICL+V +L  E 
Sbjct: 1   MFKGIIEDIGTIVHVDHIQERDIRVFIRPYNVNFLSKVQLGSSVACSGICLSVAQLHSE- 59

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
               ++  ++   T  +TN   W  GT INLE S+K+ DRLDGH V GH+DG   I+ + 
Sbjct: 60  ----YFSADISQSTLSVTNTIYWKKGTNINLELSLKINDRLDGHFVQGHVDGIGTIISIT 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            I  S          L ++I  KGS+ ++GVSLTVN    N F V +I HT E T ++  
Sbjct: 116 KINSSHNIVFQTQQPLLKYIVTKGSIAIDGVSLTVNTTSNNTFSVNIIPHTWENTIFQYS 175

Query: 178 KVGDLINIEVDSMMRYIARLYALNT 202
           KV D +NIEVD + ++I +LY  NT
Sbjct: 176 KVTDKVNIEVDIIAKHIEKLYQYNT 200


>gi|133872802|gb|ABO40463.1| RibC [Bartonella henselae]
          Length = 135

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 93/134 (69%), Gaps = 1/134 (0%)

Query: 44  AGICLTVV-RLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHL 102
           +G+CLT+V R S++ +  NW+ VE W E  R+TN+A W  GTFINLERS++LGD + GHL
Sbjct: 1   SGVCLTIVERGSKQQAKINWFAVEAWEEALRLTNLAQWTKGTFINLERSLRLGDEMGGHL 60

Query: 103 VSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDV 162
           VSGHIDG  EI+     GD++   L +P     FI  K S+ LNG SLTVN V ++ FDV
Sbjct: 61  VSGHIDGLAEIIDQKSEGDAVRFFLQVPKRFIPFIVSKSSIALNGTSLTVNCVEEHIFDV 120

Query: 163 LLIRHTIEETTWKM 176
           L+IRHT+E TTW+ 
Sbjct: 121 LIIRHTLEMTTWRQ 134


>gi|291613123|ref|YP_003523280.1| riboflavin synthase, subunit alpha [Sideroxydans lithotrophicus
           ES-1]
 gi|291583235|gb|ADE10893.1| riboflavin synthase, alpha subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 198

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 123/198 (62%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV D+G I        G+RL V+T +     ++LG SIA  G+CLTVV++      
Sbjct: 1   MFSGIVADVGLIRTAQDREGGLRLTVITETLGMDDVQLGDSIAVNGVCLTVVKID----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N + V+V  ET   T I     G  +NLE++++L DRL GHLVSGH+DG  E++  + I
Sbjct: 56  GNDFTVDVSRETLNCT-IGLERQGGHVNLEKALRLSDRLGGHLVSGHVDGVGEVVAFNDI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  L ++IAVKGS+ +NGVSLTVN V  + F+V LI HT+E TT    +V
Sbjct: 115 GESWRLVVRAPQQLAKYIAVKGSITINGVSLTVNQVSGSEFEVNLIPHTLEVTTLNELQV 174

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ R+
Sbjct: 175 GTKVNLEIDLIARYVERM 192


>gi|255320995|ref|ZP_05362168.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SK82]
 gi|262379915|ref|ZP_06073070.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SH164]
 gi|255301959|gb|EET81203.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SK82]
 gi|262298109|gb|EEY86023.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SH164]
          Length = 219

 Score =  144 bits (363), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+   E     
Sbjct: 1   MFTGIIESLGKVQSLQSVGGDVRLRIQTDLDMSDVNLGDSIATNGICLTVIEWGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQPVNVEKAMLPTTRFGGHIVSGHVDAVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGS+ ++G+SLT+N +  N   + LI HT E T     K G
Sbjct: 116 RSVYYEVTAPKEIAKYLAEKGSITVDGISLTINHLRGNILSLNLIPHTAERTNISTWKTG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|83589767|ref|YP_429776.1| riboflavin synthase subunit alpha [Moorella thermoacetica ATCC
           39073]
 gi|83572681|gb|ABC19233.1| riboflavin synthase, alpha subunit [Moorella thermoacetica ATCC
           39073]
          Length = 217

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG I  +  + +G RL +      +  + G SIA  G CLTVV +  E  V 
Sbjct: 1   MFTGLIEEIGSIRRIVTVPQGARLTISAREVLAGTRRGDSIAVNGACLTVVDVEPEALV- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                EV AET R+T + S  +G  +NLER+++LG+RL GHLVSGHIDG  EI     +G
Sbjct: 60  ----AEVMAETLRVTTLGSLKVGDRVNLERALRLGERLGGHLVSGHIDGVGEIKSRRQVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    L++P  LE++IA KGS+ L+G SLTV  V  N   V LI HT   T       G
Sbjct: 116 IAWELTLAVPVGLERYIAPKGSLALDGTSLTVITVTGNQVTVGLIPHTARNTILGDKGPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD + RY+ RL
Sbjct: 176 DRVNIEVDLLARYLERL 192


>gi|58617497|ref|YP_196696.1| riboflavin synthase subunit alpha [Ehrlichia ruminantium str.
           Gardel]
 gi|58417109|emb|CAI28222.1| Riboflavin synthase alpha chain [Ehrlichia ruminantium str. Gardel]
          Length = 202

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MF GI+ DIG I+ +  I +      +  YN    SK++LG S+A +GICL+V +L  E 
Sbjct: 1   MFKGIIEDIGTIVHVDYIQERDIRVFIRPYNVNFLSKVQLGSSVACSGICLSVAQLHSE- 59

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
               ++  ++   T  +TN   W  GT INLE S+K+ DRLDGH V GH+DG   I+ + 
Sbjct: 60  ----YFSADISQSTLSVTNTIYWKKGTNINLELSLKINDRLDGHFVQGHVDGIGTIISIT 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            I  S          L ++I  KGS+ ++GVSLTVN    N F V +I HT E T ++  
Sbjct: 116 KINSSHNIVFQTQQPLLKYIVTKGSIAIDGVSLTVNTTSNNTFSVNIIPHTWENTIFQYS 175

Query: 178 KVGDLINIEVDSMMRYIARLYALNT 202
           KV D +NIEVD + ++I +LY  NT
Sbjct: 176 KVTDKVNIEVDIIAKHIEKLYQYNT 200


>gi|78485743|ref|YP_391668.1| riboflavin synthase subunit alpha [Thiomicrospira crunogena XCL-2]
 gi|78364029|gb|ABB41994.1| riboflavin synthase, alpha subunit [Thiomicrospira crunogena XCL-2]
          Length = 221

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 125/200 (62%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G +  + P+    R+ + +   + S +K+G SIA  G+CLT + L+     
Sbjct: 1   MFTGIIETEGFVSRIEPVNGDARMTIEVGKLDMSDVKIGDSIACNGVCLTAIELTP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V +ET ++T + +  +G+ +NLE++++L DRL GHLVSGH+DG  ++L +   
Sbjct: 57  -SAYVADVSSETLKVTTLGALKVGSPVNLEKALRLQDRLGGHLVSGHVDGVGKVLSITQE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   ++  P  L ++IA KGS+C+NG+SLTVN V    FDV ++ HT +ETT K  +V
Sbjct: 116 ARSWRYQIEAPVALAKYIAGKGSICINGISLTVNQVDGCAFDVNIVPHTRQETTIKHFQV 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ R+ +
Sbjct: 176 GTTVNLEVDLLARYLERMLS 195


>gi|108758043|ref|YP_632925.1| riboflavin synthase subunit alpha [Myxococcus xanthus DK 1622]
 gi|108461923|gb|ABF87108.1| riboflavin synthase, alpha subunit [Myxococcus xanthus DK 1622]
          Length = 220

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 117/202 (57%), Gaps = 8/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMR-LRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG++ D+G++  + P   GM  L + TS   +  +LG SIA  G CLTVV    E + 
Sbjct: 1   MFTGLIQDLGRVERVIP--GGMTDLWIHTSLGAAAFELGESIAVNGACLTVV----ERTG 54

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ + V+   ET R T + S   G  +NLER++ LGDRL GHLVSGH+D   E+L     
Sbjct: 55  DS-FRVQAAPETLRRTTLGSVKPGDQVNLERALALGDRLGGHLVSGHVDAVSEVLETYPE 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S      LP  L  +   KGSV ++G+SLTVN V  + F V LI  T E TT K   V
Sbjct: 114 GGSWVMGFRLPEELAPYFIEKGSVAIDGISLTVNTVEADRFRVQLIPETQERTTLKARGV 173

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E D + +Y+ARL+AL 
Sbjct: 174 GSKVNLEADQIGKYVARLFALQ 195


>gi|226951735|ref|ZP_03822199.1| riboflavin synthase subunit alpha [Acinetobacter sp. ATCC 27244]
 gi|226837525|gb|EEH69908.1| riboflavin synthase subunit alpha [Acinetobacter sp. ATCC 27244]
          Length = 219

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  HWYAADVSRESLNRTTLGQWKVGQAVNVEKAMLPTTRFGGHIVSGHVDGLGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSLYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 TKVNLEVDVLARYIERL 192


>gi|148555359|ref|YP_001262941.1| riboflavin synthase subunit alpha [Sphingomonas wittichii RW1]
 gi|148500549|gb|ABQ68803.1| riboflavin synthase, alpha subunit [Sphingomonas wittichii RW1]
          Length = 205

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 119/207 (57%), Gaps = 11/207 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I A T +   + +R+   Y+T  + +G SIA +G C+TVV L       
Sbjct: 1   MFTGIITDVGTISA-TEMRGDLHVRIACGYDTGTIDIGASIACSGACMTVVELGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V++  E+   T    W  G  +NLERS+K+GD L GH+V+GH+DG   I+ +   G
Sbjct: 55  DWFAVDISHESVSRTAPGRWETGRRLNLERSLKVGDELGGHIVTGHVDGVGTIVSIAAEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
           DS    +  P  L  ++A KGS+ ++G+SLTVN V     G   F + +I HT   TT  
Sbjct: 115 DSTRLEIRAPAELAPYLAPKGSIAIDGISLTVNSVTDQPDGSTVFGLNIIPHTAAVTTLG 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNT 202
              V D +N+E+D + RY+ R+  L +
Sbjct: 175 GMTVHDSVNLEIDVLARYLGRMEQLRS 201


>gi|292654586|ref|YP_003534483.1| riboflavin synthase subunit alpha [Haloferax volcanii DS2]
 gi|291372746|gb|ADE04973.1| riboflavin synthase, alpha subunit [Haloferax volcanii DS2]
          Length = 203

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G+I+A+T    G RLR+ T      +  G SIA +G+CLTV     E   D
Sbjct: 1   MFTGIVEGPGEIVAVTDTDGGRRLRIRTDLAFDDLHHGQSIAVSGVCLTV-----EAFGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+EV + AET   T +     G  +NLER++   DR DGH+V GH+DGT  +  ++ +G
Sbjct: 56  DWFEVFLAAETIEKTYLGDAVEGDRVNLERALAADDRFDGHIVQGHVDGTTTVTNVERVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D  +    LP +L  ++  KGSVCL+G+SLTV    +  F V +I  T + TT     VG
Sbjct: 116 DDWFFEFDLPESLANYVVQKGSVCLDGISLTVADRREGTFAVAIIPTTYDLTTLSEKAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D I++EVD + +Y+  +
Sbjct: 176 DPIHVEVDVVAKYVESM 192


>gi|308048549|ref|YP_003912115.1| riboflavin synthase, alpha subunit [Ferrimonas balearica DSM 9799]
 gi|307630739|gb|ADN75041.1| riboflavin synthase, alpha subunit [Ferrimonas balearica DSM 9799]
          Length = 217

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  + P    +RL V T       ++LG SIA  G+CLTVV    EH  
Sbjct: 1   MFTGIIEAVGTLRKLEPRGGDLRLTVATGKLPMEDVQLGDSIATNGVCLTVVEKGAEH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V AET  +TN   + +G  +NLER+V    RL GHLVSGH+DG+ E++  +  
Sbjct: 59  ---YVADVSAETLALTNFPHYAVGHKVNLERAVTPSTRLGGHLVSGHVDGSAEVVARENR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   L  P  L +++  KGSV ++GVSLT+N V    F + ++ HT +ETT    +V
Sbjct: 116 ARAIEFWLQAPAELARYLPHKGSVTIDGVSLTLNEVDGARFRLTIVPHTAQETTLLDLQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +N+EVD + RY+ RL     +Q
Sbjct: 176 GDRVNLEVDLLARYLERLMQPAPTQ 200


>gi|290961889|ref|YP_003493071.1| riboflavin synthase subunit alpha [Streptomyces scabiei 87.22]
 gi|260651415|emb|CBG74537.1| putative riboflavin synthase alpha subunit [Streptomyces scabiei
           87.22]
          Length = 206

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 122/197 (61%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV    EH  D
Sbjct: 1   MFTGIVEELGEVTAVEKLGDSSRFRLRGPVVTEGARHGDSIAVNGVCLTVV----EHE-D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+  +V AE+ + +++ +  +G+ +NLER + +GDRL GH+V GH+DGT E++      
Sbjct: 56  DWFTADVMAESLQRSSLGALTVGSRVNLERPMAVGDRLGGHIVQGHVDGTGEVIERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G + F V LI  T++ TT    + G
Sbjct: 116 NWEIVKISLPADLTRYVVEKGSITVDGISLTVVDAGPDHFTVSLIPTTLDLTTLGRKQPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ RL
Sbjct: 176 DPVNLEVDVIAKYVERL 192


>gi|88859177|ref|ZP_01133818.1| Riboflavin synthase subunit E [Pseudoalteromonas tunicata D2]
 gi|88819403|gb|EAR29217.1| Riboflavin synthase subunit E [Pseudoalteromonas tunicata D2]
          Length = 218

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 122/201 (60%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I A+  I   + + V T   + S ++LG SIA  G+CLTVVRL     +
Sbjct: 1   MFTGIIAAVGQISALKKIGGDLSVTVKTGKLDLSDVQLGDSIATNGVCLTVVRL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T  A + +G  +NLE+++    RL GHLVSGHIDG   ++ +   
Sbjct: 56  ADGFMADVSQETLSLTGFAHYTVGQKVNLEKALMPTSRLGGHLVSGHIDGIATVVAMQAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS P +L ++I  KGSVC++G+SLTVN +  + F + ++ HT  ETT    KV
Sbjct: 116 GRAVDYWLSAPTHLLKYIPYKGSVCIDGISLTVNELNASQFKLTIVPHTAIETTISHFKV 175

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           G  +N+EVD + RY+ RL  L
Sbjct: 176 GSTVNLEVDQLARYMERLLTL 196


>gi|254507874|ref|ZP_05120004.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus 16]
 gi|219549247|gb|EED26242.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus 16]
          Length = 217

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + + +KLG SIA  G+CLTVV  SE    
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDISVTVNAGKLDMADVKLGDSIATNGVCLTVVAFSE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y  ++  ET + T  A +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -NSYTADLSLETLQKTGFADYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVAMPQEIAKYVAEKGSITVDGISLTVNALRKNAFKLTIVPHTGEETTIADFNV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQQEQ 200


>gi|88856441|ref|ZP_01131099.1| riboflavin synthase subunit alpha [marine actinobacterium PHSC20C1]
 gi|88814308|gb|EAR24172.1| riboflavin synthase subunit alpha [marine actinobacterium PHSC20C1]
          Length = 207

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+++ +     G+RL V      S    G SI+ +G+CLTVV         
Sbjct: 1   MFTGIIEELGEVVDLAATNDGVRLTVRAPQAVSDAGHGDSISVSGVCLTVVDQGP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+  +V   T  ++ + S   G+ +N+ER++++GDRL GH+V GHIDGT  +L +   G
Sbjct: 56  DWFTADVMGVTLDMSTLGSLAAGSRVNIERAMQVGDRLGGHIVQGHIDGTSTVLSVTDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SL   L   +A KGS+ ++GVSLTV+ VG+++F+V LI  T+  TT     VG
Sbjct: 116 SWNILRFSLTDELAPLVARKGSIAVHGVSLTVSAVGRDWFEVSLIPETLTATTLGALAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE D + R++AR+
Sbjct: 176 DSVNIETDILARHVARM 192


>gi|27363796|ref|NP_759324.1| riboflavin synthase subunit alpha [Vibrio vulnificus CMCP6]
 gi|161486647|ref|NP_933655.2| riboflavin synthase subunit alpha [Vibrio vulnificus YJ016]
 gi|27359913|gb|AAO08851.1| riboflavin synthase, alpha subunit [Vibrio vulnificus CMCP6]
          Length = 218

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 128/205 (62%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V T   + S +KLG SIA  G+CLTV+  S+ H  
Sbjct: 1   MFTGIIEAVGTLAAITPRGEDITVTVNTGKLDMSDVKLGDSIATNGVCLTVIDFSDRH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  E+ + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLESLKKTGFANYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVAMPESLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGDETTINDFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     +Q
Sbjct: 176 GRKVNLEVDVLARYMERLLLGQQAQ 200


>gi|313680605|ref|YP_004058344.1| riboflavin synthase, alpha subunit [Oceanithermus profundus DSM
           14977]
 gi|313153320|gb|ADR37171.1| riboflavin synthase, alpha subunit [Oceanithermus profundus DSM
           14977]
          Length = 196

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++    P    +R+ +         ++G SIA +G CLTVV LS      
Sbjct: 1   MFTGIVEEVGRVTQAEPKGGNLRVWIEAEKVLEGTEVGDSIATSGACLTVVELS-----P 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET + T    W  G  +NLER+ ++GDRLDGHLV+GH+DG   +   D   
Sbjct: 56  RGFAVELAQETVKRTA-PRWRPGARVNLERAARVGDRLDGHLVTGHVDGVGRVTRFDRRP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L ++IA KGS+ ++GVSLTV  V    F V LI HT++ TT    K G
Sbjct: 115 GAHDLYVEAPAELARYIAAKGSITIDGVSLTVVEVRGQVFSVTLIPHTLQVTTLGELKPG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E+D + RY+ RL  + T
Sbjct: 175 DAVNLEIDIIARYVERLLEVRT 196


>gi|37197788|dbj|BAC93626.1| riboflavin synthase alpha chain [Vibrio vulnificus YJ016]
          Length = 239

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 128/205 (62%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V T   + S +KLG SIA  G+CLTV+  S+ H  
Sbjct: 22  MFTGIIEAVGTLAAITPRGEDITVTVNTGKLDMSDVKLGDSIATNGVCLTVIDFSDRH-- 79

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  E+ + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 80  ---YSADLSLESLKKTGFANYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 136

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 137 GRAIEFWVAMPESLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGDETTINDFQV 196

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     +Q
Sbjct: 197 GRKVNLEVDVLARYMERLLLGQQAQ 221


>gi|312797041|ref|YP_004029963.1| riboflavin synthase alpha chain [Burkholderia rhizoxinica HKI 454]
 gi|312168816|emb|CBW75819.1| Riboflavin synthase alpha chain (EC 2.5.1.9) [Burkholderia
           rhizoxinica HKI 454]
          Length = 211

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 128/214 (59%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G RL +  S  N S + LG SIA  G CLTVV    
Sbjct: 1   MFTGIVAAVGRIESVTPLGASVEDGARLSIAASTLNLSDVGLGDSIAVQGACLTVV---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  +EV+V  ET N  T +A  G    +NLE++++  +RL GHLVSGH+DG  ++ 
Sbjct: 57  -DKTSTQFEVDVSRETLNCTTGLAQPG---EVNLEKALRAHERLGGHLVSGHVDGLGQVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
             + +G+S   R+  P +L ++ A KGS+ +NGVSLTVN V        F + +I HTI+
Sbjct: 113 RFEPVGESHELRIVAPSSLAKYFAYKGSITVNGVSLTVNAVQDQDDGCEFSINVIPHTIQ 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  +VGD +N+EVD + RY+ R+  L+TSQ
Sbjct: 173 MTTLRHLRVGDAVNLEVDMIARYVERM--LSTSQ 204


>gi|163750013|ref|ZP_02157257.1| riboflavin synthase subunit alpha [Shewanella benthica KT99]
 gi|161330287|gb|EDQ01268.1| riboflavin synthase subunit alpha [Shewanella benthica KT99]
          Length = 220

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 120/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +  +   +RL V ++  + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERLGDDIRLNVASNKLDLSDVRLGDSIATNGVCLTVV-----ECL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +    + 
Sbjct: 56  SDGYVADISAETVSLTGFAKYQVGTRVNLEKAVTPTTRLGGHMVSGHVDGVATVDDRQYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS P  L ++IA KGS+ L+GVSLTVN V  N F + ++ HT  ETT +  K 
Sbjct: 116 GKAIEFWLSAPAELARYIAHKGSITLDGVSLTVNEVQDNRFRLTIVPHTATETTLESLKA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + R++ RL
Sbjct: 176 GDKVNIEVDLIARHLERL 193


>gi|119945177|ref|YP_942857.1| riboflavin synthase subunit alpha [Psychromonas ingrahamii 37]
 gi|119863781|gb|ABM03258.1| riboflavin synthase, alpha subunit [Psychromonas ingrahamii 37]
          Length = 220

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+   AK + + V   S + S +K+G SI++ G+CLTV +LS     
Sbjct: 1   MFTGIIAAVGKVTAIKKNAKDITISVDAGSLDLSDVKVGDSISNNGVCLTVTKLS----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  ++  ET + +  +    G  +NLE+++++ DR  GH+VSGH+DG  E++ +D +
Sbjct: 56  DKSFNADLSNETLKRSGFSQIKNGFVLNLEKAMQMNDRFGGHIVSGHVDGVGEVISVDPL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+++   +  P  L ++IA KGS+ ++GVSLT N +    F + +I HTI +TT   +KV
Sbjct: 116 GNAVEYWIKAPDELAKYIAEKGSITVDGVSLTTNEINGAAFKLTIIPHTISQTTMVNYKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTQVNLEVDVISRYLERL 193


>gi|294141968|ref|YP_003557946.1| riboflavin synthase subunit alpha [Shewanella violacea DSS12]
 gi|293328437|dbj|BAJ03168.1| riboflavin synthase, alpha subunit [Shewanella violacea DSS12]
          Length = 220

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +  +   +RL V ++  + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERLGDDIRLNVASNKLDLSDVRLGDSIATNGVCLTVV-----ECL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +    + 
Sbjct: 56  SDGYVADISAETVSLTGFAKYQVGTKVNLEKAVTPTTRLGGHMVSGHVDGVASVDVRQYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   LS P +L ++IA KGS+ ++GVSLTVN V  N F + ++ HT  ETT +  K 
Sbjct: 116 GKSIEFWLSAPVDLARYIAHKGSITIDGVSLTVNEVKDNRFRLTIVPHTAGETTLESLKP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + R++ RL
Sbjct: 176 GDKVNIEVDLIARHLERL 193


>gi|295395080|ref|ZP_06805289.1| riboflavin synthase subunit alpha [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972028|gb|EFG47894.1| riboflavin synthase subunit alpha [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 214

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 120/214 (56%), Gaps = 13/214 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV  +  + A        R+ + T   T+ +  G S+A  G+CLT    +E  +  
Sbjct: 1   MFTGIVQKVVPVHAAEHRDGYARIVLETGELTADLPPGGSLAVNGVCLT---ETESPASA 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +   V  ET R+TN+ + G G+F+N+ER + + DRLDGH+V GH+D   E+L +  + 
Sbjct: 58  GRFTAHVMEETLRLTNLGALGAGSFVNVERCLAMTDRLDGHIVQGHVDAVGEVLAVTELA 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----------KNFFDVLLIRHTIE 170
            S   R+S+P +L   +AVKGSV LNGVSLTV  V            ++ +V LI  T E
Sbjct: 118 GSRIVRVSVPEHLAPLMAVKGSVALNGVSLTVTAVSDARPGAGVGPAHWVEVSLIPATCE 177

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT+   +VGDL+NIE D + RY ARL    T++
Sbjct: 178 NTTFGTAQVGDLVNIEADVVARYTARLNQFGTTK 211


>gi|332307439|ref|YP_004435290.1| riboflavin synthase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174768|gb|AEE24022.1| riboflavin synthase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 221

 Score =  141 bits (355), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 124/198 (62%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ D+G I ++TP    +RLR+ +   + S + LG SIA+ G+CLTVV +S     
Sbjct: 1   MFTGIIEDVGHIESLTPTGDDIRLRIRVNKLDMSDVALGDSIANNGVCLTVVDMSA---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + +  A +  G+ +NLE+++    R  GH+VSGH+DG  E++ ++ +
Sbjct: 57  -SGFSADVSHETIKRSGFADYKAGSKVNLEKAMLPSSRFGGHIVSGHVDGVGEVISVNPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G  +   +  P++L +++A KGS+ ++GVSLTVN V    F + LI H+++ET    +K 
Sbjct: 116 GRYVEIWVQAPNDLARYLAEKGSITVDGVSLTVNAVDGAKFLITLIPHSLQETIIGGYKK 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  IN+EVD + RY+ RL
Sbjct: 176 GTKINLEVDVVARYLERL 193


>gi|50083527|ref|YP_045037.1| riboflavin synthase subunit alpha [Acinetobacter sp. ADP1]
 gi|49529503|emb|CAG67215.1| riboflavin synthase alpha chain [Acinetobacter sp. ADP1]
          Length = 219

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G++ ++  +   +RLR+ T  + S + LG SIA  GICLTV+   +     
Sbjct: 1   MFTGIIESLGQVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQPVNVEKAMLPTTRFGGHIVSGHVDAVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGSV ++G+SLT+N +  N   + LI HT E T     K G
Sbjct: 116 RSIYYEVTAPAEIAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNISTWKTG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|254282467|ref|ZP_04957435.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR51-B]
 gi|219678670|gb|EED35019.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR51-B]
          Length = 218

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I AM P    +RLR+ T   + S ++LG SI  +G CLTV  L      
Sbjct: 1   MFTGIIEAVGEIAAMEPRGGDLRLRIRTGKLDLSDVQLGDSICTSGTCLTVTELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  ET   T +     G  +NLERS+    RL GH+VSGH+DG  E++ +D  
Sbjct: 56  GDGYWADVSVETLNFTTLGDKKPGNRVNLERSLTPASRLGGHIVSGHVDGVGEVVAVDQD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P +L ++IA KGS+C++G SLTVN V    F++ +I  T++ET +  ++ 
Sbjct: 116 ARSWRYSVEAPPDLARYIAHKGSICVDGTSLTVNAVHGGRFELNIIPQTLQETVFGEYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSRVNLEVDVIARYLERL 193


>gi|319786234|ref|YP_004145709.1| riboflavin synthase, subunit alpha [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464746|gb|ADV26478.1| riboflavin synthase, alpha subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 206

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 117/210 (55%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS------YNTSKMKLGCSIAHAGICLTVVRLS 54
           MFTGI+  +G++ A  P    +R    T           +++LG SIA  G+CLTV+  +
Sbjct: 1   MFTGIIEGVGRLAAREPRGGDVRFSFATGTLPWLDSGADEIRLGESIAVNGVCLTVIAFN 60

Query: 55  EEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
            +      ++ +   ET  +T +    +G  +NLER+++  DRL GH+VSGH+DG   +L
Sbjct: 61  AQ-----GFQADASTETLALTTLGELPVGAALNLERAMRPTDRLGGHMVSGHVDGIGRVL 115

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW 174
            +     +   R + P  L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T +
Sbjct: 116 SVHEDARAQRWRFAAPQQLLKYIAKKGSICVDGVSLTVNEVDGEGFEVALIPHTVAHTRF 175

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
              KVG+ +N+E+D + RY+ RL      Q
Sbjct: 176 AETKVGEAVNLEIDLVARYVERLLGERGGQ 205


>gi|262376971|ref|ZP_06070197.1| riboflavin synthase, alpha subunit [Acinetobacter lwoffii SH145]
 gi|262308009|gb|EEY89146.1| riboflavin synthase, alpha subunit [Acinetobacter lwoffii SH145]
          Length = 219

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+   E     
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIDWGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W  G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGTWKAGQPVNVEKAMLPTTRFGGHIVSGHVDAVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGSV ++G+SLT+N +  +   + LI HT E T     KVG
Sbjct: 116 RSIYYEVTAPAEIAKYLAEKGSVTVDGISLTINHLRGSVISLNLIPHTAERTNIGTWKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SKVNLEVDVLARYIERL 192


>gi|320157205|ref|YP_004189584.1| riboflavin synthase subunit alpha [Vibrio vulnificus MO6-24/O]
 gi|319932517|gb|ADV87381.1| riboflavin synthase alpha chain [Vibrio vulnificus MO6-24/O]
          Length = 218

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 127/205 (61%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V T   + S +KLG SIA  G+CLTV+  S+ H  
Sbjct: 1   MFTGIIEAVGTLAAITPRGEDITVTVDTGKLDMSDVKLGDSIATNGVCLTVIDFSDRH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  E+ + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLESLKKTGFANYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVVMPESLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGDETTINDFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     +Q
Sbjct: 176 GRKVNLEVDVLARYMERLLLGQQTQ 200


>gi|194290428|ref|YP_002006335.1| riboflavin synthase subunit alpha [Cupriavidus taiwanensis LMG
           19424]
 gi|193224263|emb|CAQ70272.1| RIBOFLAVIN SYNTHASE (ALPHA CHAIN) PROTEIN [Cupriavidus taiwanensis
           LMG 19424]
          Length = 207

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 129/214 (60%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G+RLR+     + S + +G SIA  G C+TV+ ++ 
Sbjct: 1   MFTGIVAAVGRIESVTPLGAAADAGVRLRIAAGGLDLSDVIIGDSIAIQGACMTVIAMAP 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                + +EVEV  E+ ++   +   G    +NLE++++L DRL GHLVSGH+DG  E++
Sbjct: 61  -----DAFEVEVSRESLDKTVGLDRAG---RVNLEKALRLADRLGGHLVSGHVDGLGEVV 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+E
Sbjct: 113 HFAPVGESHELRIRAPRELARYLAYKGSVVVNGVSLTVNRVADEADGCVFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  K G  +N+E+D + RY+ R+  L+ +Q
Sbjct: 173 VTTLQELKPGARVNLEIDLIARYVERM--LSAAQ 204


>gi|87200871|ref|YP_498128.1| riboflavin synthase subunit alpha [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136552|gb|ABD27294.1| riboflavin synthase, alpha subunit [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 207

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 122/206 (59%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMR-LRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIVT++G I+A+    KG R + +  + + +K+ +G SIA +G+CLTVV        
Sbjct: 1   MFTGIVTEVGNILAIE--DKGDRHVTISCAMDPAKIAIGASIACSGVCLTVVDKGGVAG- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           + W+ V+V  ET   T    W +G  +NLE ++KLGD L GH+V+GH+D   E++ +   
Sbjct: 58  EGWFAVDVSGETVSRTAPEQWTVGAPLNLEPALKLGDELGGHIVTGHVDAVGEVVGVCPE 117

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTW 174
           G S+   +S P  L  +IA KGS+ +NGVSLTVN V     G   F + +I HT + TT 
Sbjct: 118 GASLKFGISAPKELAPYIAAKGSITVNGVSLTVNEVADQPDGSCHFALNIIPHTAQVTTL 177

Query: 175 KMHKVGDLINIEVDSMMRYIARLYAL 200
                G  +N+E+D + RY+ R+ +L
Sbjct: 178 GTLAPGHKVNLEIDVLARYLKRMQSL 203


>gi|163803479|ref|ZP_02197351.1| riboflavin synthase subunit alpha [Vibrio sp. AND4]
 gi|159172739|gb|EDP57588.1| riboflavin synthase subunit alpha [Vibrio sp. AND4]
          Length = 217

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 125/205 (60%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V +   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGELDMSDVKLGDSIATNGVCLTVVDFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D++Y  ++  ET   T  A++ +G  +NLE+++    R  GH+VSGH+DG   I+  + +
Sbjct: 56  DHYYSADLSLETLNKTGFAAYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGVIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVEMPAEIGKYVAEKGSITVDGISLTVNDLRKNGFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL   +  Q
Sbjct: 176 GRKVNLEVDVLARYMERLLQGHKEQ 200


>gi|71909704|ref|YP_287291.1| riboflavin synthase subunit alpha [Dechloromonas aromatica RCB]
 gi|71849325|gb|AAZ48821.1| Lumazine-binding protein [Dechloromonas aromatica RCB]
          Length = 197

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 114/199 (57%), Gaps = 10/199 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GI+  +G+II +TP   G RL V         + LG SIAH G+CLTVV        
Sbjct: 1   MFSGIIAAVGRIIEITPREVGCRLHVDAGKLKLDDVALGDSIAHNGVCLTVVARE----- 55

Query: 60  DNWYEVEVWAETNRIT-NIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            N + V+V  ET   T  +A  G    +NLE++++L D + GHLVSGH+DG  E+L  D 
Sbjct: 56  GNTFAVDVSPETLSCTVGLAEPG---PVNLEKALRLSDVIGGHLVSGHVDGVGEVLRFDA 112

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           IGD+    +  P  + ++IA KGS+ ++G SLT N V    F + LI HT+E TT    K
Sbjct: 113 IGDNRLLEIRAPKEIAKYIARKGSIVIDGTSLTTNAVNGTDFTINLIPHTLENTTLNRLK 172

Query: 179 VGDLINIEVDSMMRYIARL 197
            G  +N+EVD + RY  RL
Sbjct: 173 PGSKVNLEVDLIARYCERL 191


>gi|312226849|gb|ADQ50170.1| riboflavin synthase C [Bartonella henselae]
          Length = 158

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 100/158 (63%), Gaps = 2/158 (1%)

Query: 28  TSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFI 86
           T Y+   +K+G S A +G+CLT+V R S++ +  NW+ VE W E  R+TN+  W  GTFI
Sbjct: 1   TLYDVENLKIGASFACSGVCLTIVERGSKQQANINWFAVEAWEEALRLTNLTQWTKGTFI 60

Query: 87  NLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLN 146
           NLERS++LGD + GHLVSG I G  EI+     GD     L +P  L  FIA KGS+ LN
Sbjct: 61  NLERSLRLGDEMGGHLVSG-IYGLAEIIEKKNEGDDTRFHLLVPMQLAPFIAEKGSIALN 119

Query: 147 GVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLIN 184
           G SL+VN V  N FD L+I HT++ T    H+ GD +N
Sbjct: 120 GTSLSVNYVENNIFDDLIILHTLDMTICGQHEGGDHVN 157


>gi|300855386|ref|YP_003780370.1| riboflavin synthase subunit alpha [Clostridium ljungdahlii DSM
           13528]
 gi|300435501|gb|ADK15268.1| riboflavin synthase alpha chain [Clostridium ljungdahlii DSM 13528]
          Length = 217

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 124/197 (62%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG+I+ ++      ++ +        +KLG SIA  G C+TVV L +     
Sbjct: 1   MFTGLVEEIGEILKISRGRNSSKVSIKVGNLLDGVKLGDSIAVNGTCVTVVDLKK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V++ AET R++++    IG+ +NLER+++LGDRL GH+VSGHIDGT +I+ +    
Sbjct: 56  NSFTVDIMAETLRMSSLKDLKIGSKVNLERALRLGDRLGGHIVSGHIDGTGKIVDVREED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S +  +   ++L ++I  KGSV ++GVSLTV  + KN F V LI HT  ET     K+G
Sbjct: 116 ISTWIDIEASYDLLRYIVRKGSVTIDGVSLTVAELNKNCFSVSLIPHTKMETILDYKKIG 175

Query: 181 DLINIEVDSMMRYIARL 197
           DL+NIE D + +Y+ ++
Sbjct: 176 DLVNIECDLIGKYVEKM 192


>gi|289209045|ref|YP_003461111.1| riboflavin synthase, subunit alpha [Thioalkalivibrio sp. K90mix]
 gi|288944676|gb|ADC72375.1| riboflavin synthase, alpha subunit [Thioalkalivibrio sp. K90mix]
          Length = 227

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP    +RL V     + S  +LG SIA  G+CLTV  L+     
Sbjct: 1   MFTGIIETLGNLDRLTPSGGDVRLYVNAPGMDLSDTRLGDSIAVNGVCLTVTDLTT---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  E+  +T + + G G  +NLER++ LGDRL GH+VSGH+DG  E++ ++  
Sbjct: 57  -GGFAADVSRESLDVTTLGALGPGDRVNLERALALGDRLGGHMVSGHVDGVGEVIAMEPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   R   P  L ++IA KGS+ ++G SLTVN V    F+V +I HT   T + ++ V
Sbjct: 116 ARSTRVRFRAPAALARYIAAKGSITIDGTSLTVNRVDGAEFEVNIIPHTWSLTRFSVYAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTPVNLEVDLIARYLERL 193


>gi|85710329|ref|ZP_01041394.1| riboflavin synthase subunit alpha [Erythrobacter sp. NAP1]
 gi|85689039|gb|EAQ29043.1| riboflavin synthase subunit alpha [Erythrobacter sp. NAP1]
          Length = 207

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 120/209 (57%), Gaps = 7/209 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG I A       +RLRV    + +++ +G SIA +G+CLTVV    E   D
Sbjct: 1   MFTGIVTAIGTI-ANVDQRGDIRLRVNAPLDPARIDIGASIACSGVCLTVVERGGEKG-D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V+V  ET   T    W  G  IN+E S+++GD L GH+V+GH+D    ++  + +G
Sbjct: 59  AWFDVDVSGETVSRTYAGMWNEGARINIEPSLRVGDELGGHIVTGHVDSVGTVVKAEEVG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
           DS    +     +  FIA KGS+ +NGVSLTVN V     G   F + +I HT E TT  
Sbjct: 119 DSWRIAIRARAEMSPFIAEKGSITVNGVSLTVNDVRDRSDGTCDFMLNIIPHTAEVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTSQ 204
             K GD +N+E+D + RY+ R+  L  ++
Sbjct: 179 DLKEGDEVNLEIDVLARYLKRMQGLAATR 207


>gi|149369318|ref|ZP_01889170.1| riboflavin synthase subunit alpha [unidentified eubacterium SCB49]
 gi|149356745|gb|EDM45300.1| riboflavin synthase subunit alpha [unidentified eubacterium SCB49]
          Length = 196

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  IG I ++      + + V T+  T ++K+  S+AH G+CLTVV +      D
Sbjct: 1   MFTGIIETIGTIKSLEKDGANLHMEV-TALFTQELKIDQSVAHNGVCLTVVSIK-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+V    ET   T ++S  IG+ +NLER +KLGDRLDGH+V GH+D T     ++   
Sbjct: 55  TSYKVTAIKETLDKTTLSSLEIGSPVNLERGMKLGDRLDGHIVQGHVDQTATCTAINEAN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S     +   +L      KGS+ +NGVSLTV   GK+FF V +I  T E TT+K  + G
Sbjct: 115 GSWKFTFNYNSSLGNITIEKGSITINGVSLTVVDSGKDFFSVAIIPFTYEHTTFKNLQKG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ARL  L++
Sbjct: 175 DFVNLEFDVIGKYVARLTQLSS 196


>gi|302561768|ref|ZP_07314110.1| riboflavin synthase, alpha subunit [Streptomyces griseoflavus
           Tu4000]
 gi|302479386|gb|EFL42479.1| riboflavin synthase, alpha subunit [Streptomyces griseoflavus
           Tu4000]
          Length = 240

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I A+  +    R R+     T   K G SIA  G+CLTVV    EH  D
Sbjct: 37  VFTGIVEELGEITAVETLDDACRFRLRGPVVTEGAKHGDSIAVNGVCLTVV----EHEGD 92

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++    +G+ +NLER   +G RL GH+V GH+DGT EIL  +   
Sbjct: 93  E-FTADVMAETLKRSSLGVLAVGSRVNLERPTAVGSRLGGHIVQGHVDGTGEILGREPSE 151

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R+SLP  L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + G
Sbjct: 152 NWEIVRISLPAGLSRYVVEKGSITVDGISLTVVDAGSDFFTVSLIPTTLALTTLGIKQPG 211

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ R+
Sbjct: 212 DPVNLEVDVIAKYVERM 228


>gi|256392293|ref|YP_003113857.1| riboflavin synthase, subunit alpha [Catenulispora acidiphila DSM
           44928]
 gi|256358519|gb|ACU72016.1| riboflavin synthase, alpha subunit [Catenulispora acidiphila DSM
           44928]
          Length = 223

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+       RLRV  S  TS  + G SIA  G+CLTV+   ++ +  
Sbjct: 1   MFTGIVEELGRVVALEADGDSARLRVAGSLVTSDAEHGSSIAVNGVCLTVIESGDQAAKA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +N+     G  +NLER +KLG RL GHLV GH+DG V ++     G
Sbjct: 61  GEFTADVMAETLDKSNLGDLKPGDPVNLERPMKLGARLGGHLVQGHVDG-VGVVLERIPG 119

Query: 121 DS-MYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +     R+SLP  L +++  KGS+ ++G+SLTV     + F V LI  T+E TT      
Sbjct: 120 EHWEVVRVSLPSALSRYVVDKGSITVDGISLTVVEAAADSFTVSLIPTTLELTTLGSKGP 179

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + +Y  RL  L+
Sbjct: 180 GAAVNLEIDVIAKYTERLLGLD 201


>gi|109897637|ref|YP_660892.1| riboflavin synthase subunit alpha [Pseudoalteromonas atlantica T6c]
 gi|109699918|gb|ABG39838.1| riboflavin synthase, alpha subunit [Pseudoalteromonas atlantica
           T6c]
          Length = 221

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 123/198 (62%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ D+G I ++TP    +RLR+ +   + S + LG SIA+ G+CLTVV ++     
Sbjct: 1   MFTGIIEDVGHIESLTPTGDDIRLRIRVNKLDMSDVALGDSIANNGVCLTVVDMNS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + +  A +  G+ +NLE+++    R  GH+VSGH+DG  E++ ++ +
Sbjct: 57  -SGFSADVSHETIKRSGFADYKAGSKVNLEKAMLPTSRFGGHIVSGHVDGVGEVVSVNPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G  +   +  P +L +++A KGS+ ++GVSLTVN V    F + LI H++EET    +K 
Sbjct: 116 GRYVEIWVQAPKDLARYLAEKGSITVDGVSLTVNAVEGAKFLITLIPHSLEETIIGGYKK 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  IN+EVD + RY+ RL
Sbjct: 176 GTKINLEVDVVARYLERL 193


>gi|224370209|ref|YP_002604373.1| RibE [Desulfobacterium autotrophicum HRM2]
 gi|223692926|gb|ACN16209.1| RibE [Desulfobacterium autotrophicum HRM2]
          Length = 222

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G +  + P  +G RL + T  +    K+G SIA  G CLTVV LS     +
Sbjct: 1   MFTGIIEGAGTLKKIQPNGEGKRLAIQTGMDLEGTKIGDSIAVNGACLTVVSLS-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EV++  ET   T   S   G  +NLER+++L DRLDGHLVSGHID T  ++      
Sbjct: 56  SVFEVDMAPETVSRTTFKSLLPGARLNLERALRLSDRLDGHLVSGHIDATGSVVSKTVKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   + +P  L   I  KGSV ++G+SLT+N      FDV +I HT + TT    +VG
Sbjct: 116 NAVIVTIGIPETLGDEIIEKGSVAIDGISLTINRCSHKDFDVSVIPHTAKITTIGTARVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE D + +Y+ R 
Sbjct: 176 DSVNIETDMIGKYVNRF 192


>gi|254386272|ref|ZP_05001581.1| riboflavin synthase subunit alpha [Streptomyces sp. Mg1]
 gi|194345126|gb|EDX26092.1| riboflavin synthase subunit alpha [Streptomyces sp. Mg1]
          Length = 209

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 117/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A+  R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLAEASRFRLRGPVVTEGAKHGDSIAVNGVCLTVV-----ETAD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ + G G+ +NLER + LG RL GHLV GH+DGT EIL      
Sbjct: 56  GEFTADVMQETLNRSSLGTLGQGSRVNLERPMALGGRLGGHLVQGHVDGTGEILSRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                +++LP +L +++  KGS+ ++GVSLTV     + F + LI  T+  TT  + + G
Sbjct: 116 HWELVKVALPAHLARYVVEKGSITVDGVSLTVVEAAADHFTISLIPTTLALTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ RL A
Sbjct: 176 DPVNLEVDVLAKYVERLLA 194


>gi|149909346|ref|ZP_01898002.1| riboflavin synthase subunit alpha [Moritella sp. PE36]
 gi|149807663|gb|EDM67611.1| riboflavin synthase subunit alpha [Moritella sp. PE36]
          Length = 221

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 120/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP    + + V +   + S +KLG SIA  G+CLTVV L     +
Sbjct: 1   MFTGIIETVGTLTGLTPKGADVSITVDSGDLDLSDVKLGDSIATNGVCLTVVEL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y  +V  ET + +  A + IG  +NLE+++ L  RL GHLVSGH+DG  EI+ +  +
Sbjct: 56  GNGYRADVSLETIKRSGFAHYRIGDKVNLEKALTLSTRLGGHLVSGHVDGVAEIVKISKL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G +    L  P+ L ++IA KGS+ ++G+SLT+N +    F + ++ HT  ETT + + V
Sbjct: 116 GRATEYWLQAPNELARYIAEKGSITIDGISLTINEIDGAKFKLTIVPHTALETTIESYVV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ R+
Sbjct: 176 GRKVNLEVDVIARYLERI 193


>gi|113868805|ref|YP_727294.1| riboflavin synthase subunit alpha [Ralstonia eutropha H16]
 gi|113527581|emb|CAJ93926.1| riboflavin synthase alpha chain [Ralstonia eutropha H16]
          Length = 206

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 130/213 (61%), Gaps = 19/213 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  +G+I ++TP+     G+RL +     + S + +G SIA  G C+TV+ ++  
Sbjct: 1   MFTGIVAAVGRIDSVTPLGAADAGVRLHIAAGGLDLSDVIIGDSIAIQGACMTVIAMAP- 59

Query: 57  HSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               + ++VEV  E+ ++   + S G    +NLE++++L DRL GHLVSGH+DG  E++ 
Sbjct: 60  ----DSFDVEVSRESLDKTVGLESTG---RVNLEKALRLADRLGGHLVSGHVDGLGEVVH 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+E 
Sbjct: 113 FAPVGESHELRIRAPRELARYLAYKGSVVVNGVSLTVNRVNDEADGCVFSINLIPHTVEV 172

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           TT +  K G  +N+E+D + RY+ R+  L+T+Q
Sbjct: 173 TTLQELKPGARVNLEIDLIARYVERM--LSTAQ 203


>gi|312226851|gb|ADQ50171.1| riboflavin synthase C [Bartonella henselae]
          Length = 169

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/163 (46%), Positives = 103/163 (63%), Gaps = 5/163 (3%)

Query: 28  TSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFI 86
           T Y+   +++G SIA +G+CLT+V R S++ +  NW+ VE W E  R+TN+  W  GTFI
Sbjct: 1   TRYSIENLEIGASIACSGVCLTIVERGSKQQAKINWFAVEAWEEALRLTNLTQWTKGTFI 60

Query: 87  NLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLN 146
           NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +P     FI  KGS+ LN
Sbjct: 61  NLERSLRLGDEMGGHLVSGHIDGLAEIIDQKSEGDAVRFFLQVPKRFIPFIVNKGSIALN 120

Query: 147 GVSLTVNLVGKNFF--DVLLIRHTIEETTWKMHKVGDLINIEV 187
           G SLT N V  +FF    LLIR T+  T  +   +GDL++  V
Sbjct: 121 GTSLTANCV--DFFINYGLLIRRTLVLTFSRQASIGDLVHFPV 161


>gi|269962350|ref|ZP_06176700.1| Riboflavin synthase alpha chain [Vibrio harveyi 1DA3]
 gi|269832846|gb|EEZ86955.1| Riboflavin synthase alpha chain [Vibrio harveyi 1DA3]
          Length = 217

 Score =  138 bits (348), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 122/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMADVKLGDSIATNGVCLTVVDFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET   T  A++ +G  +NLE+++    R  GH+VSGH+DG   I+  + +
Sbjct: 56  SNYYSADLSLETLNKTGFAAYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGVIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVEMPAEITKYVAEKGSITVDGISLTVNDLRKNGFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|237756117|ref|ZP_04584691.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691721|gb|EEP60755.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 210

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 119/204 (58%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GKI A+     G++++V  +     +KLG S+A  G+CLTVV + +     
Sbjct: 1   MFTGLIEEVGKISAINKKDDGLKIKVECNKILDDIKLGDSVAVNGVCLTVVNIDK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  + EV  ET + +N     I  ++NLER++    RL GH+V GH+D T EI  +  +G
Sbjct: 56  NSLDFEVSNETIKRSNFKFLKINEYVNLERAMTPSSRLGGHIVQGHVDTTGEITSITNLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++  P   +  +  KGS+ ++G+SLT+N + +N  D+ +I HT E T  K  KVG
Sbjct: 116 KHTNIKIRFPSEYDYLVIEKGSIAIDGISLTINYINENVIDLNIIPHTWENTNLKYRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+A++  L   +
Sbjct: 176 DIVNIEFDILGKYVAKMLNLGKQK 199


>gi|332186908|ref|ZP_08388649.1| riboflavin synthase, alpha subunit [Sphingomonas sp. S17]
 gi|332012918|gb|EGI54982.1| riboflavin synthase, alpha subunit [Sphingomonas sp. S17]
          Length = 200

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 124/203 (61%), Gaps = 15/203 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIVTDIG + A+   A+G  R+ + T+Y+T+ + LG SIA +G+CLTVV        
Sbjct: 1   MFTGIVTDIGSVTAVE--ARGDTRVVIATAYDTASIDLGASIACSGVCLTVVEKGP---- 54

Query: 60  DNWYEVEVWAETNRITNIA-SWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            +W+ V+V AET  I+  A  W  G  +NLER++KLGD L GH+V+GH+DG  +++ +  
Sbjct: 55  -DWFAVDVSAET--ISRTADQWHQGRPLNLERAMKLGDELGGHIVTGHVDGVGQVVSVTE 111

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTW 174
            G S    +++P +L  F+A KGSV ++GVSLTVN V          + +I HT   TT 
Sbjct: 112 EGGSHRVFVTVPADLAPFMATKGSVTVDGVSLTVNSVEDGPEGTVIGLNIIPHTAAVTTL 171

Query: 175 KMHKVGDLINIEVDSMMRYIARL 197
                G  +NIE+D + RY+ R+
Sbjct: 172 GGIIQGQRVNIEIDVLARYLQRM 194


>gi|320449998|ref|YP_004202094.1| riboflavin synthase subunit alpha [Thermus scotoductus SA-01]
 gi|320150167|gb|ADW21545.1| riboflavin synthase, subunit alpha [Thermus scotoductus SA-01]
          Length = 194

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 121/198 (61%), Gaps = 9/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G+I+ +      +R+R+      S +++G S+A  G+CLT V + E     
Sbjct: 1   MFTGLVEETGEIVEVRE-GPFLRVRIAAKEVLSDLRVGDSVAVDGVCLTAVEVDE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG  E++ +    
Sbjct: 55  GGFWVELARETLRRTA-PTWRVGHRPNLERALKVGDRLGGHFVTGHVDGVAEVVAIREAP 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-NLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +      LP +L ++IA KGSV LNGVSLTV  L G++FF V LI HT++ T     KV
Sbjct: 114 GAKDYFFRLPQDLARYIAEKGSVALNGVSLTVAGLKGQDFF-VTLIPHTLKVTNLGSLKV 172

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + RY+ RL
Sbjct: 173 GDGVNLEVDLIARYLERL 190


>gi|149187996|ref|ZP_01866291.1| riboflavin synthase subunit alpha [Vibrio shilonii AK1]
 gi|148837984|gb|EDL54926.1| riboflavin synthase subunit alpha [Vibrio shilonii AK1]
          Length = 217

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP  + + + V +   + S +KLG SIA  G+CLTV   +     
Sbjct: 1   MFTGIIEAVGTLKGITPKGEDISIHVEVGKLDMSDVKLGDSIATNGVCLTVTSFT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           DN Y  ++  ET + T  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 56  DNSYHADLSVETLKKTGFAHYSVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVDRQQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  L +++A KGS+ ++G+SLTVN V K+ F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVQMPSELGKYVAEKGSITVDGISLTVNDVRKDAFKLTIVPHTSEETTIDNFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  IN+EVD + RY+ RL     S
Sbjct: 176 GRKINLEVDVLARYMERLLQSKAS 199


>gi|312963302|ref|ZP_07777785.1| riboflavin synthase alpha chain [Pseudomonas fluorescens WH6]
 gi|311282382|gb|EFQ60980.1| riboflavin synthase alpha chain [Pseudomonas fluorescens WH6]
          Length = 220

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +RL V T   +   +KLG SIA +G+CLTVV L      
Sbjct: 1   MFTGIIESIGSIRAMTPKGGDVRLLVDTGKLDLGDVKLGDSIAVSGVCLTVVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T ++    G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLDCTAMSDLKAGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARSEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ +I HT+ ET    ++ 
Sbjct: 116 ARAVEFRIRAPKALAKYIAHKGSITVDGTSLTVNAVNGAEFELTIIPHTLSETIMASYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|283765826|gb|ADB28305.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 67/140 (47%), Positives = 90/140 (64%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ KG+RL++ T Y+   +++G SIA +GICLTVV    +  + NW+ VE W 
Sbjct: 1   GCVEDVQPLKKGVRLKISTHYDIESLEIGASIACSGICLTVVERGLKQEMTNWFTVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GTF+NLERS++LGD L GHLV GHIDG  EI+     GD++   L  
Sbjct: 61  EALRLTNLAQWTKGTFVNLERSLRLGDELGGHLVFGHIDGLAEIIEKKNEGDAVRFHLQA 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P  L  FI  KGS+ LNG S
Sbjct: 121 PARLTSFIVNKGSIALNGTS 140


>gi|296283378|ref|ZP_06861376.1| riboflavin synthase subunit alpha [Citromicrobium bathyomarinum
           JL354]
          Length = 205

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG + A+      + +R+   ++  ++ +G SIA +G+CLTV         D
Sbjct: 1   MFTGIVTAIGTVAAIEQRGD-LHVRIACPFDPERIAIGASIACSGVCLTVTERGGSAG-D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V  ET   T    W  G  +NLE S++LGD L GHLV+GH+D   E+     + 
Sbjct: 59  AWFAVDVSQETVSRTVPGLWEEGRKLNLEPSLRLGDELGGHLVTGHVDAVGEVAERRSVD 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
            S++  +  P  L  FIA KGS+ ++GVSLTVN V     G   F + +I HT E TT  
Sbjct: 119 GSIHFEIRAPKALAPFIAAKGSITVDGVSLTVNAVEDEADGSARFALNIIPHTGEVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
               GD +N+E+D + RY+ R+ AL
Sbjct: 179 ALSEGDKVNLEIDVLARYLKRMQAL 203


>gi|161486750|ref|YP_507060.2| riboflavin synthase subunit alpha [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 202

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MF GI+ DIG II +       R  V+   N    S+ K+G SI  +GICL+ V L  E 
Sbjct: 1   MFKGIIEDIGTIIQVDYTKGQDRRLVIKPTNANFLSETKIGDSIGCSGICLSAVELDNE- 59

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                +  +V   T  +T+ A W  GT INLE  +K+ DRLDGH V GH+DG   I+ + 
Sbjct: 60  ----CFSADVSDATLSVTSAAHWKEGTKINLELPLKMTDRLDGHFVQGHVDGVGNIISIT 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +  S      +P  L +++  KGS+ ++GVSLT+N +  N   V +I HT ++TT++ +
Sbjct: 116 NVNSSHNIEFHIPDALLKYMIRKGSIAIDGVSLTINSISNNILSVNIIPHTWKKTTFQYN 175

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
           KV D INIEVD + +++ RLY  N
Sbjct: 176 KVNDNINIEVDMLAKHLERLYEHN 199


>gi|302533294|ref|ZP_07285636.1| riboflavin synthase, alpha subunit [Streptomyces sp. C]
 gi|302442189|gb|EFL14005.1| riboflavin synthase, alpha subunit [Streptomyces sp. C]
          Length = 207

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A+  R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLAEASRFRLRGPVVTEGAKHGDSIAVNGVCLTVV-----ETED 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GEFTADVMQETLNRSSLGALAAGSRVNLERPMALGGRLGGHLVQGHVDGTGRIISRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP NL +++  KGS+ ++GVSLTV     ++F + LI  T+  TT  + + G
Sbjct: 116 HWEIVKVSLPENLARYVVEKGSITVDGVSLTVVEAAADYFTISLIPTTLALTTLGIKQSG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ RL A
Sbjct: 176 DPVNLEVDVLAKYVERLLA 194


>gi|307326835|ref|ZP_07606027.1| riboflavin synthase, alpha subunit [Streptomyces violaceusniger Tu
           4113]
 gi|306887598|gb|EFN18592.1| riboflavin synthase, alpha subunit [Streptomyces violaceusniger Tu
           4113]
          Length = 240

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 118/197 (59%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +    R +V     T   K G SIA  G+CLTVV L E+ +  
Sbjct: 1   MFTGIVEELGEIVAIEHLGDASRFQVRGPVVTEGAKHGDSIAVNGVCLTVVDLIED-AEG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  IG+ +NLER + LG RL GH+V GH+DGT  I+      
Sbjct: 60  TRFSADVMAETLDRSSLGALDIGSRVNLERPMALGGRLGGHIVQGHVDGTGAIVDRKLSE 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 120 HWEIVKISLPAELSRYVVEKGSITVDGISLTVVDAGSDYFTVSLIPTTLALTTLGVKQAG 179

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ RL
Sbjct: 180 DPVNLEVDVLAKYVERL 196


>gi|291295638|ref|YP_003507036.1| riboflavin synthase subunit alpha [Meiothermus ruber DSM 1279]
 gi|290470597|gb|ADD28016.1| riboflavin synthase, alpha subunit [Meiothermus ruber DSM 1279]
          Length = 209

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 115/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV + G I     +    RL +         +LG S+A +G+CLTVV L  E    
Sbjct: 1   MFSGIVEETGVIREAREMGGLRRLFIEAQRALEGTRLGDSVAVSGVCLTVVELGSEG--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T    W +G  +NLER++ LGDRL GHLV+GH+DG   ++ ++   
Sbjct: 58  --FAVELAQETLRRT-ARRWEVGQRVNLERALALGDRLGGHLVTGHVDGRARVVRINREM 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    L +P  L ++IA KGSV L+GVSLTV  V  N F V LI HT+E TT K    G
Sbjct: 115 GAWDVWLEVPQELTRYIAPKGSVALDGVSLTVAGVEGNRFWVTLIPHTLEVTTLKELAEG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY+ RL +
Sbjct: 175 DEVNLEVDLLARYLERLVS 193


>gi|332296596|ref|YP_004438519.1| riboflavin synthase, alpha subunit [Thermodesulfobium narugense DSM
           14796]
 gi|332179699|gb|AEE15388.1| riboflavin synthase, alpha subunit [Thermodesulfobium narugense DSM
           14796]
          Length = 197

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G+II+ +P   G ++++        +K+  SIA  G+CLTV +++ +    
Sbjct: 1   MFTGIIEDVGQIISFSPQGYGYKIKISFKKQFDDLKISDSIAVDGVCLTVTKINGQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +E ++  ET  +T       G  +NLER++K   R  GH+V GH+D   +I  +    
Sbjct: 58  --FEADISKETVSVTTFKHLKAGMKVNLERAMKHDSRFGGHIVLGHVDAVGKIASIKSEK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L+++IA KGS+ +NG+SLT+  V +N FDV LI  TI+ET+    KVG
Sbjct: 116 LNTILTVEFPLQLKKYIAHKGSIAINGISLTIAAVKENSFDVALIPLTIKETSLSDKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
            L+NIEVD + RYI  L
Sbjct: 176 SLVNIEVDVISRYIENL 192


>gi|21219945|ref|NP_625724.1| riboflavin synthase subunit alpha [Streptomyces coelicolor A3(2)]
 gi|256788955|ref|ZP_05527386.1| riboflavin synthase subunit alpha [Streptomyces lividans TK24]
 gi|289772843|ref|ZP_06532221.1| riboflavin synthase, alpha subunit [Streptomyces lividans TK24]
 gi|11493385|emb|CAC17561.1| putative riboflavin synthase [Streptomyces coelicolor A3(2)]
 gi|289703042|gb|EFD70471.1| riboflavin synthase, alpha subunit [Streptomyces lividans TK24]
          Length = 200

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 118/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A+  +    R RV     T   + G SIA  G+CLTVV    +H  D
Sbjct: 1   MFTGIVEELGEITAVETLDDACRFRVRGPAVTEGARHGDSIAVNGVCLTVV----DHEGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER   +G RL GH+V GH+DGT EIL      
Sbjct: 57  -AFTADVMAETLNRSSLGALAVGSRVNLERPTAVGARLGGHIVQGHVDGTGEILERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPADLARYVVEKGSITVDGISLTVVDAGPDFFTVSLIPTTLALTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+ RL     S
Sbjct: 176 DPVNLEVDVIAKYVERLLGAQGS 198


>gi|91776449|ref|YP_546205.1| riboflavin synthase subunit alpha [Methylobacillus flagellatus KT]
 gi|91710436|gb|ABE50364.1| riboflavin synthase, alpha subunit [Methylobacillus flagellatus KT]
          Length = 199

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 121/200 (60%), Gaps = 12/200 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G I  +TP     RL + T   +   + +G SIA  G+CLT + L   HS 
Sbjct: 1   MFTGIIQAQGHIKTITPHDGDARLVIDTGDLDLHDVAIGDSIAVNGVCLTAIALGP-HS- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTF--INLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
              +E +V  ET   T     G+ T   +NLE++++L DRL GHLVSGH+DG  +++  +
Sbjct: 59  ---FEADVSKETLSCT----VGLDTLRQVNLEKALRLSDRLGGHLVSGHVDGVGQVIRFE 111

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +G+SM   +  PH L ++IAVKGSV ++GVSLTVN V  + F V LI HT+E TT K  
Sbjct: 112 PVGESMLLIVRAPHALSRYIAVKGSVTIDGVSLTVNHVDGDDFSVNLIPHTMEVTTLKNL 171

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  +N+EVD + RY+ R+
Sbjct: 172 GVGSRVNLEVDLIARYVERM 191


>gi|297155738|gb|ADI05450.1| riboflavin synthase subunit alpha [Streptomyces bingchenggensis
           BCW-1]
          Length = 209

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +    R  V     T   K G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEIVAVENLGDASRFLVSGPVVTEGAKHGDSIAVNGVCLTVVDFE-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GRFSADVMAETLNRSSLGALAVGSRVNLERPMALGGRLGGHLVQGHVDGTGTIVERKLSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPADLSRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGVKQAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ RL
Sbjct: 176 DPVNLEVDVLAKYVERL 192


>gi|269103254|ref|ZP_06155951.1| riboflavin synthase alpha chain [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163152|gb|EEZ41648.1| riboflavin synthase alpha chain [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 218

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 118/200 (59%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT---SYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G I A+TP  KG  + V       + S +KLG SIA  G+CLTVV+L+   
Sbjct: 1   MFTGIIEAVGTITALTP--KGADISVTVDSGKLDLSDVKLGDSIATNGVCLTVVQLT--- 55

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                Y  ++  ET + T  A++  G  +NLE+++    R  GH+VSGH+D   E++   
Sbjct: 56  --GKGYVADLSLETLKRTAFANYKAGQAVNLEKAMLPTTRFGGHMVSGHVDAVAEVIERT 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   +  P +L Q+IA KGS+ ++G+SLTVN +  + F + ++ HT  ETT +  
Sbjct: 114 HTGRAIEFWIKAPSHLAQYIAEKGSIAIDGISLTVNAIRGDEFKLTIVPHTAAETTMESF 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           KVG  INIEVD + RY+ RL
Sbjct: 174 KVGRQINIEVDVIARYLERL 193


>gi|325528282|gb|EGD05446.1| riboflavin synthase subunit alpha [Burkholderia sp. TJI49]
          Length = 211

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 123/209 (58%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESITPLGASPEAGVRLSVQAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++VEV  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -EKTDAAFDVEVSRESLNRTVGLAEPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVN----LVGKNFFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN    L   + F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNSVEDLADGSEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N+EVD + RY+ R+ +
Sbjct: 173 VTTLRHLKAGDKVNLEVDMIARYVERMLS 201


>gi|161702945|ref|YP_303402.2| riboflavin synthase subunit alpha [Ehrlichia canis str. Jake]
          Length = 202

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN---TSKMKLGCSIAHAGICLTVVRLSEEH 57
           MF GIV DIG +I +       R   +   N    S+ KLG SI  +GICL+VV L+   
Sbjct: 1   MFKGIVEDIGTVIQVRNTKNCDRRVSIKPSNFKFLSETKLGDSIGCSGICLSVVELN--- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D+++  +V   T  ITN   W  GT +NLE  +++ DRLDGH V GH+DG  +I  + 
Sbjct: 58  --DDYFVTDVSDATLSITNATYWEEGTKVNLELPIRITDRLDGHFVQGHVDGIGKITSII 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +  S    L +P  L ++   KGS+ +NGVSLT+N +      V +I HT E+TT++  
Sbjct: 116 KVNSSHNIELHVPDTLLKYTITKGSIAINGVSLTINSISNGILSVNIIPHTWEKTTFQYS 175

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
           KV D+INIE D + +++ +LY  N
Sbjct: 176 KVNDIINIEADILAKHLEQLYIYN 199


>gi|315179336|gb|ADT86250.1| riboflavin synthase subunit alpha [Vibrio furnissii NCTC 11218]
          Length = 218

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 123/198 (62%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV   + HS 
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDITISVNAGKLDMSDVKLGDSIATNGVCLTVVAF-DSHS- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLETLKKSGFADYKVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVAMPAELSKYVAEKGSMTVDGISLTVNDLRKNAFKLTIVPHTTQETTIDHFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYLERL 193


>gi|260767834|ref|ZP_05876769.1| riboflavin synthase alpha chain [Vibrio furnissii CIP 102972]
 gi|260617343|gb|EEX42527.1| riboflavin synthase alpha chain [Vibrio furnissii CIP 102972]
          Length = 218

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 123/198 (62%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV   + HS 
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDITISVNAGKLDMSDVKLGDSIATNGVCLTVVAF-DSHS- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLETLKKSGFADYKVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNRV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVAMPAELSKYVAEKGSMTVDGISLTVNDLRKNAFKLTIVPHTTQETTIDHFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYLERL 193


>gi|68171228|ref|ZP_00544632.1| Lumazine-binding protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999348|gb|EAM85993.1| Lumazine-binding protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599335|gb|ABD44804.1| riboflavin synthase, alpha subunit [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 207

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MF GI+ DIG II +       R  V+   N    S+ K+G SI  +GICL+ V L  E 
Sbjct: 6   MFKGIIEDIGTIIQVDYTKGQDRRLVIKPTNANFLSETKIGDSIGCSGICLSAVELDNE- 64

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                +  +V   T  +T+ A W  GT INLE  +K+ DRLDGH V GH+DG   I+ + 
Sbjct: 65  ----CFSADVSDATLSVTSAAHWKEGTKINLELPLKMTDRLDGHFVQGHVDGVGNIISIT 120

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +  S      +P  L +++  KGS+ ++GVSLT+N +  N   V +I HT ++TT++ +
Sbjct: 121 NVNSSHNIEFHIPDALLKYMIRKGSIAIDGVSLTINSISNNILSVNIIPHTWKKTTFQYN 180

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
           KV D INIEVD + +++ RLY  N
Sbjct: 181 KVNDNINIEVDMLAKHLERLYEHN 204


>gi|72394527|gb|AAZ68804.1| Lumazine-binding protein [Ehrlichia canis str. Jake]
 gi|222831896|gb|EEE70373.1| predicted protein [Populus trichocarpa]
          Length = 212

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN---TSKMKLGCSIAHAGICLTVVRLSEEH 57
           MF GIV DIG +I +       R   +   N    S+ KLG SI  +GICL+VV L+   
Sbjct: 11  MFKGIVEDIGTVIQVRNTKNCDRRVSIKPSNFKFLSETKLGDSIGCSGICLSVVELN--- 67

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D+++  +V   T  ITN   W  GT +NLE  +++ DRLDGH V GH+DG  +I  + 
Sbjct: 68  --DDYFVTDVSDATLSITNATYWEEGTKVNLELPIRITDRLDGHFVQGHVDGIGKITSII 125

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +  S    L +P  L ++   KGS+ +NGVSLT+N +      V +I HT E+TT++  
Sbjct: 126 KVNSSHNIELHVPDTLLKYTITKGSIAINGVSLTINSISNGILSVNIIPHTWEKTTFQYS 185

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
           KV D+INIE D + +++ +LY  N
Sbjct: 186 KVNDIINIEADILAKHLEQLYIYN 209


>gi|260655867|ref|ZP_05861336.1| riboflavin synthase, alpha subunit [Jonquetella anthropi E3_33 E1]
 gi|260629483|gb|EEX47677.1| riboflavin synthase, alpha subunit [Jonquetella anthropi E3_33 E1]
          Length = 210

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 120/202 (59%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V   G+++ +TP      + V   +  +++ +G S+A  G CLTV  L+     D
Sbjct: 1   MFTGLVECTGRVVGLTPEGGCQAVTVSCPF-AAELAIGQSVAVDGACLTVSALA-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V + AET      +S  +G  +NLER++KLG RLDGHLV GH+DGT  ++ L   G
Sbjct: 55  GAFRVLMTAETVSRGG-SSLQVGKRVNLERALKLGGRLDGHLVLGHVDGTARVVSLRRSG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    + +P+ L +++AVKGSV L+GVSLTV         V +I  T+++TT    + G
Sbjct: 114 SSALLTVLIPNELRRYVAVKGSVALDGVSLTVASFEGGAASVAVIPQTLDDTTLGERRSG 173

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DLIN+EVD + RY+ RL + +T
Sbjct: 174 DLINLEVDVIARYLERLVSNDT 195


>gi|188996125|ref|YP_001930376.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931192|gb|ACD65822.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 210

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 117/204 (57%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GKI A+     G++++V  +     +KLG S+A  G+CLTV  + +     
Sbjct: 1   MFTGLIEEVGKISAINKKNDGLKIKVECNKILDDIKLGDSVAVNGVCLTVANIDK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  + EV  ET + +N     I  ++NLER++    RL GH+V GH+D T EI  +  +G
Sbjct: 56  NSLDFEVSNETIKRSNFKFLKINEYVNLERAMTPSSRLGGHIVQGHVDTTGEITSITNLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++  P   +  +  KGS+ ++G+SLT+N V  N  D+ +I HT E T  K  KVG
Sbjct: 116 KHTNIKIKFPSEYDYLVIEKGSIAIDGISLTINYVNDNVIDLNIIPHTWENTNLKYRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+A++  L   +
Sbjct: 176 DIVNIEFDILGKYVAKMLNLGKQK 199


>gi|146298413|ref|YP_001193004.1| riboflavin synthase subunit alpha [Flavobacterium johnsoniae UW101]
 gi|146152831|gb|ABQ03685.1| riboflavin synthase, alpha subunit [Flavobacterium johnsoniae
           UW101]
          Length = 196

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G+I  +      + + V +S  T+++K+  S++H GICLTVV +      D
Sbjct: 1   MFTGIIETLGRIHEIQKDKNNLHVTVDSSI-TNELKIDQSVSHNGICLTVVAIK-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           ++Y V    ET   TNI  W +   +NLER +KLGDRLDGH+V GH+D T     ++   
Sbjct: 55  SFYTVTAIEETILKTNIGDWKVNDIVNLERGMKLGDRLDGHIVQGHVDQTGVCTKIEEAN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         NL      KGS+ +NGVSLTV     N F V +I +T E T +K  KVG
Sbjct: 115 GSWNYTFEYDKNLNNITIEKGSITVNGVSLTVVNSQTNEFSVSIIPYTFENTNFKDFKVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
             IN+E D + +YI+RLY++N
Sbjct: 175 TKINLEFDVVGKYISRLYSIN 195


>gi|53804260|ref|YP_114100.1| riboflavin synthase subunit alpha [Methylococcus capsulatus str.
           Bath]
 gi|53758021|gb|AAU92312.1| riboflavin synthase, alpha subunit [Methylococcus capsulatus str.
           Bath]
          Length = 219

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++    P     RL V       S ++LG SIA  G+CLTVV   E    
Sbjct: 1   MFTGIIQAMGQLQRKEPRGGDYRLTVAAGKLAMSDVRLGDSIAVNGVCLTVVGFGE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET   T +     GT +NLE ++  G RL GH+VSGH+DG   I+  D  
Sbjct: 57  -GGFRADVSRETLSRTTLGELRTGTALNLELALTPGSRLGGHIVSGHVDGIGTIMARDED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+  +L  P +L ++IA KGS+C++G+SLTVN V  + FDV ++ HT+  TT K  + 
Sbjct: 116 GRSVRFQLDAPAHLAKYIAEKGSICIDGISLTVNRVDGSVFDVNVVPHTLAVTTLKDAQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|229592848|ref|YP_002874967.1| riboflavin synthase subunit alpha [Pseudomonas fluorescens SBW25]
 gi|229364714|emb|CAY52679.1| riboflavin synthase alpha chain [Pseudomonas fluorescens SBW25]
          Length = 220

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +RL V T   +   +KLG SIA +G+CLTV+ L      
Sbjct: 1   MFTGIIESIGSIRAMTPKGGDVRLLVETGKLDLGDVKLGDSIAVSGVCLTVIELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T +     G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLDCTAMNDLKAGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARSEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ +I HT+ ET    ++ 
Sbjct: 116 ARAVEFRIRAPKELAKYIAHKGSITVDGTSLTVNAVNGAEFELTIIPHTLSETIMASYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|110835034|ref|YP_693893.1| riboflavin synthase subunit alpha [Alcanivorax borkumensis SK2]
 gi|110648145|emb|CAL17621.1| riboflavin synthase, alpha subunit [Alcanivorax borkumensis SK2]
          Length = 221

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ AMTP    + L + +   + + +KLG SIA  G+CLT   L      
Sbjct: 1   MFTGIIESMGKVAAMTPKGGDVTLLIKSEGLDFADVKLGDSIAVNGVCLTATALP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E +V  ET  +T++A   +G+ +NLE+++    RL GHLVSGH+DG  +I+ +   
Sbjct: 56  GGAFEADVSGETLSLTSLAQISVGSTVNLEKALTPSSRLGGHLVSGHVDGLGKIVEMKQD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P  L ++IA KGS+ ++G+SLTVN V    F + +I HT E TT    KV
Sbjct: 116 ARSVRIDIEAPAELAKYIAHKGSITVDGISLTVNSVAGAVFSLNIIPHTQEVTTIGQWKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTPVNLEVDIIARYLERL 193


>gi|297569248|ref|YP_003690592.1| riboflavin synthase, alpha subunit [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925163|gb|ADH85973.1| riboflavin synthase, alpha subunit [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 222

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GK+ A  P   GM L + T +       G SIA  G+CLT   +   H   
Sbjct: 1   MFTGIILGKGKVKAKRPAGGGMTLALETDFPLPDPVEGESIAVNGVCLTARDIRGRH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   TN+   G+G  +NLER+++L DRL GH+VSGH+D    +L    +G
Sbjct: 58  --FLADVSPESLTRTNLGRLGVGGVVNLERALRLSDRLGGHMVSGHVDAVTTVLARRALG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  ++P  L ++I  KGSV L+G+SLTVN V +  F V +I HT+E TT     VG
Sbjct: 116 TFTLFDFAVPPGLGRYIIAKGSVALDGISLTVNEVDEERFSVSIIPHTLEITTLGEVAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ +L +
Sbjct: 176 DGVNLEVDLIGKYVEKLLS 194


>gi|262196664|ref|YP_003267873.1| riboflavin synthase, subunit alpha [Haliangium ochraceum DSM 14365]
 gi|262080011|gb|ACY15980.1| riboflavin synthase, alpha subunit [Haliangium ochraceum DSM 14365]
          Length = 200

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V DIG I  +   +    LR+ T   + ++++LG S+A  G+CLTV     E   
Sbjct: 1   MFTGLVQDIGTIARVDRRSDAAILRIATKRIHAAELELGESVAVNGVCLTVTERDAE--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V   AET R TNI    +   +NLER++++GDRL GH+VSGH+D    I     +
Sbjct: 58  --GFTVLAGAETLRRTNIGELRVSARVNLERALRMGDRLGGHMVSGHVDAVGTIASRRDL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P +  +++  KGS+ ++G+SLTVN V    F V LI HT++ETT    ++
Sbjct: 116 GANLDIAIETPASALRYVIEKGSIAIDGISLTVNRVEARSFAVALIPHTVDETTLAARRI 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G+ +N+EVD + +Y+ RL
Sbjct: 176 GERVNLEVDMIGKYVERL 193


>gi|73540479|ref|YP_294999.1| riboflavin synthase subunit alpha [Ralstonia eutropha JMP134]
 gi|72117892|gb|AAZ60155.1| Lumazine-binding protein [Ralstonia eutropha JMP134]
          Length = 209

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 125/211 (59%), Gaps = 20/211 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK------GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRL 53
           MFTGIV  +G+I  +TP+        G+RLRV     + S + +G SIA  G C+TV+ +
Sbjct: 1   MFTGIVAAVGRIETVTPLGSDSAADTGVRLRVAAGGLDLSDVVIGDSIAIQGACMTVIAM 60

Query: 54  SEEHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVE 112
           +      + ++VEV  E+ N+   +   G    +NLE++++L DRL GHLVSGH+DG  E
Sbjct: 61  TA-----DSFDVEVSRESLNKTVGLELAG---RVNLEKALRLADRLGGHLVSGHVDGLGE 112

Query: 113 ILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHT 168
           ++    +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT
Sbjct: 113 VVHFAPVGESHELRIRAPRELGRYLAYKGSVVINGVSLTVNRVTDEADGCVFSINLIPHT 172

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARLYA 199
           +E TT +  K G  +N+E+D + RY+ R+ +
Sbjct: 173 LEVTTLQELKAGSRVNLEIDLIARYVERMLS 203


>gi|332976012|gb|EGK12883.1| riboflavin synthase subunit alpha [Psychrobacter sp. 1501(2011)]
          Length = 200

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 122/202 (60%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G + ++T +   +RL + + + + S +KLG SIA  GICLTVV +S     
Sbjct: 1   MFTGIIESTGTLKSITELGGDVRLAIESDNLDFSDVKLGDSIASNGICLTVVEMS----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +N Y V+V  ET   T + +W  G  +NLE+++    R  GH+VSGH+DG  +I  +   
Sbjct: 56  NNGYSVDVSRETLAKTAMGNWQQGDTLNLEKAMLPTTRFGGHMVSGHVDGVGKIELMKED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH-K 178
             S+Y  +++P  L+++ A KGS+ ++G+SLT NLV  N   + +I HT E T    H K
Sbjct: 116 ARSIYIEIAIPEALKKYAATKGSITVDGISLTTNLVKDNIVCLNIIPHTAEVTNIGRHWK 175

Query: 179 VGDLINIEVDSMMRYIARLYAL 200
           VG  +NIEVD + RY+ RL ++
Sbjct: 176 VGGPVNIEVDLIARYLERLTSV 197


>gi|283765824|gb|ADB28304.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 90/140 (64%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ KG+R+++ T Y+   +++G SIA +GICLTVV    +  + NW+ VE W 
Sbjct: 1   GCVEDVQPLKKGVRVKISTHYDIESLEIGASIACSGICLTVVERGLKQEMTNWFTVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GTF+NLERS++LGD L GHLV GHIDG  EI+     GD++   L  
Sbjct: 61  EALRLTNLAQWTKGTFVNLERSLRLGDELGGHLVFGHIDGLAEIIEKKNEGDAVRFHLQA 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P  L  FI  KGS+ LNG S
Sbjct: 121 PARLTSFIVNKGSIALNGTS 140


>gi|302541056|ref|ZP_07293398.1| riboflavin synthase, alpha subunit [Streptomyces hygroscopicus ATCC
           53653]
 gi|302458674|gb|EFL21767.1| riboflavin synthase, alpha subunit [Streptomyces himastatinicus
           ATCC 53653]
          Length = 206

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 117/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +    R +V     T   + G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEIVAVENLGDASRFQVRGPVVTEGARHGDSIAVNGVCLTVV-----DTGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER + LG RL GHLV GH+DGT  ++      
Sbjct: 56  GGFSADVMAETLDRSSLGALAVGSRVNLERPMALGGRLGGHLVQGHVDGTGTLIERKLSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPSELGRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGVKQPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ RL A
Sbjct: 176 DPVNLEVDVLAKYVERLLA 194


>gi|323491729|ref|ZP_08096907.1| riboflavin synthase subunit alpha [Vibrio brasiliensis LMG 20546]
 gi|323314091|gb|EGA67177.1| riboflavin synthase subunit alpha [Vibrio brasiliensis LMG 20546]
          Length = 217

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V +   + S +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDISVTVDVGKLDMSDVKLGDSIATNGVCLTVVEFNS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET   T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -TSYSADLSLETLDKTGFTDYSAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P ++ +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVSMPGDIAKYVAEKGSITVDGISLTVNALRKNQFKLTIVPHTGEETTIADFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSREEQ 200


>gi|18309549|ref|NP_561483.1| riboflavin synthase subunit alpha [Clostridium perfringens str. 13]
 gi|18144226|dbj|BAB80273.1| riboflavin synthase alpha subunit [Clostridium perfringens str. 13]
          Length = 217

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 119/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +NI +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNIGNLKKSSKVNLERAMSINSRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE D + +Y+ +L   N
Sbjct: 176 DLVNIECDPIGKYVEKLLGFN 196


>gi|313127501|ref|YP_004037771.1| riboflavin synthase, alpha subunit [Halogeometricum borinquense DSM
           11551]
 gi|312293866|gb|ADQ68326.1| riboflavin synthase, alpha subunit [Halogeometricum borinquense DSM
           11551]
          Length = 203

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G ++A T    G RLR+        ++ G SIA +G+CLTV    E++S D
Sbjct: 1   MFTGIVEGTGVVVAATDDDGGRRLRLSPDVTFEDLRHGQSIAVSGVCLTV----EDYSTD 56

Query: 61  -NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W++V + AET   T +     G  +NLER++    RLDGH+V GH+D T  +  ++ +
Sbjct: 57  EQWFDVFLAAETVEKTYLGDVSEGDRVNLERALPADGRLDGHIVQGHVDTTTTVTGIERV 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD  +    LP  L +++  KGSVCL+G+SLTV    ++ F V +I  T + TT     V
Sbjct: 117 GDDWFFEFDLPEELGKYVVAKGSVCLDGISLTVADRRESDFAVAIIPTTYDLTTLSEKSV 176

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +++EVD + +Y+  +
Sbjct: 177 GDPVHVEVDVVAKYVENM 194


>gi|260775294|ref|ZP_05884191.1| riboflavin synthase alpha chain [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608475|gb|EEX34640.1| riboflavin synthase alpha chain [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 216

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V +   + S +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIIEAVGTLTAITPKGEDISVTVEVGKLDMSDVKLGDSIATNGVCLTVVDFN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+DG  EI   + +
Sbjct: 56  STSYSADLSLETLNKTGFTDYQVGGKVNLEKAMLPTTRFGGHIVSGHVDGVGEITERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P  L +++A KGSV ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVSMPEELSKYVAEKGSVTVDGISLTVNALRKNAFKLTIVPHTGEETTIADFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQKEQ 200


>gi|26522746|dbj|BAC44850.1| riboflavin synthase [Photobacterium phosphoreum]
          Length = 218

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 117/200 (58%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS---YNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +GKI A+TP  KG  + V       + + +KLG SIA  G+CLTVV+L+   
Sbjct: 1   MFTGIIEAVGKISALTP--KGADVSVTVDSGLLDLADVKLGDSIATNGVCLTVVKLT--- 55

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                Y  ++  ET   T  A++  G  +NLE+++    R  GH+VSGHID   E++   
Sbjct: 56  --GKGYVADLSLETLNRTAFANYKAGQVVNLEKAMLATTRFGGHMVSGHIDAVAEVIERQ 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            IG ++   + +P  L ++I+ KGSV ++G+SLTVN V  N F + ++ HT  ETT    
Sbjct: 114 HIGRAIEFWIKVPPQLAKYISEKGSVAVDGISLTVNAVRGNEFKLTIVPHTAAETTMADF 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  IN+EVD + RY+ RL
Sbjct: 174 NVGRKINLEVDVIARYLERL 193


>gi|182626740|ref|ZP_02954480.1| riboflavin synthase, alpha subunit [Clostridium perfringens D str.
           JGS1721]
 gi|177907908|gb|EDT70500.1| riboflavin synthase, alpha subunit [Clostridium perfringens D str.
           JGS1721]
          Length = 217

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 119/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +NI +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNIGNLKKSSKVNLERAMSINSRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE DS+ +Y+ +L    
Sbjct: 176 DLVNIECDSIGKYVEKLLGFK 196


>gi|328954277|ref|YP_004371611.1| riboflavin synthase, alpha subunit [Desulfobacca acetoxidans DSM
           11109]
 gi|328454601|gb|AEB10430.1| riboflavin synthase, alpha subunit [Desulfobacca acetoxidans DSM
           11109]
          Length = 215

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 121/199 (60%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  IG+I A+   A+G+RL +   +N +++K G SIA +G CLTVV L+      
Sbjct: 1   MFTGLVEGIGEITAIAREAEGLRLSLTAPFNLTEVKPGDSIAVSGPCLTVVELTA----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VEV  ET R T++A+  +G  +N+ER++++GDRL GH+VSGHID   +++      
Sbjct: 56  RTFTVEVSPETVRRTSLAAKRVGDRVNIERALRVGDRLGGHIVSGHIDCVGQLVKKMVRP 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
             + C + L  N  +++  KGS+ L+GVSLTVN    + F V +I  T   TT    + G
Sbjct: 116 QHLQCVIRLTDNWSRYVIEKGSIALDGVSLTVNSCTGDEFSVNIIPFTARHTTLIEVRPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +Y+ +L +
Sbjct: 176 DRLNVETDIIGKYVEKLLS 194


>gi|323497967|ref|ZP_08102976.1| riboflavin synthase subunit alpha [Vibrio sinaloensis DSM 21326]
 gi|323317012|gb|EGA70014.1| riboflavin synthase subunit alpha [Vibrio sinaloensis DSM 21326]
          Length = 217

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 121/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V +   + + +KLG SIA  G+CLTVV  S     
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDISVTVEVGKLDMADVKLGDSIATNGVCLTVVDYSA---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T  +++  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -TSYTADLSLETLQKTGFSAYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVSMPEEIAKYVAEKGSITVDGISLTVNALRKNAFKLTIVPHTGEETTIADFHV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|290968503|ref|ZP_06560042.1| riboflavin synthase, alpha subunit [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781499|gb|EFD94088.1| riboflavin synthase, alpha subunit [Megasphaera genomosp. type_1
           str. 28L]
          Length = 216

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + GKI +    +  + L +      +  +LG SIA  G+CLTV  L+ +    
Sbjct: 1   MFTGIIEETGKIQSFKRRSDSIALTIQACKVLTDTQLGDSIAVNGVCLTVTSLTTD---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +++ + G G  +NLER+V +G RL GHLVSGHIDGT  I+ +   G
Sbjct: 57  -TFTADVMHETMRRSSLQTIGSGDTVNLERAVAVGGRLGGHLVSGHIDGTGHIMRIQPDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +S   NL  FI  KGSV L+GVSLTV  VG  +F V LI HT+  TT    K G
Sbjct: 116 IANIFTISAAANLVHFIVEKGSVALDGVSLTVTAVGDRWFSVSLIPHTLAHTTLLSKKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
            ++NIE D + +YI RL
Sbjct: 176 AVLNIETDIIGKYIDRL 192


>gi|153834832|ref|ZP_01987499.1| riboflavin synthase, alpha subunit [Vibrio harveyi HY01]
 gi|156973477|ref|YP_001444384.1| riboflavin synthase subunit alpha [Vibrio harveyi ATCC BAA-1116]
 gi|148868760|gb|EDL67834.1| riboflavin synthase, alpha subunit [Vibrio harveyi HY01]
 gi|156525071|gb|ABU70157.1| hypothetical protein VIBHAR_01167 [Vibrio harveyi ATCC BAA-1116]
          Length = 217

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 122/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V +   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVVDFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET   T  A++ +G  +NLE+++    R  GH+VSGH+DG   I+  + +
Sbjct: 56  SHYYSADLSLETLNKTGFAAYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGVIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVEMPAEICKYVAEKGSITVDGISLTVNDLRKNGFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|85372856|ref|YP_456918.1| riboflavin synthase subunit alpha [Erythrobacter litoralis
           HTCC2594]
 gi|84785939|gb|ABC62121.1| riboflavin synthase alpha chain [Erythrobacter litoralis HTCC2594]
          Length = 206

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 122/210 (58%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG I +   ++  +R+RV   Y+ + + +G SIA +G C+TVV        D
Sbjct: 1   MFTGIVTAIGTIESAEQLSD-LRVRVRCPYDPADIAIGASIACSGACMTVVDRGGREG-D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID--GTVEILFLDF 118
            W+ V+V  E+   T    W +G  +NLE ++KLGD L GH+V+GH+D  GTVE      
Sbjct: 59  AWFAVDVSGESVSKTASDMWQVGGALNLETALKLGDELGGHIVTGHVDAVGTVESAV--E 116

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETT 173
           +G S   ++  P +L  +IA KGS+ ++GVSLTVN V     G   F + +I HT E TT
Sbjct: 117 VGGSHTVKIRAPKDLAPYIAPKGSITVDGVSLTVNEVTDHDDGSCTFSLNIIPHTWEVTT 176

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALNTS 203
               + G  +N+E+D + RY+ R+ +L  +
Sbjct: 177 LGRIEAGSEVNLEIDVLARYLRRMESLRAA 206


>gi|125972629|ref|YP_001036539.1| riboflavin synthase subunit alpha [Clostridium thermocellum ATCC
           27405]
 gi|256004716|ref|ZP_05429692.1| riboflavin synthase, alpha subunit [Clostridium thermocellum DSM
           2360]
 gi|281416821|ref|ZP_06247841.1| riboflavin synthase, alpha subunit [Clostridium thermocellum JW20]
 gi|125712854|gb|ABN51346.1| riboflavin synthase, alpha subunit [Clostridium thermocellum ATCC
           27405]
 gi|255991309|gb|EEU01415.1| riboflavin synthase, alpha subunit [Clostridium thermocellum DSM
           2360]
 gi|281408223|gb|EFB38481.1| riboflavin synthase, alpha subunit [Clostridium thermocellum JW20]
 gi|316941133|gb|ADU75167.1| riboflavin synthase, alpha subunit [Clostridium thermocellum DSM
           1313]
          Length = 218

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 119/202 (58%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  + P  K ++L +        +K+G SIA  GICLTV       S+D
Sbjct: 1   MFTGIVEEIGLVKEIIPGNKSIKLTIKCEKIMDDVKVGDSIAVNGICLTVT------SLD 54

Query: 61  N-WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           N  +  +V  +T R TN+ +   G  +NLER+++  DR+ GH+VSGHIDGT  IL  +  
Sbjct: 55  NGAFTADVMPQTMRKTNLGNLRTGEKVNLERALRPVDRMGGHIVSGHIDGTGVILSKEEE 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            ++++  +S P ++ ++I V+GSV L+GVSLTV  V +  F V LI HT   T     K 
Sbjct: 115 DNAIWLEISAPSDILKYIVVRGSVALDGVSLTVAYVDEKSFKVSLIPHTASVTILGSKKP 174

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD INIE D + +Y+ +L   +
Sbjct: 175 GDRINIECDMLGKYVEKLMCFD 196


>gi|289663673|ref|ZP_06485254.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 200

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTV+     +  
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVIAFDAAN-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQAVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V +  F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPSVLRYVAKKGSICVDGVSLTVNEVDEEGFEVALIPHTVANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|332992367|gb|AEF02422.1| riboflavin synthase subunit alpha [Alteromonas sp. SN2]
          Length = 220

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 122/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVM-TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GKI  +      +RL V  T+ + + + LG SIA  G+CLTV  +  +   
Sbjct: 1   MFTGIIQALGKITKLDNRGSDIRLTVSSTTLDMADVALGDSIATNGVCLTVTDMGSD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             +Y  +V AET ++T  A +G G+ +NLE++++  DRL GH+VSGH+DG  EI  +   
Sbjct: 58  --YYCADVSAETIKLTGFAHYGTGSTVNLEKAMRPTDRLGGHIVSGHVDGVGEISKIIKH 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D +   +  P +L ++IA KGS+ ++GVSLTVN V    F + +I HT++ET    ++V
Sbjct: 116 TDYVEFWVKAPTSLAKYIAHKGSITVDGVSLTVNEVNGAEFMLWIIPHTLKETVMGHYEV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTAVNLEVDVIARYLERL 193


>gi|187479426|ref|YP_787451.1| riboflavin synthase subunit alpha [Bordetella avium 197N]
 gi|115424013|emb|CAJ50566.1| riboflavin synthase alpha chain [Bordetella avium 197N]
          Length = 203

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 126/208 (60%), Gaps = 17/208 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIA---KGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTG+V  +G+I+++ P+A    G+RL +   S +   + +G SIA  G C+TVV LS +
Sbjct: 1   MFTGLVAAVGRIVSVKPLAGESAGVRLDIDAGSLDLQDVAIGDSIAVQGACMTVVGLSAQ 60

Query: 57  HSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
           H     ++V+V  E+ +R   +   G    +NLE+S+ LGD+L GHLVSGH+DG  E+L 
Sbjct: 61  H-----FQVDVSRESLSRTVGLDREG---EVNLEKSLGLGDKLGGHLVSGHVDGLGEVLR 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIEE 171
              +G+S    +S+P +L +F+A KGS+ +NG+SLTVN V          + +I HT   
Sbjct: 113 FSEVGESRELLISIPKSLARFLAYKGSITVNGISLTVNRVEDTATACTISINIIPHTQAV 172

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYA 199
           TT +    GD +N+EVD + RY+ R+ +
Sbjct: 173 TTLRNVHAGDSVNLEVDMIARYVERMMS 200


>gi|294627699|ref|ZP_06706281.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598051|gb|EFF42206.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 200

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFDSVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSIHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDQDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|156124814|gb|ABU50705.1| RibE [Photobacterium kishitanii]
 gi|156124824|gb|ABU50712.1| RibE [Photobacterium kishitanii]
          Length = 218

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 124/207 (59%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G I A+T  +KG    V  + +T   + +K+G SIA  GICLTVV+L+   
Sbjct: 1   MFTGIIEAVGNISAIT--SKGSDFEVSVNCDTLDLADVKIGDSIATNGICLTVVKLT--- 55

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             DN Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+D   E++   
Sbjct: 56  --DNSYVADLSIETLSRTAFNYYKVGQAVNLEKAMLPTTRFGGHIVSGHVDAVAEVIECR 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P  +E++++ KGSV ++GVSLTVN V  N F + ++ HT+ ETT    
Sbjct: 114 TSGRAIDIWVRVPSQIEKYLSEKGSVTVDGVSLTVNAVRGNEFKLTIVPHTVVETTIADF 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
           KVG+ INIEVD + RYI RL  ++  +
Sbjct: 174 KVGNKINIEVDILARYIERLLLVDKPE 200


>gi|157374413|ref|YP_001473013.1| riboflavin synthase subunit alpha [Shewanella sediminis HAW-EB3]
 gi|157316787|gb|ABV35885.1| riboflavin synthase, alpha subunit [Shewanella sediminis HAW-EB3]
          Length = 220

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 122/206 (59%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +  +   +RL V +   +   ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERLGDDIRLNVASGKLDLGDVRLGDSIATNGVCLTVV-----ECL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +    F 
Sbjct: 56  SDGYVADISAETVSLTGFAKYQVGTMVNLEKAVTPTTRLGGHMVSGHVDGIASVDDRQFR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  N F + ++ HT  ETT    K 
Sbjct: 116 GKAIEFWLTAPSILARYIAHKGSITIDGVSLTVNEVIDNRFRLTIVPHTAGETTLVSLKA 175

Query: 180 GDLINIEVDSMMRYIARL--YALNTS 203
           GD +NIEVD + R++ RL  Y+ +T+
Sbjct: 176 GDAVNIEVDLIARHLERLMTYSSDTA 201


>gi|148654181|ref|YP_001281274.1| riboflavin synthase subunit alpha [Psychrobacter sp. PRwf-1]
 gi|148573265|gb|ABQ95324.1| riboflavin synthase, alpha subunit [Psychrobacter sp. PRwf-1]
          Length = 200

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 122/204 (59%), Gaps = 11/204 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G + ++T +   +RL + +   + S +KLG SIA  GICLTVV +      
Sbjct: 1   MFTGIIESTGTLKSITEVGGDVRLVIESDDLDFSDVKLGDSIASNGICLTVVDMDS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID--GTVEILFLD 117
            N Y V+V  ET   T + +W  G  +NLE+++    R  GH+VSGH+D  GTVE++  D
Sbjct: 57  -NSYAVDVSRETLAKTAMNNWQQGDTLNLEKAMLPTTRFGGHMVSGHVDGVGTVEVMTED 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S+Y  +S+P  L+++ A KGS+ ++G+SLT NLV  N   + +I HT E T    H
Sbjct: 116 --ARSIYIEISIPEALKKYAATKGSITVDGISLTTNLVKDNIICLNIIPHTAEVTNIARH 173

Query: 178 -KVGDLINIEVDSMMRYIARLYAL 200
            KVG  +NIEVD + RY+ RL A+
Sbjct: 174 WKVGGPVNIEVDLIARYLERLTAV 197


>gi|254480935|ref|ZP_05094181.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214038730|gb|EEB79391.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 218

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  M P    MRLRV T   + S + LG SIA  G CLTVV L  +   
Sbjct: 1   MFTGIIQAVGEIADMQPSGGDMRLRVNTGKLDLSDVALGDSIAANGACLTVVELPGDGY- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W +V V  ET   T +     G+ +NLE+++    RL GH+VSGH+DG  E++ L   
Sbjct: 60  --WADVSV--ETLNFTTLGGLKTGSKVNLEKALTPASRLGGHIVSGHVDGVGEVVSLQED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P +L ++IA KGS+ ++G SLTVN V    FD+ +I  T+ ET +  ++ 
Sbjct: 116 ARSWRFVMRAPDDLAKYIAHKGSITVDGTSLTVNAVNGAEFDLNIIPQTMAETVFGDYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSKLNLEVDVIARYLERL 193


>gi|253998344|ref|YP_003050407.1| riboflavin synthase subunit alpha [Methylovorus sp. SIP3-4]
 gi|253985023|gb|ACT49880.1| riboflavin synthase, alpha subunit [Methylovorus sp. SIP3-4]
          Length = 201

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 16/202 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +  +   ++L +  T+ N   + +G SI   G+CLT V LS  H  
Sbjct: 1   MFTGIIQAVGRIEKVDTLGSDVKLTIDATALNLGDVAIGDSICVNGVCLTAVSLSPSH-- 58

Query: 60  DNWYEVEVWAETNRIT----NIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
              ++  V  ET   T    N+        +NLE++++  DRL GH+VSGH+DG  +++ 
Sbjct: 59  ---FQAHVSRETLNCTVGLDNVKP------VNLEKALRFSDRLGGHIVSGHVDGVGQVVR 109

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            +  GD M   +  PH + ++IA+KGS+ ++GVSLTVN V  + F V LI HTIE T  K
Sbjct: 110 FEPAGDCMLLAVRAPHAISRYIAIKGSITIDGVSLTVNSVDGDVFSVNLIPHTIEVTALK 169

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
              VG  +N+EVD + RY+ R+
Sbjct: 170 SLGVGSRVNLEVDMIARYVERM 191


>gi|157960991|ref|YP_001501025.1| riboflavin synthase subunit alpha [Shewanella pealeana ATCC 700345]
 gi|157845991|gb|ABV86490.1| riboflavin synthase, alpha subunit [Shewanella pealeana ATCC
           700345]
          Length = 221

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV L     +
Sbjct: 1   MFTGIIESVGHLRKVERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVEL-----M 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  + + +G  +NLE++V    RL GH+VSGH+DG   +    F 
Sbjct: 56  SDGYVADISAETVTLTGFSHYQVGKAVNLEKAVTPTTRLGGHMVSGHVDGIAHVDDRQFR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLSPPEELGRYIAHKGSITIDGVSLTVNEVQGHRFRLTIVPHTAGETTLVNLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL +  + +
Sbjct: 176 GDSVNIEVDLIARHLERLMSYGSQE 200


>gi|319941822|ref|ZP_08016144.1| riboflavin synthase [Sutterella wadsworthensis 3_1_45B]
 gi|319804755|gb|EFW01622.1| riboflavin synthase [Sutterella wadsworthensis 3_1_45B]
          Length = 205

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 127/207 (61%), Gaps = 14/207 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+     +  G+RL ++      +++K+G SIA  G C+TV+ + E    
Sbjct: 1   MFTGIVQAVGKVREPEKLGNGVRLTILAPDLGLNEVKVGDSIAVNGACMTVIEVGERE-- 58

Query: 60  DNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              ++++V AE+ ++ T + ++G    +NLE++++L DR+DGH+VSGH+DG  ++  ++ 
Sbjct: 59  ---FKIDVSAESLSKTTGLDTFG---EVNLEKAMRLSDRIDGHIVSGHVDGVGQVESMEP 112

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVL----LIRHTIEETTW 174
           + +S    + +P  L  ++A KGS+ +NGVSLT+N V     D L    LI HT+E TT 
Sbjct: 113 VAESWRLVVRVPRVLSPYVAYKGSITINGVSLTINKVEDTALDTLVTINLIPHTLEVTTL 172

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALN 201
           K  K    +N+E+D++ RY+ R+ +L 
Sbjct: 173 KHLKAQSYVNVEIDTIARYVERIMSLK 199


>gi|300784678|ref|YP_003764969.1| riboflavin synthase alpha chain [Amycolatopsis mediterranei U32]
 gi|299794192|gb|ADJ44567.1| riboflavin synthase alpha chain [Amycolatopsis mediterranei U32]
          Length = 209

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 117/197 (59%), Gaps = 8/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++ A+  +    RLRV     T     G SIA +G+CLTVV ++      
Sbjct: 1   MFTGIVEEIGEVTAVEQLTNAARLRVRGPLVTGDAGHGDSIAVSGVCLTVVEVT-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + +++A   +G  +NLER+   G RL GH++ GH+DGT   L  D  G
Sbjct: 56  GEFTVDVVHETLQRSSLAKVAVGDRVNLERATPAGGRLGGHIMQGHVDGTGVFLGRDENG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +   ++P +L +++  KGS+ ++GVSLTV  +  + F V LI  T+E TT    + G
Sbjct: 116 VTTF---AMPAHLSRYVVEKGSIAVDGVSLTVAAISADQFAVALIPTTLEATTLGAREAG 172

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+EVD + +Y+ +L
Sbjct: 173 DLVNLEVDVVAKYVEKL 189


>gi|94265527|ref|ZP_01289275.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
 gi|93453968|gb|EAT04314.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
          Length = 222

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 112/201 (55%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GKI    P   G+ L + T +  ++   G SIA  G+CLT  R        
Sbjct: 1   MFTGIILGKGKIYEKRPAGGGVTLGLETDFPLAEPLEGESIAINGVCLTARRFQ-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  E+ + TN+    +G  +NLER+++L DRL GHLVSGH+D   E+L     G
Sbjct: 56  NRFLADVSPESLKRTNLGRLAVGGRVNLERALRLSDRLGGHLVSGHVDAVAEVLARQPCG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D      ++P  L ++I  KGS+ ++G+SLTVN V +  F V +I HT+  TT      G
Sbjct: 116 DFTIFSFAIPPGLGRYIIAKGSITIDGISLTVNEVDQRQFTVSIIPHTLAITTLGELAAG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+EVD + +Y+ +L A+ 
Sbjct: 176 GRVNLEVDLIGKYVEKLLAVK 196


>gi|169342993|ref|ZP_02864021.1| riboflavin synthase, alpha subunit [Clostridium perfringens C str.
           JGS1495]
 gi|169298902|gb|EDS80976.1| riboflavin synthase, alpha subunit [Clostridium perfringens C str.
           JGS1495]
          Length = 217

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 119/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE D + +Y+ +L   N
Sbjct: 176 DLVNIECDPIGKYVEKLLGFN 196


>gi|328552753|gb|AEB23245.1| riboflavin synthase subunit alpha [Bacillus amyloliquefaciens
           TA208]
 gi|328912448|gb|AEB64044.1| riboflavin synthase (alpha subunit) [Bacillus amyloliquefaciens
           LL3]
          Length = 215

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G I A+      M L +  S  TS ++LG SIA  GICLTV   S     D
Sbjct: 1   MFTGIVEETGTIQAIKKTGLSMALTIAASKVTSDVRLGDSIAVNGICLTVTGFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNGLSKGSKVNLERAMSANGRFGGHFVSGHVDGTAEITRIEKKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L L   L + + +KGS+ ++GVSLT+  +      V +I HTI ET ++   VG
Sbjct: 116 NAVYYDLKLSPELTKTLVLKGSITVDGVSLTIFGLSDESVTVSVIPHTISETIFRTKAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
            ++NIE D + +Y+ R 
Sbjct: 176 SIVNIECDMIGKYLYRF 192


>gi|325963045|ref|YP_004240951.1| riboflavin synthase, subunit alpha [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469132|gb|ADX72817.1| riboflavin synthase, alpha subunit [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 213

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 114/208 (54%), Gaps = 10/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G ++++       R+R+     T  + LG SIA  G+CLT   ++ +    
Sbjct: 1   MFTGIIAEQGHVLSVERDGDSARVRLHAPGTTEGLALGGSIAVNGVCLTATEIAGKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   + I     G  +NLER V+ G RLDGH+V GH+DG  E+L  + +G
Sbjct: 58  --FSVDVMGETLVRSTIGELAPGDSVNLERCVQAGGRLDGHVVQGHVDGVGELLEREPLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG-----KNFFDVLLIRHTIEETTWK 175
           +    R  +P NL ++IA KGS+ ++GVSLTV  V        +F+V LI  T+ ET   
Sbjct: 116 NWERLRFGVPANLARYIAEKGSIAIDGVSLTVTAVSDAAEVNPWFEVGLIPTTLAETGLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
               G  +N+EVD + +Y  RL A NT 
Sbjct: 176 TKTTGSRVNLEVDVLAKYTERLLAFNTP 203


>gi|296122847|ref|YP_003630625.1| riboflavin synthase, subunit alpha [Planctomyces limnophilus DSM
           3776]
 gi|296015187|gb|ADG68426.1| riboflavin synthase, alpha subunit [Planctomyces limnophilus DSM
           3776]
          Length = 205

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 112/203 (55%), Gaps = 4/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN----TSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTG+V  +G+I A+     G+R+ V              LG S+A  G CLTVV L  +
Sbjct: 1   MFTGLVEGMGQIEAVVSEPGGVRIVVSPPVQMLLPEDPAVLGESVAINGCCLTVVELQNQ 60

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
                 +  +  +ET   TN+ +   G  +NLER++K   R  GH+V GH+DGT  IL +
Sbjct: 61  GEPAEKWSFQAGSETLSKTNLGTLASGASVNLERAMKANARFGGHIVQGHVDGTARILSI 120

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
           D   D ++   +L   L + +  KGSV ++GVSLTV    ++ F V LI HT++ETT   
Sbjct: 121 DHEADWVFMAFALAPELARQLVPKGSVTVDGVSLTVVEAKRDGFSVALIPHTLKETTLGQ 180

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
            +VGD +NIE D + +Y+ RL A
Sbjct: 181 RQVGDTVNIETDILGKYVERLMA 203


>gi|331005897|ref|ZP_08329248.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC1989]
 gi|330420293|gb|EGG94608.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC1989]
          Length = 213

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+++A+ P+   +RL + T+      ++LG SIA  G+CLTV+  +     
Sbjct: 1   MFTGIIESVGQVVAVEPVEGDVRLHIDTAGLPMDAVQLGDSIATNGVCLTVIEKTA---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V  E+  +T I  W  GT +NLER++    RL GH+VSGH+DG  E++     
Sbjct: 57  -TGYRADVSVESLDLTTIREWQAGTTVNLERALTPESRLGGHIVSGHVDGIGEVVSRHPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    + +P ++ ++IA KGS+ ++G SLTVN V    FDV ++ HTI  T    ++ 
Sbjct: 116 ARSERFLMRVPASMAKYIAHKGSITIDGTSLTVNSVNGCEFDVNIVPHTIANTVMGRYET 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTKVNLEVDVIARYLERL 193


>gi|323141089|ref|ZP_08075994.1| riboflavin synthase, alpha subunit [Phascolarctobacterium sp. YIT
           12067]
 gi|322414465|gb|EFY05279.1| riboflavin synthase, alpha subunit [Phascolarctobacterium sp. YIT
           12067]
          Length = 216

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G +  +    +   L V        +K+G S+A  G CLTVV +      D
Sbjct: 1   MFTGLVAELGTVQKLAQQGESYHLTVAAVKVLQNLKIGDSVAVNGACLTVVSMD-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R+TNI S   G  +NLER+++L D LDGH+VSGH++G   I      G
Sbjct: 56  TAFTADVMPETVRLTNIGSLHAGDRVNLERTLRLCDGLDGHIVSGHVEGLGVIAGRRPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +M   ++ P  L ++I  KGS+ ++G+SLTV  V ++ F V LI HT +ETT     VG
Sbjct: 116 IAMVVTINTPPELLKYIIKKGSIAIDGISLTVTQVTESSFSVSLIPHTAKETTLGFKDVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ ++   N  Q
Sbjct: 176 DSVNLETDIVGKYVEQMLKFNPKQ 199


>gi|313200418|ref|YP_004039076.1| riboflavin synthase subunit alpha [Methylovorus sp. MP688]
 gi|312439734|gb|ADQ83840.1| riboflavin synthase, alpha subunit [Methylovorus sp. MP688]
          Length = 235

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 118/207 (57%), Gaps = 16/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +  +   ++L +  T+ N   + +G SI   G+CLT V LS  H  
Sbjct: 35  MFTGIIQAVGRIEKVDTLGSDVKLTIDATALNLGDVAIGDSICVNGVCLTAVSLSPSH-- 92

Query: 60  DNWYEVEVWAETNRIT----NIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
              ++  V  ET   T    N+        +NLE++++  DRL GH+VSGH+DG  +++ 
Sbjct: 93  ---FQAHVSRETLNCTVGLDNVKP------VNLEKALRFSDRLGGHIVSGHVDGVGQVVR 143

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            +  GD M   +  PH + ++IA+KGS+ ++GVSLTVN V  + F V LI HTIE T  K
Sbjct: 144 FEPAGDCMLLAVRAPHAISRYIAIKGSITIDGVSLTVNSVDGDVFSVNLIPHTIEVTALK 203

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNT 202
              VG  +N+EVD + RY+ R+    T
Sbjct: 204 SLGVGSRVNLEVDMIARYVERMAQWKT 230


>gi|296133285|ref|YP_003640532.1| riboflavin synthase, alpha subunit [Thermincola sp. JR]
 gi|296031863|gb|ADG82631.1| riboflavin synthase, alpha subunit [Thermincola potens JR]
          Length = 219

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  M   A   RL +        +KLG SIA  GICLTV   +     +
Sbjct: 1   MFTGIVEELGVLKGMKKGADSARLTIQAEKVLQDVKLGDSIAVNGICLTVTEFN-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++ V+V AET R TN+     G F+NLER++++GDRL GH+VSGHIDG   I+      
Sbjct: 56  RFFSVDVMAETLRRTNLLDLQPGNFVNLERALRVGDRLGGHIVSGHIDGVGTIIRQQRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   +  P  + ++I  KGSV ++G+SLTV       F V LI HT + TT    K G
Sbjct: 116 IAIITEIEAPPEVMKYILTKGSVAVDGISLTVVNHTDRTFVVSLIPHTAKMTTLGYKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + RY+ RL   +  +
Sbjct: 176 DKVNLESDIIGRYVERLLGCHQQE 199


>gi|289671053|ref|ZP_06492128.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 200

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQAVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V +  F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPSVLRYVAKKGSICVDGVSLTVNEVDEEGFEVALIPHTVANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|308174117|ref|YP_003920822.1| riboflavin synthase subunit alpha [Bacillus amyloliquefaciens DSM
           7]
 gi|307606981|emb|CBI43352.1| riboflavin synthase (alpha subunit) [Bacillus amyloliquefaciens DSM
           7]
          Length = 215

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G I A+      M L +  S  TS ++LG SIA  GICLTV   S     D
Sbjct: 1   MFTGIVEETGTIQAIKKTGLSMALTIAASKVTSDVRLGDSIAVNGICLTVTGFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNGLSKGSKVNLERAMSANGRFGGHFVSGHVDGTAEITRIEKKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L L   L + + +KGS+ ++GVSLT+  +      V +I HTI ET ++   VG
Sbjct: 116 NAVYYDLKLSPELTKTLVLKGSITVDGVSLTIFGLSDESVTVSVIPHTISETIFQTKAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
            ++NIE D + +Y+ R 
Sbjct: 176 SIVNIECDMIGKYLYRF 192


>gi|156946232|gb|ABU98301.1| RibE [Photobacterium kishitanii]
          Length = 218

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 124/207 (59%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G I A+T  +KG    V  + +T   + +K+G SIA  GICLTVV+L+   
Sbjct: 1   MFTGIIEAVGNISAIT--SKGSDFEVSVNCDTLDLADVKIGDSIATNGICLTVVKLT--- 55

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             DN Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+D   E++   
Sbjct: 56  --DNSYIADLSIETLSRTAFNYYKVGQAVNLEKAMLPTTRFGGHIVSGHVDAVAEVIECR 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P  +E++++ KGSV ++GVSLTVN V  N F + ++ HT+ ETT    
Sbjct: 114 TSGRAIDIWVRVPSQIEKYLSEKGSVTVDGVSLTVNAVRGNEFKLTIVPHTVVETTIADF 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
           KVG+ INIEVD + RYI RL  ++  +
Sbjct: 174 KVGNKINIEVDILARYIERLLLVDKPE 200


>gi|194364359|ref|YP_002026969.1| riboflavin synthase subunit alpha [Stenotrophomonas maltophilia
           R551-3]
 gi|194347163|gb|ACF50286.1| riboflavin synthase, alpha subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 208

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 117/205 (57%), Gaps = 14/205 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKM-----KLGCSIAHAGICLTVVRLSE 55
           MFTGI+  +G++ A   I   +R     ++N   +     ++G SIA  G+CLTV+    
Sbjct: 1   MFTGIIEGVGRLAARESIGGDVRF----TFNVGNLPFDNVQMGESIAINGVCLTVIAFDA 56

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                + ++ +   ET  +T +     G  INLER+++  DRL GHLVSGH+DG  ++L 
Sbjct: 57  -----SSFQADASTETLGLTTLGQLSEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVLS 111

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
           +     +   R + P +L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T + 
Sbjct: 112 IHEDARAQRWRFAAPASLRRYIAKKGSICVDGVSLTVNEVDDEGFEVALIPHTVANTAFS 171

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
              VG  +N+E+D + RY+ RL ++
Sbjct: 172 AAGVGSAVNLEIDLVARYVERLISV 196


>gi|296395032|ref|YP_003659916.1| riboflavin synthase subunit alpha [Segniliparus rotundus DSM 44985]
 gi|296182179|gb|ADG99085.1| riboflavin synthase, alpha subunit [Segniliparus rotundus DSM
           44985]
          Length = 211

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 116/209 (55%), Gaps = 16/209 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  + P     +L +        +  G SIA  G+CLTVV   E     
Sbjct: 1   MFTGLVEELGEVAWLNPSGDAAQLAIRARVVVDGLGHGDSIAVNGVCLTVVEQPEP---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET R T++ +   G+ ++LER++ LGDRL GHLV GH+DGT  +L      
Sbjct: 57  GMFVVDAMGETLRHTSVGALAPGSLVHLERALALGDRLGGHLVQGHVDGTGRVLSHTKGE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK------------NFFDVLLIRHT 168
                R+SLP  L +++A KGS+ ++GVSLTV+ +G              +F+V LI  T
Sbjct: 117 QWDVVRISLPEELRKYVAHKGSITVDGVSLTVSAIGGPEQDGSADNEGITWFEVSLIPET 176

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARL 197
           I  TT   H  GD++N+EVD + +Y+ RL
Sbjct: 177 IRATTLGRHATGDVVNLEVDVIAKYVERL 205


>gi|328881088|emb|CCA54327.1| Riboflavin synthase alpha chain [Streptomyces venezuelae ATCC
           10712]
          Length = 202

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 119/204 (58%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +    R R+     T   + G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEVVAVEQLEDASRFRLRGPLVTEGAQHGDSIAVNGVCLTVVEFG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +  +GT +NLER + +G RL GH+V GH+DGT  IL      
Sbjct: 56  GEFTADVMAETLKRSSLGALDVGTRVNLERPMAVGGRLGGHIVQGHVDGTGTILERSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++ LP +L +++  KGS+ ++GVSLTV  V  ++F + LI  T++ TT  + + G
Sbjct: 116 HWELVKVGLPAHLSRYVVEKGSITVDGVSLTVVEVADDWFTISLIPTTLDLTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL   +  +
Sbjct: 176 DPVNLEVDVIAKYVERLLGADAKE 199


>gi|302879547|ref|YP_003848111.1| riboflavin synthase, alpha subunit [Gallionella capsiferriformans
           ES-2]
 gi|302582336|gb|ADL56347.1| riboflavin synthase, alpha subunit [Gallionella capsiferriformans
           ES-2]
          Length = 198

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 117/198 (59%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GI+ D+G I        G+RL V         +++G SIA  G+CLTVV LS     
Sbjct: 1   MFSGIIADVGIITRAVDREGGLRLSVEAEVLGMDDVQIGDSIAVNGVCLTVVTLSGRE-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T +     G  +NLE++++L DRL GHLVSGH+DG   ++  + I
Sbjct: 59  ---FTVDVSRETLSCT-VGLAHQGAHVNLEKALRLSDRLGGHLVSGHVDGVGSVVAFNDI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P +L ++IAVKGS+ +NGVSLTVN V    F+V LI HT++ TT    K 
Sbjct: 115 GESWRLVVRAPQSLAKYIAVKGSITINGVSLTVNHVAGAEFEVNLIPHTLDVTTLNELKT 174

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ R+
Sbjct: 175 GAQVNLEIDLIARYVERM 192


>gi|21230170|ref|NP_636087.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769840|ref|YP_244602.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21111705|gb|AAM40011.1| riboflavin synthase alpha chain [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575172|gb|AAY50582.1| riboflavin synthase alpha chain [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 200

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T S     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLAARQPQGGDVRFTFATGSLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + S   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGSLQEGAVLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V    F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPQVLRYVAKKGSICVDGVSLTVNEVDDAGFEVALIPHTVANTAFSETAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|283765818|gb|ADB28301.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 87/135 (64%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           + P+ +GMRL++ T Y    + +G SIA +GICLT+V    + ++  W+ VE W ET R+
Sbjct: 6   VQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGVQQAIAGWFVVEAWEETLRL 65

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +     
Sbjct: 66  TNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEGDAIRFYLKVARQFM 125

Query: 135 QFIAVKGSVCLNGVS 149
            FI  KGS+ LNG S
Sbjct: 126 PFIVNKGSIALNGTS 140


>gi|325928454|ref|ZP_08189645.1| riboflavin synthase, alpha subunit [Xanthomonas perforans 91-118]
 gi|325541171|gb|EGD12722.1| riboflavin synthase, alpha subunit [Xanthomonas perforans 91-118]
          Length = 200

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDEDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|168214535|ref|ZP_02640160.1| riboflavin synthase, alpha subunit [Clostridium perfringens CPE
           str. F4969]
 gi|170714019|gb|EDT26201.1| riboflavin synthase, alpha subunit [Clostridium perfringens CPE
           str. F4969]
          Length = 217

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 120/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKLSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE DS+ +Y+ +L   N
Sbjct: 176 DLVNIECDSIGKYVEKLLGFN 196


>gi|310822847|ref|YP_003955205.1| riboflavin synthase subunit alpha [Stigmatella aurantiaca DW4/3-1]
 gi|309395919|gb|ADO73378.1| Riboflavin synthase, alpha subunit [Stigmatella aurantiaca DW4/3-1]
          Length = 216

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 113/202 (55%), Gaps = 8/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMR-LRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG++ D+G +  +  +  GM  L + TS       LG SIA  G CLTVV    E   
Sbjct: 1   MFTGLIQDVGVVERV--VTGGMTDLWLRTSLGAGSFALGESIAVDGACLTVV----ERGG 54

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  ++V+   ET R T +     GT +NLER++ LGDRL GHLV+GH+D   E+L     
Sbjct: 55  DT-FKVQAAPETLRRTTMGELRPGTRVNLERAMALGDRLGGHLVAGHVDAVSEVLETRPE 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S      LP  L  +   KGSV ++G+SLTVN V  + F V LI  T E TT +   V
Sbjct: 114 GGSWVMAFRLPQELAPYFIDKGSVAVDGISLTVNAVLSDRFTVQLIPETQERTTLRAKAV 173

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E D + +Y+ARL++L 
Sbjct: 174 GARVNLEADMIGKYVARLFSLR 195


>gi|21241519|ref|NP_641101.1| riboflavin synthase subunit alpha [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78046356|ref|YP_362531.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|21106866|gb|AAM35637.1| riboflavin synthase alpha chain [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78034786|emb|CAJ22431.1| riboflavin synthase, alpha chain [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 200

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDEDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|15606790|ref|NP_214170.1| riboflavin synthase subunit alpha [Aquifex aeolicus VF5]
 gi|8928298|sp|O67604|RISA_AQUAE RecName: Full=Riboflavin synthase alpha chain
 gi|2984029|gb|AAC07572.1| riboflavin synthase alpha chain [Aquifex aeolicus VF5]
          Length = 207

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 116/194 (59%), Gaps = 7/194 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V D+GK+  +T  +KG +L V T      +KLG S++  G CLTVV +       
Sbjct: 1   MFTGLVEDLGKVKNLTLSSKGAKLSVETKL--EDVKLGDSVSVNGACLTVVDIK-----S 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +    +V  ET + TN+     G ++NLER++++G+RL GH+V GH+D T  +   +F+G
Sbjct: 54  STLTFDVSPETLKRTNLGKLKTGDYVNLERALRVGERLGGHIVQGHVDFTAPVKSFNFLG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +     + +P     ++  KGS+ L+G+SLTVN V +N   + +I HT + T  +  KVG
Sbjct: 114 EHYELVIEIPEEWSIYVVEKGSIALDGISLTVNYVKENKVFINIIPHTYKSTNLQFKKVG 173

Query: 181 DLINIEVDSMMRYI 194
           DL+N+E D + +Y+
Sbjct: 174 DLLNVETDILGKYV 187


>gi|182439883|ref|YP_001827602.1| riboflavin synthase subunit alpha [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326780549|ref|ZP_08239814.1| riboflavin synthase, alpha subunit [Streptomyces cf. griseus
           XylebKG-1]
 gi|178468399|dbj|BAG22919.1| putative riboflavin synthase alpha subunit [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326660882|gb|EGE45728.1| riboflavin synthase, alpha subunit [Streptomyces cf. griseus
           XylebKG-1]
          Length = 202

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A   R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLADASRFRLRGPLVTEGAKHGDSIAVNGVCLTVV-----DTGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + + + +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GEFTADVMAETLKRSGLGALAPGSRVNLERPMALGGRLGGHLVQGHVDGTGTIVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++GVSLTV     +FF + LI  T+  TT    + G
Sbjct: 116 HWELVKVSLPPELSRYVVEKGSITVDGVSLTVVEAAADFFTISLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ R+      Q
Sbjct: 176 DPVNLEVDVIAKYVERMLGDRAGQ 199


>gi|113969441|ref|YP_733234.1| riboflavin synthase subunit alpha [Shewanella sp. MR-4]
 gi|114046669|ref|YP_737219.1| riboflavin synthase subunit alpha [Shewanella sp. MR-7]
 gi|113884125|gb|ABI38177.1| riboflavin synthase, alpha subunit [Shewanella sp. MR-4]
 gi|113888111|gb|ABI42162.1| riboflavin synthase, alpha subunit [Shewanella sp. MR-7]
          Length = 218

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLAAPAELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + RY+ RL   +T +
Sbjct: 176 GDKVNIEVDLIARYLERLMRFDTKE 200


>gi|325923220|ref|ZP_08184899.1| riboflavin synthase, alpha subunit [Xanthomonas gardneri ATCC
           19865]
 gi|325546302|gb|EGD17477.1| riboflavin synthase, alpha subunit [Xanthomonas gardneri ATCC
           19865]
          Length = 200

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +R    T S     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGHLAARQPQGGDVRFTFATGSLPFEAVQLGESIAVNGVCLTVIAFDA---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 57  -GSFQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEDGFEVALIPHTVANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|77361289|ref|YP_340864.1| riboflavin synthase subunit alpha [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876200|emb|CAI87422.1| Riboflavin synthase subunit E [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 217

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI  +      + +RV +   + S +KLG SIA  G+CLTVV   ++H+ 
Sbjct: 1   MFTGIIEATGKIALLQKKQGDLAIRVQSPDLDMSDVKLGDSIATNGVCLTVV---DKHT- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  ++  ET  +T  A + +G  +NLE++++   RL GHLVSGH+DG   I  +   
Sbjct: 57  -DGFSADLSNETIDLTGFAHYTLGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITAITPN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   NL ++I  KGSVC++G+SLTVN V  N F + ++ HT E+TT    KV
Sbjct: 116 ARATEYWLTTDENLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSEQTTIANFKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTQVNLEVDQIARYLERL 193


>gi|332286797|ref|YP_004418708.1| riboflavin synthase subunit alpha [Pusillimonas sp. T7-7]
 gi|330430750|gb|AEC22084.1| riboflavin synthase subunit alpha [Pusillimonas sp. T7-7]
          Length = 210

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 125/213 (58%), Gaps = 21/213 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMR-----LRVMTS-YNTSKMKLGCSIAHAGICLTVVRLS 54
           MFTGIV  +GKII + P  +G +     L++    + T   KLG SIA  G C+TVV L 
Sbjct: 1   MFTGIVAAVGKIIKVIPFNEGQKDAGVHLKIQVGGFLTDSTKLGDSIAIQGACMTVVALE 60

Query: 55  EEHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
            +      + V+V  E+ NR   + + G    +NLE +++LGD LDGHLVSGH+DG   +
Sbjct: 61  PDS-----FSVDVSRESLNRTAGLDAVG---EVNLEHALRLGDSLDGHLVSGHVDGLGLV 112

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD-----VLLIRHT 168
              + +G+S   R+ +P  L +++A KGSV +NGVSLTVN V  +  D     + LI HT
Sbjct: 113 SRFEPVGESWDLRIKVPQELAKYMAYKGSVTVNGVSLTVNRV-DDMADGCEIHINLIPHT 171

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           ++ TT K    G  +N+E+D++ RY+ R+ +L 
Sbjct: 172 VQVTTLKHLAAGASVNLEIDTIARYVERMVSLQ 204


>gi|110799364|ref|YP_695001.1| riboflavin synthase subunit alpha [Clostridium perfringens ATCC
           13124]
 gi|168216369|ref|ZP_02641994.1| riboflavin synthase, alpha subunit [Clostridium perfringens NCTC
           8239]
 gi|110674011|gb|ABG82998.1| riboflavin synthase, alpha subunit [Clostridium perfringens ATCC
           13124]
 gi|182381310|gb|EDT78789.1| riboflavin synthase, alpha subunit [Clostridium perfringens NCTC
           8239]
          Length = 217

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 119/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE DS+ +Y+ +L    
Sbjct: 176 DLVNIECDSIGKYVEKLLGFK 196


>gi|166710622|ref|ZP_02241829.1| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 200

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  +  ++A KGS+C++GVSLTVN V +  F+V LI HTI  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLHYVAKKGSICVDGVSLTVNEVDEEGFEVALIPHTIANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GATVNLEIDLVARYVERL 193


>gi|302525888|ref|ZP_07278230.1| riboflavin synthase, alpha subunit [Streptomyces sp. AA4]
 gi|302434783|gb|EFL06599.1| riboflavin synthase, alpha subunit [Streptomyces sp. AA4]
          Length = 201

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 117/199 (58%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    RL V     TS    G SIA +G+CLTVV +S      
Sbjct: 1   MFTGIVEEVGEVTAVEQLTDAARLTVRGPLVTSDAGHGDSIAVSGVCLTVVTVS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + +++A   +G  +NLER+   G RL GH++ GH+DGT   L  D  G
Sbjct: 56  GEFTVDVVNETLQRSSLAKVAVGDAVNLERATPAGGRLGGHIMQGHVDGTGVFLSRDERG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +   SLP  L +++  KGS+ ++GVSLTV  + ++ F V LI  T+E TT    + G
Sbjct: 116 VTTF---SLPPALARYVVEKGSIAVDGVSLTVASIAEDRFSVALIPTTLEATTLGRREEG 172

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ +L A
Sbjct: 173 DHVNLEVDVVAKYVEKLTA 191


>gi|159037491|ref|YP_001536744.1| riboflavin synthase subunit alpha [Salinispora arenicola CNS-205]
 gi|157916326|gb|ABV97753.1| riboflavin synthase, alpha subunit [Salinispora arenicola CNS-205]
          Length = 220

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRL-RVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++ +T  A+   L  +  S   +  + G SIA  G+CLTVV L+     
Sbjct: 1   MFTGIVEELGEVVQVTQTAEDSALVAIRGSVVVADARHGDSIAVNGVCLTVVDLA----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  +V  ET R + +     G  +NLER+  LG RL GHLV GH+DG  E+L  +  
Sbjct: 56  DGAFTADVMGETLRRSALGGLRPGDRVNLERAATLGSRLGGHLVQGHVDGIGEVLAREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP +L +++  KGS+ ++GVSLTV  VG ++F+V LI  T+  TT     V
Sbjct: 116 ARWETVRFRLPTDLARYVVTKGSITVDGVSLTVAGVGSDWFEVGLIPTTLGLTTLGSRGV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + +Y+ RL
Sbjct: 176 GDAVNVEVDVLAKYVERL 193


>gi|117919546|ref|YP_868738.1| riboflavin synthase subunit alpha [Shewanella sp. ANA-3]
 gi|117611878|gb|ABK47332.1| riboflavin synthase, alpha subunit [Shewanella sp. ANA-3]
          Length = 218

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLAAPTELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + RY+ RL   +T +
Sbjct: 176 GDKVNIEVDLIARYLERLMRFDTKE 200


>gi|254787585|ref|YP_003075014.1| riboflavin synthase subunit alpha [Teredinibacter turnerae T7901]
 gi|237684167|gb|ACR11431.1| riboflavin synthase, alpha subunit [Teredinibacter turnerae T7901]
          Length = 219

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 120/200 (60%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT-SKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I+++      +RLRV  +  + S + LG SIA  G+CLT V L      
Sbjct: 1   MFTGIIETVGQIVSLERRGGDVRLRVRAADMSWSDVALGDSIATNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T+I SW  GT +NLE+++    RL GH+VSGH+DG  E++  +  
Sbjct: 56  GDGFAADVSLETLSLTSIGSWKSGTAVNLEKALTPQSRLGGHIVSGHVDGLGEVV--ERA 113

Query: 120 GDSMYCRLSL--PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            D+   R S+  P  L ++IA KGS+ ++G SLTVN V  + F++ ++ HTIE T    +
Sbjct: 114 PDARSERFSIRAPRELAKYIAHKGSITVDGTSLTVNKVNGDVFELNIVPHTIERTIIGEY 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
             G  +N+EVD + RY+ RL
Sbjct: 174 TAGTQVNLEVDVIARYLERL 193


>gi|256827879|ref|YP_003156607.1| riboflavin synthase subunit alpha [Desulfomicrobium baculatum DSM
           4028]
 gi|256577055|gb|ACU88191.1| riboflavin synthase, alpha subunit [Desulfomicrobium baculatum DSM
           4028]
          Length = 218

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 108/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G++ AM       R  V   +  +   LG SIA  G+CLTV     E    
Sbjct: 1   MFTGIIQGLGRVAAMDRRGSETRFTVRPDFALTDYALGESIAVNGVCLTV-----ETFGA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+      ET  +TN+ + G+ + +NLER++ +GDRL GH+VSGH+D   E+L +   G
Sbjct: 56  GWFTAYASGETMSVTNLGALGVSSSVNLERALAMGDRLGGHIVSGHVDCLAEVLSIRQAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   RL  P +    +  KGSV L+G+SLTVN  G+ + +V +I  T  ETT      G
Sbjct: 116 QSRIYRLGFPASYSSQVIPKGSVALDGISLTVNDCGQGYLEVNIIPATQRETTISDWAQG 175

Query: 181 DLINIEVDSMMRYIARL 197
             IN+E D + +Y+ R+
Sbjct: 176 RRINMETDVIGKYVQRM 192


>gi|91792503|ref|YP_562154.1| riboflavin synthase subunit alpha [Shewanella denitrificans OS217]
 gi|91714505|gb|ABE54431.1| riboflavin synthase, alpha subunit [Shewanella denitrificans OS217]
          Length = 217

 Score =  134 bits (337), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +    + +RL V +   + S +KLG SIA  G+CLTVV+     S+
Sbjct: 1   MFTGIIEALGTLTKIERHGQDIRLTVDSGKLDLSDVKLGDSIATNGVCLTVVQ-----SL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V AET  +T  A + +G  +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  KQGYMADVSAETVALTGFARYKVGQKVNLEKALTATTRLGGHMVSGHVDGMAEVMQRQAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L  P  L ++IA KGSV ++GVSLTVN V  + F + ++ HT  ETT      
Sbjct: 116 GKAIEFWLKAPSELARYIAHKGSVTIDGVSLTVNEVDGDNFRLTIVPHTAGETTLLDLNT 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + RY+ RL
Sbjct: 176 GDRVNLEVDLIARYLERL 193


>gi|253699857|ref|YP_003021046.1| riboflavin synthase subunit alpha [Geobacter sp. M21]
 gi|251774707|gb|ACT17288.1| riboflavin synthase, alpha subunit [Geobacter sp. M21]
          Length = 214

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+++++        L V TS    ++ +G SIA  G CLTVVR        
Sbjct: 1   MFTGLIETVGELVSIEKRGASGSLTVKTSLPLDEVAIGASIAINGACLTVVRKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                ++  ET   T   +   G+ +N+ER+++L DRLDGHLVSGH+D    ++    + 
Sbjct: 56  GAVTFDISPETIDRTGFKNLKSGSPVNMERAMRLSDRLDGHLVSGHVDCVATVIERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++      PH   ++IA KGSV ++G+SLTVN  G + F + +I HT  +TT    +VG
Sbjct: 116 GNIVFSFRFPHQYGKYIAAKGSVAIDGISLTVNSAGPDSFSINVIPHTAAKTTLIGKRVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +NIE D + RY+ RL A
Sbjct: 176 DEVNIETDLLCRYLERLLA 194


>gi|294667127|ref|ZP_06732352.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603137|gb|EFF46563.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 200

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 117/200 (58%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G++ A  P  +G  +R   +  T     ++LG SIA  G+CLTV+      
Sbjct: 1   MFTGIIEGVGQLAARQP--QGGDVRFTFAAGTLPFDSVQLGESIAVNGVCLTVIAFDAAS 58

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  + 
Sbjct: 59  -----FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSIH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +   
Sbjct: 114 DDARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDQDGFEVALIPHTVAHTAFAQT 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  +N+E+D + RY+ RL
Sbjct: 174 AVGAAVNLEIDLVARYVERL 193


>gi|227549214|ref|ZP_03979263.1| riboflavin synthase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078668|gb|EEI16631.1| riboflavin synthase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 197

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++A+T +   +R+ V      +  + G SIA  G+CLTVV      + D
Sbjct: 1   MFTGLVEEVGEVVALTKLDDSVRIAVRAPRVATDARHGDSIAVDGVCLTVV-----DTAD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + + S+  G+ +NLER++  G R+ GH+V GH+DG  ++L      
Sbjct: 56  GVFSADVMQETLDRSRLGSYVEGSRVNLERALAAGARMGGHIVQGHVDGVAQVLSRTASE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R SLP  L +++  KGS+ +NG SLTV+ VG+++F+V LI  T+ +TT      G
Sbjct: 116 NWEVIRFSLPAGLARYVVEKGSITVNGTSLTVSAVGEDYFEVSLIPTTLTDTTASSLATG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+EVD + +Y+ ++
Sbjct: 176 ENVNLEVDIVAKYVEKM 192


>gi|291003621|ref|ZP_06561594.1| riboflavin synthase subunit alpha [Saccharopolyspora erythraea NRRL
           2338]
          Length = 211

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 109/190 (57%), Gaps = 8/190 (4%)

Query: 8   DIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEV 67
           ++G + A  P+A G RL V     TS    G SIA  G+CLTVV + E       + V+V
Sbjct: 3   ELGTVTAAEPLADGSRLTVAGPVVTSDAGHGDSIAVNGVCLTVVDVLE-----GAFTVDV 57

Query: 68  WAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRL 127
            AET R +++   G+G  +NLER++ LGDRL GH+V GH+DGT  +   +  G     R 
Sbjct: 58  VAETLRRSSLKHVGVGDRVNLERAMALGDRLGGHIVQGHVDGTAVLRSAEADG---LTRF 114

Query: 128 SLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEV 187
            LP  L +++  KGS+ ++GVSLTV   G+  F V LI  T E TT      GD +NIEV
Sbjct: 115 DLPARLSRYVVEKGSITVDGVSLTVVEAGEESFSVALIPTTKELTTLGFRAPGDEVNIEV 174

Query: 188 DSMMRYIARL 197
           D + +++ RL
Sbjct: 175 DVLAKHVERL 184


>gi|260772213|ref|ZP_05881129.1| riboflavin synthase alpha chain [Vibrio metschnikovii CIP 69.14]
 gi|260611352|gb|EEX36555.1| riboflavin synthase alpha chain [Vibrio metschnikovii CIP 69.14]
          Length = 218

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 122/198 (61%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G ++ MT   + + + V T   + S +KLG SIA  G+CLTV+ +S +H  
Sbjct: 1   MFTGIIEAVGSLVEMTRQGEDVTITVATGKLDMSDVKLGDSIATNGVCLTVIDVSSQH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET   +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+   ++
Sbjct: 59  ---YCADLSLETLNKSAFAHYQVGEKLNLEKAMLPTTRFGGHIVSGHVDGIGEIIERQWV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +SLP+ L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    + 
Sbjct: 116 GRAIELWVSLPNELTRYVAEKGSITIDGISLTVNGLRKNAFKLTIVPHTSLETTIDGFQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYLERL 193


>gi|254428561|ref|ZP_05042268.1| riboflavin synthase, alpha subunit [Alcanivorax sp. DG881]
 gi|196194730|gb|EDX89689.1| riboflavin synthase, alpha subunit [Alcanivorax sp. DG881]
          Length = 219

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ AMTP    + L + +   + S ++LG SIA  G+CLT   L      
Sbjct: 1   MFTGIIESMGKVAAMTPKGGDVTLLIKSDGLDFSDVQLGDSIAVNGVCLTATALP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +E +V  ET  +T++A   +G+ +NLE+++    RL GHLVSGH+DG  +I+ +   
Sbjct: 56  GSAFEADVSGETLSLTSLAQISVGSTVNLEKALTPSSRLGGHLVSGHVDGLGKIVEMKQD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P  L ++IA KGS+ ++G+SLTVN V    F + +I HT E TT    +V
Sbjct: 116 ARSVRIDIEAPAELAKYIAHKGSITVDGISLTVNSVVGAVFSLNIIPHTQEVTTIGQWQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTPVNLEVDIIARYLERL 193


>gi|283765816|gb|ADB28300.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 86/135 (63%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           + P+ +GMRL++ T Y    + +G SIA +GICLT+V    + +   W+ VE W ET R+
Sbjct: 6   VQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGVQQATAGWFVVEAWEETLRL 65

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +     
Sbjct: 66  TNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEGDAIRFYLKVARQFM 125

Query: 135 QFIAVKGSVCLNGVS 149
            FI  KGS+ LNG S
Sbjct: 126 PFIVNKGSIALNGTS 140


>gi|262370186|ref|ZP_06063513.1| riboflavin synthase subunit alpha [Acinetobacter johnsonii SH046]
 gi|262315225|gb|EEY96265.1| riboflavin synthase subunit alpha [Acinetobacter johnsonii SH046]
          Length = 219

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G + ++  +   +RLR+ T  + S + LG SIA  GICLTV+   E     
Sbjct: 1   MFTGIIESLGTVESVQNVGGDVRLRIGTDLDMSDVHLGDSIATNGICLTVIDWGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY  +V  E+   T +A W +G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  HWYAADVSRESLNRTTLAHWKVGQRVNVEKAMLPTTRFGGHIVSGHVDAVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGS+ ++G+SLT+N +      + LI HT E T     K G
Sbjct: 116 RSLYFEVTAPAEIARYLAEKGSITVDGISLTINHLRGRILSLNLIPHTAERTNIGTWKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RYI RL
Sbjct: 176 SQVNLEVDVLARYIERL 192


>gi|255994554|ref|ZP_05427689.1| riboflavin synthase, alpha subunit [Eubacterium saphenum ATCC
           49989]
 gi|255993267|gb|EEU03356.1| riboflavin synthase, alpha subunit [Eubacterium saphenum ATCC
           49989]
          Length = 213

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ + GKI+  TP  +     ++     + +++G SIA  G CLTV   ++ H   
Sbjct: 1   MFTGLIEEKGKILN-TPQGEAGSFSIVADDILNDVEIGDSIAVNGTCLTVTAFTKGH--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +EV+V AET R+T +    IG  +NLER+++ G R  GH+VSGHIDGT  I  +    
Sbjct: 57  --FEVDVLAETLRMTTLGKLRIGDEVNLERAMQAGKRFGGHIVSGHIDGTGRIRSISGEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +  +  + +   L   I +KGSV ++GVSLTV  VG+N F V +I HT EETT    K G
Sbjct: 115 NGTWITIVINPELMGNIVLKGSVAIDGVSLTVANVGENEFQVCVIPHTGEETTLVGKKAG 174

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIEVD + +YI  + +  + +
Sbjct: 175 DVVNIEVDMIAKYINNILSEKSEK 198


>gi|192361915|ref|YP_001983155.1| riboflavin synthase subunit alpha [Cellvibrio japonicus Ueda107]
 gi|190688080|gb|ACE85758.1| riboflavin synthase, alpha subunit [Cellvibrio japonicus Ueda107]
          Length = 219

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 119/200 (59%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG+++A+ P    +RLR+ T + N + + LG SIA  G+CLTVV L      
Sbjct: 1   MFTGIIEAIGEVVALQPQNGDLRLRIKTHHLNLADVHLGDSIATNGVCLTVVDLP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL--FLD 117
            + Y  +V  ET   T +  W +G  +NLE+++    RL GH+VSGH+DG  E++  F D
Sbjct: 56  GDGYWADVSRETLDNTTLPGWKLGQRVNLEKALTPQTRLGGHIVSGHVDGVGEVVKRFPD 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
              +  + R   P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT++ T    +
Sbjct: 116 ARSERFHIRA--PKELAKYIAHKGSITVDGTSLTVNKVDGAVFELNIVPHTLQWTIMDTY 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           + G  +N+EVD + RY+ RL
Sbjct: 174 QTGTNVNLEVDVLARYLERL 193


>gi|95929566|ref|ZP_01312308.1| riboflavin synthase, alpha subunit [Desulfuromonas acetoxidans DSM
           684]
 gi|95134263|gb|EAT15920.1| riboflavin synthase, alpha subunit [Desulfuromonas acetoxidans DSM
           684]
          Length = 215

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ DIG +  +   A  ++L V T+    ++ LG SIA  GICLTV+R        
Sbjct: 1   MFTGLIEDIGTVRELRHGASSVQLTVATTLPMDEIALGDSIAVNGICLTVIRYGS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   TN+ +   G+ +NLER+++L DRL GHLVSGH+D    ++     G
Sbjct: 56  GVFVADVSPETLECTNLGAVSPGSQVNLERALQLSDRLGGHLVSGHVDDVATVVERRRDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++     L  +  +++  KGS+ ++G+SLTVN V +  F V +I H++E+TT K  +VG
Sbjct: 116 NAIRFTFRLAAHTLRYVVAKGSITIDGISLTVNEVTEETFSVAIIPHSLEKTTLKNVQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + RY+ +L
Sbjct: 176 GRVNIETDIIARYVEKL 192


>gi|86147436|ref|ZP_01065748.1| riboflavin synthase subunit alpha [Vibrio sp. MED222]
 gi|85834729|gb|EAQ52875.1| riboflavin synthase subunit alpha [Vibrio sp. MED222]
          Length = 218

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V   + + + +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLSAITPRGEDITVTVNVGHLDMADVKLGDSIATNGVCLTVVEYN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  DHSYSADLSLETLKKTGFVDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGSV ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWVEMPAEISKYVAQKGSVTVDGISLTVNDLRKNAFKLTIVPHTSSETTIDQFNV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|25028271|ref|NP_738325.1| riboflavin synthase subunit alpha [Corynebacterium efficiens
           YS-314]
 gi|259506814|ref|ZP_05749714.1| riboflavin synthase, alpha subunit [Corynebacterium efficiens
           YS-314]
 gi|23493555|dbj|BAC18525.1| putative riboflavin synthase alpha chain [Corynebacterium efficiens
           YS-314]
 gi|259165600|gb|EEW50154.1| riboflavin synthase, alpha subunit [Corynebacterium efficiens
           YS-314]
          Length = 205

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +  +   +RL +  +     + LG SI+  G+CLTV    E H   
Sbjct: 1   MFTGIVEELGSVSGVENLGDSVRLTIAATRVLEDVNLGDSISVNGVCLTVATFEEGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +   ET   +++ S  +G+ +NLER++    RL GH++ GH+DGT  +L  +   
Sbjct: 58  --FTADCMQETLDRSSLGSLTVGSPVNLERAMAANGRLGGHIMQGHVDGTTTLLSRESSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R +LP +L +++  KGS+ LNG SLTV+ +G+++F+V LI  T+ ETT    +VG
Sbjct: 116 NWDVLRFALPADLARYVVEKGSIALNGTSLTVSSLGEDWFEVSLIPTTLRETTHGHLQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIEVD + +Y+ R+
Sbjct: 176 DVVNIEVDVIAKYVERM 192


>gi|197123235|ref|YP_002135186.1| riboflavin synthase subunit alpha [Anaeromyxobacter sp. K]
 gi|196173084|gb|ACG74057.1| riboflavin synthase, alpha subunit [Anaeromyxobacter sp. K]
          Length = 215

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 109/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V D+G +  + P   G RL +  +     ++ LG SIA +G CLTVV        
Sbjct: 1   MFTGLVADVGVVERIVPRQGGARLTLRPARLPVDELVLGESIACSGACLTVVERG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +   ET   T +  W  GT +NLER++ +G+RL GHLV GH+D   E+L     
Sbjct: 56  GGLVSFDAVPETLARTTVGGWRPGTKVNLERALAVGERLGGHLVQGHVDAVGEVLRRVPE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      +SLP ++   +A KGS+ ++GVSLTV   G++ F++ LI  T+  TT      
Sbjct: 116 GQGARLTISLPPSIAPLVAEKGSIAVDGVSLTVATAGRDRFELALIPETLARTTLGQAAA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E D + R++ARL A  
Sbjct: 176 GAKVNLEADVLARHVARLRAFE 197


>gi|239932465|ref|ZP_04689418.1| riboflavin synthase subunit alpha [Streptomyces ghanaensis ATCC
           14672]
 gi|291440829|ref|ZP_06580219.1| riboflavin synthase subunit alpha [Streptomyces ghanaensis ATCC
           14672]
 gi|291343724|gb|EFE70680.1| riboflavin synthase subunit alpha [Streptomyces ghanaensis ATCC
           14672]
          Length = 204

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 119/197 (60%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV    EH  D
Sbjct: 1   MFTGIVEELGEVTAVETLDDACRFRLRGPVVTEDAKHGDSIAVNGVCLTVV----EHEGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER + LG RL GH+V GH+DGT EIL      
Sbjct: 57  E-FTADVMAETLNRSSLGALAVGSRVNLERPMALGARLGGHIVQGHVDGTGEILERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + G
Sbjct: 116 NWEVVKVSLPADLSRYVVEKGSITVDGISLTVVDAGPDFFTVSLIPTTLALTTLGLKQPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ R+
Sbjct: 176 DPVNLEVDVIAKYVERM 192


>gi|212634189|ref|YP_002310714.1| riboflavin synthase subunit alpha [Shewanella piezotolerans WP3]
 gi|212555673|gb|ACJ28127.1| Lumazine-binding protein [Shewanella piezotolerans WP3]
          Length = 221

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGHLRKVERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVE-----QL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADISAETVSLTGFAHYAVGTAVNLEKAVTPTTRLGGHMVSGHVDGIAHVDDRQVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLTPPAELGRYIAHKGSITIDGVSLTVNEVQGHRFRLTIVPHTAGETTLIDLKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL + ++ Q
Sbjct: 176 GDSVNIEVDLIARHLERLMSYSSEQ 200


>gi|326791793|ref|YP_004309614.1| riboflavin synthase, subunit alpha [Clostridium lentocellum DSM
           5427]
 gi|326542557|gb|ADZ84416.1| riboflavin synthase, alpha subunit [Clostridium lentocellum DSM
           5427]
          Length = 216

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 118/200 (59%), Gaps = 5/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  +    K  R+++       + ++G SIA  G+CLT+  ++      
Sbjct: 1   MFTGIVEEIGYVEHIQNGEKFSRIKINAVKVLEQSQIGESIATNGVCLTITNMT-----S 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +E ++ AET R +N+ S  IG  +NLER++ L  RL GHLVSGHIDG  E++ +    
Sbjct: 56  GSFEADIMAETLRKSNLGSLRIGAAVNLERAMHLSSRLGGHLVSGHIDGIGEMMSITKEA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +  +  P  + +++ +KGS+ ++G+SLTV  V K +F V +I HT  +TT  M  V 
Sbjct: 116 AATWITIKAPAEILRYVVLKGSIAIDGISLTVADVTKEYFKVSVIPHTKNKTTLLMKGVT 175

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+EVD + +Y+ RL  L
Sbjct: 176 DQVNLEVDIIGKYVERLLGL 195


>gi|262202281|ref|YP_003273489.1| riboflavin synthase subunit alpha [Gordonia bronchialis DSM 43247]
 gi|262085628|gb|ACY21596.1| riboflavin synthase, alpha subunit [Gordonia bronchialis DSM 43247]
          Length = 215

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 9/203 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A   +    R+ V     TS    G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEIAAREDLPDAARITVRGPVVTSDAGYGDSIAVNGVCLTVV-----EKRD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V AET R ++++  G G+ +NLER++  G R  GH+V GH+DGT E++ +    
Sbjct: 56  DSFTVDVMAETLRRSSLSGLGPGSRVNLERAMPAGGRFGGHIVQGHVDGTGEVMSVSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
                R+++P  L +++  KGS+ ++GVSLTV  +G+     +F++ LI  T+ ET    
Sbjct: 116 HWTVVRIAMPGQLSRYLVEKGSITVDGVSLTVAALGETDQTPWFEISLIPTTLSETNLGS 175

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
              G ++N+EVD + +Y+ RL+ 
Sbjct: 176 AAPGTVVNLEVDVIAKYVERLHP 198


>gi|84394362|ref|ZP_00993083.1| riboflavin synthase subunit alpha [Vibrio splendidus 12B01]
 gi|218710375|ref|YP_002417996.1| riboflavin synthase subunit alpha [Vibrio splendidus LGP32]
 gi|84375021|gb|EAP91947.1| riboflavin synthase subunit alpha [Vibrio splendidus 12B01]
 gi|218323394|emb|CAV19571.1| Riboflavin synthase alpha chain [Vibrio splendidus LGP32]
          Length = 218

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 120/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V + + + + +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLSAITPRGEDITVTVNVGNLDMADVKLGDSIATNGVCLTVVEYN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  DHSYSADLSLETLKKTGFVDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGSV ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWVEMPAEISKYVAQKGSVTVDGISLTVNDLRKNAFKLTIVPHTSSETTIDQFNV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|94264513|ref|ZP_01288300.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
 gi|93455072|gb|EAT05299.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
          Length = 222

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 111/201 (55%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GKI    P   G+ L + T +  ++   G SIA  G+CLT  R        
Sbjct: 1   MFTGIILGKGKIYEKRPAGGGVTLGLETDFPLAEPLEGESIAINGVCLTARRFQ-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  E+   TN+    +G  +NLER+++L DRL GHLVSGH+D   E+L     G
Sbjct: 56  NRFLADVSPESLERTNLGRLAVGGRVNLERALRLSDRLGGHLVSGHVDAVAEVLARQPHG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D      ++P  L ++I  KGS+ ++G+SLTVN V +  F V +I HT+  TT      G
Sbjct: 116 DFTIFSFAIPPGLGRYIIAKGSITIDGISLTVNEVDQRQFTVSIIPHTLAITTLGELAAG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+EVD + +Y+ +L A+ 
Sbjct: 176 GRVNLEVDLIGKYVEKLLAVK 196


>gi|329898130|ref|ZP_08272332.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC3088]
 gi|328920910|gb|EGG28342.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC3088]
          Length = 218

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I A+ P    +R+RV +       ++LG SI  +G+CLTVV L      
Sbjct: 1   MFTGIIEAVGEIAAIEPRGGDVRIRVKSGKLPLHGVQLGDSICTSGVCLTVVDLP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  ET  +T + +W  GT +NLER++    RL GH+VSGH+DG   ++     
Sbjct: 56  GDGYWADVSNETLSLTTVGTWSNGTKVNLERALTPESRLGGHIVSGHVDGIGTVVERYEE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    +  P  L ++IA KGS+C++G SLTVN V  + FD+ +I  T+ ET    + V
Sbjct: 116 GRSWRFLIEAPAELAKYIAHKGSICIDGTSLTVNSVNGSRFDLNIIPQTMAETVIGGYHV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  IN+EVD + RY+ RL
Sbjct: 176 GTSINLEVDVIARYLERL 193


>gi|127512120|ref|YP_001093317.1| riboflavin synthase subunit alpha [Shewanella loihica PV-4]
 gi|126637415|gb|ABO23058.1| riboflavin synthase, alpha subunit [Shewanella loihica PV-4]
          Length = 221

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGSLRKIERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVV-----EQM 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +G  +NLE++V    RL GH+VSGH+DG   +    + 
Sbjct: 56  ADGYVADISAETVALTGFAHYQVGQKVNLEKAVTPTTRLGGHMVSGHVDGVASVDDRQYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V    F + ++ HT  ETT    K 
Sbjct: 116 GKAIEFWLTPPKGLARYIAHKGSITIDGVSLTVNEVDGERFRLTIVPHTASETTLIDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL +   ++
Sbjct: 176 GDRVNIEVDLIARHLERLLSFQAAE 200


>gi|114319538|ref|YP_741221.1| riboflavin synthase subunit alpha [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225932|gb|ABI55731.1| riboflavin synthase, alpha subunit [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 221

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G+I    P  + MRL +     + + ++LG SIA  G+CLT V L+ +   
Sbjct: 1   MFTGIVQAVGRIQRRDPRGEDMRLWIAAGDLDLTGVRLGDSIAVNGVCLTAVELTADA-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET R+T++   G G  +NLE ++ L   L GHLVSGH+DG  E++     
Sbjct: 59  ---FAADVSVETLRLTSLGDLGEGDALNLELALTLQTPLGGHLVSGHVDGLGEVVSRRPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   R   P  L ++IA KGS+ ++GVSLTVN V    F+V L+ HT+E T     + 
Sbjct: 116 GRSEVWRFRAPEGLARYIAAKGSITVDGVSLTVNGVDGAEFEVNLVPHTLEVTRLGQLRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSRVNLEVDIIARYLERL 193


>gi|29833444|ref|NP_828078.1| riboflavin synthase subunit alpha [Streptomyces avermitilis
           MA-4680]
 gi|29610567|dbj|BAC74613.1| putative riboflavin synthase alpha subunit [Streptomyces
           avermitilis MA-4680]
          Length = 202

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 119/204 (58%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV    EH  D
Sbjct: 1   MFTGIVEELGEVTAVENLGDASRFRLRGPVVTENAQHGDSIAVNGVCLTVV----EHEGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER + +G RL GH+V GH+DGT  ++      
Sbjct: 57  E-FTADVMAETLDRSSLGALAVGSRVNLERPMAVGARLGGHIVQGHVDGTGAVIERRPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT    + G
Sbjct: 116 NWEIVKVSLPADLSRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGRKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL    T +
Sbjct: 176 DPVNLEVDVVAKYVERLLGDRTRE 199


>gi|297627299|ref|YP_003689062.1| riboflavin synthase alpha chain [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296923064|emb|CBL57648.1| Riboflavin synthase alpha chain [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 220

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPI-AKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ +IG I    P    G RL +      S    GCSIA  G CLTVV L      
Sbjct: 1   MFTGIIEEIGTIDTSAPAEGGGARLAIRGPLAVSDATPGCSIAVNGTCLTVVDLPG---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ + V++  ET R T++     G+ +NLER+++   RLDGH V GH+DG   +L     
Sbjct: 57  DDSFVVDLMPETLRRTSLGRLSQGSQVNLERAMRADARLDGHQVQGHVDGLATLLERTDA 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
              +     +P  L   IA KG+V L+GVSLTV  VG     V LI  T+  TT    +V
Sbjct: 117 DGWVELEFGVPDALGPLIAEKGAVALDGVSLTVTHVGPASLGVALIPETLRMTTLGGLEV 176

Query: 180 GDLINIEVDSMMRYIAR 196
           GD++NIEVD + RY+ R
Sbjct: 177 GDVVNIEVDPVARYVER 193


>gi|58584344|ref|YP_197917.1| riboflavin synthase subunit alpha [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
 gi|58418660|gb|AAW70675.1| Riboflavin synthase alpha chain [Wolbachia endosymbiont strain TRS
           of Brugia malayi]
          Length = 198

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 114/171 (66%), Gaps = 5/171 (2%)

Query: 27  MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFI 86
           + + N S +  G SIA +G+CLTVV +     +++ + V++  ET +++N+ +W +G  I
Sbjct: 27  IKAQNLSSIHEGDSIACSGVCLTVVDI-----INDIFTVQISQETMKVSNLGAWKVGKKI 81

Query: 87  NLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLN 146
           NLE++++L D++DGHLV GH+D T +IL ++    S   +LS P  L +F+A KGSV L+
Sbjct: 82  NLEQAMRLSDKIDGHLVHGHVDETAKILTINQNLGSHEIKLSCPQELIKFVAKKGSVTLD 141

Query: 147 GVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           GVSLTVN V    F V +I +T + TT++ +KV D +N+EVD + RY+ +L
Sbjct: 142 GVSLTVNSVIGREFTVNIIPYTWQNTTFQYNKVNDYLNLEVDMIARYLDQL 192


>gi|285019599|ref|YP_003377310.1| riboflavin synthase, alpha subunit protein [Xanthomonas albilineans
           GPE PC73]
 gi|283474817|emb|CBA17316.1| putative riboflavin synthase, alpha subunit protein [Xanthomonas
           albilineans]
          Length = 199

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +R    T S   + ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGHLAARQPQGGDVRFTFATGSLPFADVQLGESIAVNGVCLTVIAFDA---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG   +L +   
Sbjct: 57  -DAFQADASTETLGLTTLGTLAEGAALNLERAMRPTDRLGGHLVSGHVDGLGRVLAIHHD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  L ++IA KGS+C++GVSLTVN V  + F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPSALLRYIAKKGSICVDGVSLTVNAVDADGFEVALIPHTVAHTAFAQTTV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAPVNLEIDLVARYVERL 193


>gi|320011956|gb|ADW06806.1| riboflavin synthase, alpha subunit [Streptomyces flavogriseus ATCC
           33331]
          Length = 206

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 116/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV L E     
Sbjct: 1   MFTGIVEELGEVTAVEKLDDASRFRLRGPVVTEGAKHGDSIAVNGVCLTVVDLGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V AET   +++ +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  NEFTADVMAETLDRSSLGALAPGSRVNLERPMALGGRLGGHLVQGHVDGTGHIVERKVSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +     +SLP  L +++  KGS+ ++GVSLTV   G +FF + LI  T+  TT  + + G
Sbjct: 116 NWELVTVSLPAGLARYVVEKGSITVDGVSLTVVDAGPDFFTISLIPTTLALTTLGLKQPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ RL A
Sbjct: 176 DPVNLEVDVLAKYVERLLA 194


>gi|283765822|gb|ADB28303.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (63%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  +  + +G+RL++ T Y+   +++G SIA +GICLTVV    +  + NW+ VE W 
Sbjct: 1   GCVEDVQSLKQGVRLKISTHYDIESLEIGASIACSGICLTVVERGLKQEMTNWFTVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GTF+NLERS++LGD L GHLV GHIDG  EI+     GD++   L  
Sbjct: 61  EALRLTNLAQWTKGTFVNLERSLRLGDELGGHLVFGHIDGLAEIIEKKNEGDAVRFHLQA 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P  L  FI  KGS+ LNG S
Sbjct: 121 PARLTSFIVNKGSIALNGTS 140


>gi|300312949|ref|YP_003777041.1| riboflavin synthase subunit alpha [Herbaspirillum seropedicae SmR1]
 gi|300075734|gb|ADJ65133.1| riboflavin synthase (alpha chain) protein [Herbaspirillum
           seropedicae SmR1]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 126/213 (59%), Gaps = 18/213 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG----MRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  IG I ++TP+A G    +RL +   S   + + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAIGTITSVTPLAAGPDAGVRLTIDAGSLPMADVGLGDSIALNGACMTVVEKTA 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                N + V+V  E+ R+T  A       +NLE+++ L +RL GHLVSGH+DG  ++  
Sbjct: 61  -----NGFTVDVSRESLRLT--AGLDAPGEVNLEKALTLAERLGGHLVSGHVDGLGQVHS 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVN----LVGKNFFDVLLIRHTIEE 171
            + +G+S    +  P  L +++A KGS+ +NGVSLTVN    L     F + LI HT+E 
Sbjct: 114 FEPVGESRELIVDAPKALGKYLAYKGSIVVNGVSLTVNRVEDLAEACRFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           TT+K  K G  +N+E+D + RY+ R+  L++SQ
Sbjct: 174 TTFKHLKAGSKVNLEIDLIARYVERM--LSSSQ 204


>gi|119896611|ref|YP_931824.1| riboflavin synthase subunit alpha [Azoarcus sp. BH72]
 gi|119669024|emb|CAL92937.1| riboflavin synthase [Azoarcus sp. BH72]
          Length = 204

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 120/203 (59%), Gaps = 13/203 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV   G+I  + P+A G+RL V T+  + + +++G SIA++G+CLTV+        
Sbjct: 1   MFSGIVAACGRIERIEPLADGLRLTVDTAGLDLADVQIGDSIANSGVCLTVIERDGPR-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGI---GTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
                  V  + +R T   + G+   G  +NLE++++L DRL GHLV+GH+DG  E+L  
Sbjct: 59  -------VRFDVSRETLNCTVGLDVEGGEVNLEKALQLSDRLGGHLVTGHVDGVGEVLKF 111

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
             IG+S    +  P  +  +IA KGSV +NGVSLTVN V    F + LI HT+  T  K 
Sbjct: 112 APIGESHELVIRAPGAIAGYIAKKGSVTVNGVSLTVNRVEGPDFSINLIPHTVAVTNLKH 171

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
            K G  +N+E+D + RY+ R+ A
Sbjct: 172 LKAGSRVNLEIDLIARYVERMLA 194


>gi|225629975|ref|YP_002726766.1| riboflavin synthase subunit alpha [Wolbachia sp. wRi]
 gi|225591956|gb|ACN94975.1| riboflavin synthase subunit alpha [Wolbachia sp. wRi]
          Length = 198

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 109/169 (64%), Gaps = 5/169 (2%)

Query: 29  SYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINL 88
           + N S +  G SIA +G+CLTVV +     + + + V+   ET ++ N+ +W IG  INL
Sbjct: 29  TQNLSSINKGDSIACSGVCLTVVDI-----MSDTFTVQASQETMKVANLNTWRIGKKINL 83

Query: 89  ERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGV 148
           E++++L D++DGHLV GH+DG V+ L ++   DS   +LS P  L +F+A K SV L+GV
Sbjct: 84  EQAMRLSDKIDGHLVQGHVDGIVKFLTINQNLDSHEIKLSCPQELIKFVAKKSSVTLDGV 143

Query: 149 SLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           SLTVN V    F V +  +T E TT++ +KV D +N+E+D + RY+ +L
Sbjct: 144 SLTVNSVVNQEFTVNITPYTWENTTFQYNKVNDYLNLEIDMIARYLDQL 192


>gi|1710404|sp|P51961|RISA_PHOPO RecName: Full=Riboflavin synthase alpha chain
 gi|496180|gb|AAA25628.1| riboflavin synthetase alpha subunit [Photobacterium phosphoreum]
          Length = 218

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 123/207 (59%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G I A+T  +KG    V  + +T   + +K+G SIA  GICLTVV+L+   
Sbjct: 1   MFTGIIEAVGNISAIT--SKGSDFEVSVNCDTLDLADVKIGDSIATNGICLTVVKLTA-- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
              N Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+D   E++   
Sbjct: 57  ---NSYVADLSIETLSRTAFNYYKVGQAVNLEKAMLPTTRFGGHIVSGHVDAVAEVIECR 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P  +E++++ KGSV ++GVSLTVN V  N F + ++ HT+ ETT    
Sbjct: 114 TSGRAIDIWIRVPSQIEKYLSEKGSVTVDGVSLTVNAVTGNEFKLTIVPHTVVETTIADF 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
           KVG+ +NIEVD + RYI RL  ++  +
Sbjct: 174 KVGNKVNIEVDVLARYIERLLLVDKPE 200


>gi|332534977|ref|ZP_08410795.1| riboflavin synthase alpha chain [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332035595|gb|EGI72087.1| riboflavin synthase alpha chain [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 217

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI  +      + +R+ ++  + + +KLG SIA  G+CLTVV   ++H +
Sbjct: 1   MFTGIIEATGKIALLQKKQGDLAIRIQSADLDMTDVKLGDSIATNGVCLTVV---DKH-I 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  ++  ET  +T  A + +G  +NLE++++   RL GHLVSGH+DG   I  +   
Sbjct: 57  DG-FSADLSNETISLTGFAHYALGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITSITAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   NL ++I  KGSVC++G+SLTVN V  N F + ++ HT E+TT    KV
Sbjct: 116 ARATEYWLTTDENLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSEQTTIAHFKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTQVNLEVDQIARYLERL 193


>gi|154686572|ref|YP_001421733.1| riboflavin synthase subunit alpha [Bacillus amyloliquefaciens
           FZB42]
 gi|154352423|gb|ABS74502.1| RibE [Bacillus amyloliquefaciens FZB42]
          Length = 215

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G I A+      M L +  S   S +KLG SIA  GICLTV   S     D
Sbjct: 1   MFTGIVEETGTIQAIKKTGLSMALTIAASKVISDVKLGDSIAVNGICLTVTGFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNGLSKGSKVNLERAMSANGRFGGHFVSGHVDGTAEITRIEKKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L L   L + + +KGS+ ++GVSLT+  +      V +I HTI ET ++   VG
Sbjct: 116 NAVYYDLKLSPELTKTLVLKGSITVDGVSLTIFGLSDESVTVSIIPHTISETIFQTKTVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + +Y+ R 
Sbjct: 176 STVNIECDMIGKYLYRF 192


>gi|198282614|ref|YP_002218935.1| riboflavin synthase subunit alpha [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666123|ref|YP_002424805.1| riboflavin synthase, alpha subunit [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247135|gb|ACH82728.1| riboflavin synthase, alpha subunit [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518336|gb|ACK78922.1| riboflavin synthase, alpha subunit [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 218

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  M      +R+ V     + + + LG SIA +G CLTVV +  +   
Sbjct: 1   MFTGIIQALGQIRGMQARDGDLRMIVAAGRLDLADVGLGDSIAVSGACLTVVEVQRDA-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T +    +G+ +NLE++++L DRL GHLV+GH+DG  +I  +   
Sbjct: 59  ---FAVDVSRETLNKTILGRLQVGSPVNLEKALRLADRLGGHLVAGHVDGVGQIREVSAS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    ++ P +L +++A KGSVC++G+SLTVN +  + F + LI HT+ +TT    + 
Sbjct: 116 GRSQVFAIAAPPDLLRYVAAKGSVCVDGISLTVNALRGDLFMLNLIPHTLAQTTAAQWRP 175

Query: 180 GDLINIEVDSMMRYIAR 196
           G  +N+EVD + RY+ R
Sbjct: 176 GQSVNLEVDLIARYLER 192


>gi|206561396|ref|YP_002232161.1| riboflavin synthase subunit alpha [Burkholderia cenocepacia J2315]
 gi|198037438|emb|CAR53373.1| riboflavin synthase alpha chain [Burkholderia cenocepacia J2315]
          Length = 209

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 124/214 (57%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -EKTDTTFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT++
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVD 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  K GD +N+EVD + RY+ R+  L+ SQ
Sbjct: 173 VTTLRHVKAGDKVNLEVDMIARYVERM--LSASQ 204


>gi|114562214|ref|YP_749727.1| riboflavin synthase subunit alpha [Shewanella frigidimarina NCIMB
           400]
 gi|114333507|gb|ABI70889.1| riboflavin synthase, alpha subunit [Shewanella frigidimarina NCIMB
           400]
          Length = 219

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + +KLG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEALGTLRKIDRKGNDIRLTVASGKLDLTDVKLGDSIATNGVCLTVV-----ERL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  + + +G  +NLE++V    RL GH+VSGH+DG  ++    + 
Sbjct: 56  GDGYVADISAETVDLTGFSHYQVGQKVNLEKAVTATTRLGGHMVSGHVDGIAKVEQCAYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS+P  L ++IA KGS+ ++GVSLTVN V    F + ++ HT  ETT    KV
Sbjct: 116 GKALEFWLSVPAQLSRYIAHKGSITIDGVSLTVNEVDGARFRLTIVPHTAGETTLVDLKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDSVNIEVDLIARYLERL 193


>gi|150026413|ref|YP_001297239.1| riboflavin synthase subunit alpha [Flavobacterium psychrophilum
           JIP02/86]
 gi|149772954|emb|CAL44438.1| Riboflavin synthase, alpha subunit [Flavobacterium psychrophilum
           JIP02/86]
          Length = 198

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 119/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G I A+    + + ++V ++  T+++K+  S+AH G+CLTVV +      +
Sbjct: 1   MFTGIIETLGTIKALEKDGENIHIKVASNI-TNELKIDQSVAHNGVCLTVVNID-----N 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET   TN++ W +   +NLER++KLGDRLDGH+V GH+D T     ++   
Sbjct: 55  DVYTVTAIKETIDKTNLSHWNVNDVVNLERAMKLGDRLDGHIVQGHVDQTAICKGIEEAN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S Y        L      KGS+ +NGVSLTV    +N F V +I +T E T +   K+G
Sbjct: 115 GSWYFTFEYDKILNNITIEKGSITVNGVSLTVVNSKENEFSVAIIPYTYEHTNFCDFKIG 174

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             IN+E D + +Y+ARL++L+  +
Sbjct: 175 TKINLEFDVIGKYVARLHSLHVDK 198


>gi|99034652|ref|ZP_01314599.1| hypothetical protein Wendoof_01000589 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 198

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 109/169 (64%), Gaps = 5/169 (2%)

Query: 29  SYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINL 88
           + N S +  G SIA +G+CLTVV +     + + + V+   ET ++ N+ +W IG  INL
Sbjct: 29  TQNLSSINKGDSIACSGVCLTVVDI-----MSDTFTVQASQETMKVANLNTWRIGKKINL 83

Query: 89  ERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGV 148
           E++++L D++DGHLV GH+DG V+ L ++   DS   +LS P  L +F+A K SV L+GV
Sbjct: 84  EQAMRLSDKIDGHLVQGHVDGIVKFLTINQNLDSHEIKLSCPQELIKFVAKKSSVTLDGV 143

Query: 149 SLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           SLTVN V    F V +  +T E TT++ +KV D +N+E+D + RY+ +L
Sbjct: 144 SLTVNSVINQEFTVNITPYTWENTTFQYNKVNDYLNLEIDMIARYLDQL 192


>gi|328951150|ref|YP_004368485.1| riboflavin synthase, alpha subunit [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451474|gb|AEB12375.1| riboflavin synthase, alpha subunit [Marinithermus hydrothermalis
           DSM 14884]
          Length = 202

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 110/197 (55%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I   TP    +RL +     T   ++G SIA  G+CLTVV   E H   
Sbjct: 1   MFTGIVEEVGTIREATPSNGNLRLWIEAHTVTQDARIGDSIAVNGVCLTVV-AREPHG-- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET   T    W  G  +NLER++ LGDRL GH V+GH+DG   +     + 
Sbjct: 58  --FAVELARETLERT-APRWAAGRRVNLERALALGDRLGGHFVTGHVDGVGRVQARRNVP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L ++IA KGS+ ++GVSLTV  V    F V LI HT++ TT    + G
Sbjct: 115 GAYDLVIQAPPELARYIARKGSIAIDGVSLTVVQVEGATFSVTLIPHTLKATTLGELQEG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ RL
Sbjct: 175 DAVNLEVDLIARYLERL 191


>gi|2497759|sp|Q44680|RISA_BACAM RecName: Full=Riboflavin synthase alpha chain
 gi|1212774|emb|CAA65190.1| riboflavin synthase (a-subunit) [Bacillus amyloliquefaciens]
          Length = 215

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G I A+      M L +  S  TS ++LG SIA  GICLTV   S     D
Sbjct: 1   MFTGIVEETGTIQAIKKTGLSMALTIAASKVTSDVRLGDSIAVNGICLTVTGFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNGLSKGSKVNLERAMSANGRFGGHFVSGHVDGTAEITRIEKKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L L   L + + +KGS+ ++GVS T+  +      V +I HTI ET ++   VG
Sbjct: 116 NAVYYDLKLSPELTKTLVLKGSITVDGVSSTIFGLSDESVTVSVIPHTISETIFRTKAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
            ++NIE D + +Y+ R 
Sbjct: 176 SIVNIECDMIGKYLYRF 192


>gi|110801688|ref|YP_697859.1| riboflavin synthase subunit alpha [Clostridium perfringens SM101]
 gi|110682189|gb|ABG85559.1| riboflavin synthase, alpha subunit [Clostridium perfringens SM101]
          Length = 217

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 118/201 (58%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE D + +Y+ +L    
Sbjct: 176 DLVNIECDPIGKYVEKLLGFK 196


>gi|107022038|ref|YP_620365.1| riboflavin synthase subunit alpha [Burkholderia cenocepacia AU
           1054]
 gi|116688982|ref|YP_834605.1| riboflavin synthase subunit alpha [Burkholderia cenocepacia HI2424]
 gi|105892227|gb|ABF75392.1| riboflavin synthase, alpha subunit [Burkholderia cenocepacia AU
           1054]
 gi|116647071|gb|ABK07712.1| riboflavin synthase, alpha subunit [Burkholderia cenocepacia
           HI2424]
          Length = 209

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 123/214 (57%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIETIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -EKTDTTFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN +        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIIAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  K GD +N+EVD + RY+ R+  L+ SQ
Sbjct: 173 VTTLRHVKAGDKVNLEVDMIARYVERM--LSASQ 204


>gi|149208444|gb|ABR21785.1| RibE [Photobacterium kishitanii]
 gi|156124842|gb|ABU50722.1| RibE [Photobacterium kishitanii]
          Length = 218

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 123/207 (59%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G I A+T  +KG    V  + +T   + +K+G SIA  GICLTVV+L+   
Sbjct: 1   MFTGIIEAVGNISAIT--SKGSDFEVSVNCDTLDLADVKIGDSIATNGICLTVVKLTA-- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
              N Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+D   E++   
Sbjct: 57  ---NSYVADLSIETLSRTAFNYYKVGQAVNLEKAMLPTTRFGGHIVSGHVDAVAEVIECR 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P  +E++++ KGSV ++GVSLTVN V  N F + ++ HT+ ETT    
Sbjct: 114 TSGRAIDIWIRVPSQIEKYLSEKGSVTVDGVSLTVNAVRGNEFKLTIVPHTVVETTIADF 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
           KVG+ +NIEVD + RYI RL  ++  +
Sbjct: 174 KVGNKVNIEVDVLARYIERLLLVDKPE 200


>gi|78065535|ref|YP_368304.1| riboflavin synthase subunit alpha [Burkholderia sp. 383]
 gi|77966280|gb|ABB07660.1| Riboflavin synthase alpha chain [Burkholderia sp. 383]
          Length = 211

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 125/209 (59%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MF+GIV  +G+I ++ P+      G+RL V+    + + + LG SIA  G C+TV+  S 
Sbjct: 1   MFSGIVAAVGRIESIQPLGASADAGVRLTVLAGGLDLADVALGDSIAIQGACMTVIEKS- 59

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A+ G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 60  ----DAAFDVDVSRESLNRTVGLATPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
             + +G+S   R+  P  L +++A KGS+ +NGVSLTVN +        F + LI HT+E
Sbjct: 113 RFEPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N++VD + RY+ R+ +
Sbjct: 173 VTTLRHVKAGDKVNLKVDMIARYVERMMS 201


>gi|94311621|ref|YP_584831.1| riboflavin synthase subunit alpha [Cupriavidus metallidurans CH34]
 gi|93355473|gb|ABF09562.1| riboflavin synthase alpha chain [Cupriavidus metallidurans CH34]
          Length = 210

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 122/208 (58%), Gaps = 17/208 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIA---KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  +G+I +++P+     G+RLRV     + S + +G SIA  G C+TVV L   
Sbjct: 1   MFTGIVAAVGRIESVSPLGDVNAGVRLRVAAGDLDLSDVGIGDSIAIQGACMTVVTLGA- 59

Query: 57  HSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                 ++V+V  E+ ++   +   G    +NLE++++L DRL GHLVSGH+DG  E++ 
Sbjct: 60  ----GQFDVDVSRESLDKTVGLDQPG---RVNLEKALRLADRLGGHLVSGHVDGLGEVVR 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+E 
Sbjct: 113 FAPVGESHELRIRAPRELGRYLAYKGSVVVNGVSLTVNNVSDEADGCVFSINLIPHTVEV 172

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYA 199
           TT      G  +N+E+D + RY+ R+ +
Sbjct: 173 TTLNELAPGKRVNLEIDLIARYVERMLS 200


>gi|254522990|ref|ZP_05135045.1| riboflavin synthase, alpha subunit [Stenotrophomonas sp. SKA14]
 gi|219720581|gb|EED39106.1| riboflavin synthase, alpha subunit [Stenotrophomonas sp. SKA14]
          Length = 221

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 115/202 (56%), Gaps = 14/202 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKM-----KLGCSIAHAGICLTVVRLSE 55
           +FTGI+  +G++ A   I   +R     ++N   +     ++G SIA  G+CLTV+    
Sbjct: 22  LFTGIIEGVGRLAARESIGGDVRF----TFNVGNLPFDNVQMGESIAINGVCLTVIAFDA 77

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                + ++ +   ET  +T +     G  INLER+++  DRL GHLVSGH+DG  ++L 
Sbjct: 78  -----SSFQADASTETLGLTTLGQLDEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVLS 132

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
           +     +   R + P +L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T + 
Sbjct: 133 IHEDARAQRWRFAAPASLRRYIAKKGSICVDGVSLTVNEVDDEGFEVALIPHTVANTAFS 192

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
              VG  +N+E+D + RY+ RL
Sbjct: 193 ASGVGSAVNLEIDLVARYVERL 214


>gi|42520035|ref|NP_965950.1| riboflavin synthase subunit alpha [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42409772|gb|AAS13884.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 198

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 110/171 (64%), Gaps = 5/171 (2%)

Query: 27  MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFI 86
           + + N S +  G SIA +G+CLTVV +     + + + V+   ET ++ N+ +W IG  I
Sbjct: 27  IKTQNLSSINKGDSIACSGVCLTVVDI-----MSDTFTVQASQETMKVANLNTWRIGKKI 81

Query: 87  NLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLN 146
           NLE++++L D++DGHLV GH+DG V+ L ++   DS   +LS P  L +F+A K SV L+
Sbjct: 82  NLEQAMRLSDKIDGHLVQGHVDGIVKFLTINQNLDSHEIKLSCPQELIKFVAKKSSVTLD 141

Query: 147 GVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           GVSLTVN V    F V +  +T E TT++ +KV D +N+E+D + RY+ +L
Sbjct: 142 GVSLTVNSVINQEFTVNITPYTWENTTFQYNKVNDYLNLEIDMIARYLDQL 192


>gi|221201162|ref|ZP_03574202.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2M]
 gi|221206385|ref|ZP_03579398.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2]
 gi|221213662|ref|ZP_03586636.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD1]
 gi|221166451|gb|EED98923.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD1]
 gi|221173694|gb|EEE06128.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2]
 gi|221179012|gb|EEE11419.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2M]
          Length = 209

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 123/211 (58%), Gaps = 18/211 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVNAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -AKTDTSFDVDVSRESLNRTVGLAQPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V      + F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVEDRPDGSEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
            TT +  K GD +N+EVD + RY+ R+  ++
Sbjct: 173 VTTLRHLKAGDQVNLEVDMIARYVERMLTMS 203


>gi|121997690|ref|YP_001002477.1| riboflavin synthase subunit alpha [Halorhodospira halophila SL1]
 gi|121589095|gb|ABM61675.1| riboflavin synthase, alpha subunit [Halorhodospira halophila SL1]
          Length = 219

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 109/198 (55%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   G++ A+    +G  LR+       ++ ++G SIA  G CLT   +      
Sbjct: 1   MFTGIVETCGRVAAIEHSGEGRILRIDAPRLGLAECRIGDSIAVDGACLTATGIE----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  +V  ET R T +     G  +NLER+V     L GHLV+GH+DG  E++     
Sbjct: 56  DGQFRADVSDETLRCTTLGGLRSGVRVNLERAVTPSTPLGGHLVTGHVDGVGEVVERAPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   R  +P  L +++AVKGS+ + GVSLT+N V    F+V LI HT++ T     + 
Sbjct: 116 GGSERWRFRVPEGLARYVAVKGSIAVAGVSLTINAVAGREFEVNLIPHTLDATNLGERRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDPVNIEVDLVARYVERL 193


>gi|163782876|ref|ZP_02177872.1| riboflavin synthase subunit alpha [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881997|gb|EDP75505.1| riboflavin synthase subunit alpha [Hydrogenivirga sp. 128-5-R1-1]
          Length = 206

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 112/196 (57%), Gaps = 7/196 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++GK++++T  +KG  L V  S+    +K+G S++  G CLTVVRL      +
Sbjct: 1   MFTGLVEEVGKVVSITRDSKGGVLEVGCSF--EDLKVGDSVSVNGACLTVVRLG-----N 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                EV  ET   TN+ +   G F+NLER+++   RL GH V GH+D T  I+    +G
Sbjct: 54  GTAHFEVSPETFSRTNLKALKRGDFVNLERALRADSRLGGHFVLGHVDFTARIVSFRDLG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +     + LPH   +    KGSV ++G+SLTVN V +    + +I HT E T  K  K G
Sbjct: 114 EHRELLIELPHPYRKHFVEKGSVAIDGISLTVNRVSEGSVSINVIPHTYESTNLKYRKPG 173

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E D + +Y+ R
Sbjct: 174 DEVNVETDIIGKYVLR 189


>gi|170732273|ref|YP_001764220.1| riboflavin synthase subunit alpha [Burkholderia cenocepacia MC0-3]
 gi|169815515|gb|ACA90098.1| riboflavin synthase, alpha subunit [Burkholderia cenocepacia MC0-3]
          Length = 209

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 124/214 (57%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -EKTDTTFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN +        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  + GD +N+EVD + RY+ R+  L+ SQ
Sbjct: 173 VTTLRHVQAGDKVNLEVDMIARYVERM--LSASQ 204


>gi|254246079|ref|ZP_04939400.1| Riboflavin synthase alpha chain [Burkholderia cenocepacia PC184]
 gi|124870855|gb|EAY62571.1| Riboflavin synthase alpha chain [Burkholderia cenocepacia PC184]
          Length = 209

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 124/214 (57%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -EKTDTTFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN +        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  + GD +N+EVD + RY+ R+  L+ SQ
Sbjct: 173 VTTLRHVQAGDKVNLEVDMIARYVERM--LSASQ 204


>gi|156124799|gb|ABU50696.1| RibE [Photobacterium kishitanii]
          Length = 218

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 123/207 (59%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G I A+T  +KG    V  + +T   + +K+G SIA  GICLTVV+L+   
Sbjct: 1   MFTGIIEAVGNISAIT--SKGSDFEVSVNCDTLDLADVKIGDSIATNGICLTVVKLTA-- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
              N Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+D   E++   
Sbjct: 57  ---NSYVADLSIETLSRTAFNYYKVGQAVNLEKAMLPTTRFGGHIVSGHVDAVAEVIECR 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P  +E++++ KGSV ++GVSLTVN V  N F + ++ HT+ ETT    
Sbjct: 114 TSGRAIDIWIRVPSQIEKYLSDKGSVTVDGVSLTVNAVRGNEFKLTIVPHTVVETTIADF 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
           KVG+ +NIEVD + RYI RL  ++  +
Sbjct: 174 KVGNKVNIEVDVLARYIERLLLVDKPE 200


>gi|77461239|ref|YP_350746.1| riboflavin synthase subunit alpha [Pseudomonas fluorescens Pf0-1]
 gi|77385242|gb|ABA76755.1| riboflavin synthase alpha chain [Pseudomonas fluorescens Pf0-1]
          Length = 220

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T +     G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLDCTAMNDLKSGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVSRSDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F + +I HT+ ET    +K 
Sbjct: 116 ARAVEFRIRAPKELAKYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYKP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|197335014|ref|YP_002155464.1| riboflavin synthase, alpha subunit [Vibrio fischeri MJ11]
 gi|26522771|dbj|BAC44858.1| riboflavin synthase [Vibrio fischeri]
 gi|197316504|gb|ACH65951.1| riboflavin synthase, alpha subunit [Vibrio fischeri MJ11]
          Length = 218

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V +   + S +KLG SIA  G+CLTVV ++E+   
Sbjct: 1   MFTGIIESVGTLQAITPKGEDISVTVNVGQLDMSDVKLGDSIATNGVCLTVVAMTEQ--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T   ++  G  +NLE+++    R  GH+VSGH+D   EI+     
Sbjct: 58  --TYTADLSLETLKRTGFVNYKAGDKVNLEKAMLPTTRFGGHIVSGHVDAVGEIIERHQT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + LP  L +++  KGS+ ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWIQLPQTLAKYVVEKGSITVDGISLTVNDIRKNAFKLTIVPHTAAETTMDNFSV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GQKVNLEVDVIARYLERL 193


>gi|239993721|ref|ZP_04714245.1| riboflavin synthase subunit alpha [Alteromonas macleodii ATCC
           27126]
          Length = 220

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +      +RL V + + + S + LG SIA  G+CLTV  +  +   
Sbjct: 1   MFTGIIQALGTIKKLDNRGNDIRLTVSSPTLDMSDVALGDSIATNGVCLTVTDMGPD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             +Y  +V AET ++T  A +  G+ +NLE++++  DRL GH+VSGH+DG  E+  +   
Sbjct: 58  --YYCADVSAETIKLTGFAHYSAGSTVNLEKAMRPSDRLGGHIVSGHVDGVGEVTQIIKH 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D +   +  P  L ++IA KGS+ ++G+SLTVN V    F + +I HT++ET    +KV
Sbjct: 116 SDYVEFWVKAPEALAKYIAHKGSITVDGISLTVNEVNGAEFMLWIIPHTLQETIMGSYKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTAVNLEVDVIARYLERL 193


>gi|149927762|ref|ZP_01916014.1| riboflavin synthase, alpha subunit [Limnobacter sp. MED105]
 gi|149823588|gb|EDM82818.1| riboflavin synthase, alpha subunit [Limnobacter sp. MED105]
          Length = 209

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 122/208 (58%), Gaps = 19/208 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI+  IG+I  + P+      G+RL V   S + S +KLG SIA  G C+TVV +  
Sbjct: 1   MFTGIIESIGQIKTVEPLQDSTYAGVRLAVHAPSLDFSDVKLGDSIAIQGACMTVVAMQ- 59

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  + V+V  E+ ++   ++  G    +NLE++++L DR+ GHLVSGH+DG   ++
Sbjct: 60  ----DQTFHVDVSQESLSKTVGLSQPG---EVNLEKAMRLSDRVGGHLVSGHVDGLGSVV 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTI 169
               +G+S + ++  P +L  F A KGSV +NGVSLTVN V     G+    + LI HT+
Sbjct: 113 DFSPVGESWHLQIRAPKSLSPFFAYKGSVTVNGVSLTVNQVDDHASGECDIHINLIPHTV 172

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARL 197
           + TT K  K G  +N+E+D + RY  R+
Sbjct: 173 QMTTLKHLKAGSPVNLEIDQIARYCERI 200


>gi|239939893|ref|ZP_04691830.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           15998]
 gi|239986379|ref|ZP_04707043.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           11379]
 gi|291443326|ref|ZP_06582716.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           15998]
 gi|291346273|gb|EFE73177.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           15998]
          Length = 202

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A   R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLADASRFRLRGPLVTEGAKHGDSIAVNGVCLTVV-----DTGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GEFTADVMAETLKRSSLGALAPGSRVNLERPMALGGRLGGHLVQGHVDGTGTIVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++GVSLTV     ++F + LI  T+  TT    + G
Sbjct: 116 HWEIVKVSLPPELTRYVVEKGSITVDGVSLTVVDAAADYFTISLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ R+      Q
Sbjct: 176 DPVNLEVDVIAKYVERMLGDRAGQ 199


>gi|322420506|ref|YP_004199729.1| riboflavin synthase subunit alpha [Geobacter sp. M18]
 gi|320126893|gb|ADW14453.1| riboflavin synthase, alpha subunit [Geobacter sp. M18]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+++++        L V TS    ++++G SIA  G CLTVVR        
Sbjct: 1   MFTGLIETVGELVSIERRGASGSLTVKTSLPLDEIEIGASIAINGACLTVVRKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET   T       G+ +N+ER+++L DRLDGHLVSGH+D    +     + 
Sbjct: 56  GTVTFDVSPETIDRTAFKHLKSGSPVNMERAMRLSDRLDGHLVSGHVDCIAAVTERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++      P    ++IA KGSV ++G+SLTVN VG + F V +I HT  +TT    ++G
Sbjct: 116 NNIIFSFRFPVEFAKYIAAKGSVAIDGISLTVNSVGPDSFSVNVIPHTAAKTTLLSRRIG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +NIE D + RY+ RL A
Sbjct: 176 DEVNIETDLLCRYLERLLA 194


>gi|146329597|ref|YP_001209385.1| riboflavin synthase subunit alpha [Dichelobacter nodosus VCS1703A]
 gi|146233067|gb|ABQ14045.1| riboflavin synthase, alpha subunit [Dichelobacter nodosus VCS1703A]
          Length = 214

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+      + L +    ++ S   LG SIA  G+CLTV+       +
Sbjct: 1   MFTGIIQSVGTITAIAAHGNDLSLEICAEQFDLSHSHLGDSIAVNGVCLTVIDF-----I 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V AET R+T IA W + T +NLE +  L  +L GHLVSGH+DG   +      
Sbjct: 56  SKGFRVDVSAETLRLTTIARWRVDTRVNLEPAATLNTQLGGHLVSGHVDGIAVLKERVTE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   + S+P  L ++IA KGS+ ++GVSLT+N +  + F V+++ HT + T    + +
Sbjct: 116 GRSQRLQFSVPTALTKYIARKGSITVDGVSLTINDIQGDQFSVMIVPHTQKNTIIDDYHI 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  ++IEVD + RY+ RL     S+
Sbjct: 176 GQAVHIEVDLLARYLERLLKSTDSE 200


>gi|167623140|ref|YP_001673434.1| riboflavin synthase subunit alpha [Shewanella halifaxensis HAW-EB4]
 gi|167353162|gb|ABZ75775.1| riboflavin synthase, alpha subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 221

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV+L     +
Sbjct: 1   MFTGIIESVGHLRKVERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVQL-----M 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  + + +G  +NLE++V    RL GH+VSGH+DG   +    F 
Sbjct: 56  ADGYVADISAETVSLTGFSHYPVGKAVNLEKAVTPTTRLGGHMVSGHVDGIAHVDDRQFR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLTPPVELGRYIAHKGSITIDGVSLTVNEVQGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL +  + +
Sbjct: 176 GDSVNIEVDLIARHLERLMSYPSQE 200


>gi|90579823|ref|ZP_01235631.1| riboflavin synthase subunit alpha [Vibrio angustum S14]
 gi|90438708|gb|EAS63891.1| riboflavin synthase subunit alpha [Vibrio angustum S14]
          Length = 218

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 119/200 (59%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT---SYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  IG I A+TP  KG  + V     + + S +KLG SIA  G+CLTVV+L+ + 
Sbjct: 1   MFTGIIEAIGTITALTP--KGADISVTVDSGNLDLSDVKLGDSIATNGVCLTVVKLTGK- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                Y  ++  ET + T  A +  G  +NLE+++    R  GH+VSGH+D   EI+   
Sbjct: 58  ----GYVADLSLETLKRTAFAHYQAGQVVNLEKAMLPTTRFGGHMVSGHVDAVAEIIERH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT    
Sbjct: 114 HTGRAIEFWVKVPAHLAKYISEKGSVAVDGISLTVNEINGDEFKLTIVPHTALETTMDTF 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           K G +IN+EVD + RY+ RL
Sbjct: 174 KPGRMINLEVDVIARYLERL 193


>gi|171315489|ref|ZP_02904725.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria MEX-5]
 gi|171099326|gb|EDT44064.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria MEX-5]
          Length = 207

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 125/214 (58%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESIDPLGAWPDAGVRLTVQAGGLDLADVALGDSIAIQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----TGFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTVDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +  K GD +N+E+D + RY+ R+  L+ SQ
Sbjct: 173 VTTLRHVKAGDKVNLEIDMIARYVERM--LSASQ 204


>gi|261253737|ref|ZP_05946310.1| riboflavin synthase alpha chain [Vibrio orientalis CIP 102891]
 gi|260937128|gb|EEX93117.1| riboflavin synthase alpha chain [Vibrio orientalis CIP 102891]
          Length = 217

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+T   + + + V +   + S +KLG SIA  G+CLTVV  S     
Sbjct: 1   MFTGIVEAVGTLTAITQKGEDISVTVEVGKLDMSDVKLGDSIATNGVCLTVVDFSS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -TSYTADLSIETLQKTGFTDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVSMPEEIAKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGEETTIADFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQREQ 200


>gi|169827592|ref|YP_001697750.1| riboflavin synthase subunit alpha [Lysinibacillus sphaericus C3-41]
 gi|168992080|gb|ACA39620.1| Riboflavin synthase alpha chain [Lysinibacillus sphaericus C3-41]
          Length = 218

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 108/194 (55%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV DIG I A+      M++ V +S  T  ++LG SIA  G+CLTV      H  D
Sbjct: 7   MFTGIVEDIGTIKALQSNKNSMKITVHSSKVTEDVRLGDSIAVNGVCLTVT-----HFTD 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
               ++V  ET + TN+    +G  +NLER++    R  GH V+GH+D   +IL    + 
Sbjct: 62  QELTMDVMPETVKATNLHQLAVGDPVNLERAMPANGRFGGHFVAGHVDAVGKILRKRPVA 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + L   L  F   KGS+ ++G SLT+  V  N+  + LI HT +ET   M K+G
Sbjct: 122 NAVYIDIELSEELTSFCIPKGSITIDGTSLTIFHVESNYVTISLIPHTYKETILGMKKIG 181

Query: 181 DLINIEVDSMMRYI 194
             +NIE D + +YI
Sbjct: 182 AFVNIETDLVGKYI 195


>gi|161525608|ref|YP_001580620.1| riboflavin synthase subunit alpha [Burkholderia multivorans ATCC
           17616]
 gi|189349663|ref|YP_001945291.1| riboflavin synthase subunit alpha [Burkholderia multivorans ATCC
           17616]
 gi|160343037|gb|ABX16123.1| riboflavin synthase, alpha subunit [Burkholderia multivorans ATCC
           17616]
 gi|189333685|dbj|BAG42755.1| riboflavin synthase alpha chain [Burkholderia multivorans ATCC
           17616]
          Length = 209

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 123/211 (58%), Gaps = 18/211 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVNAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -AKTDTTFDVDVSRESLNRTVGLAQPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V      + F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVEDRPDGSEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
            TT +  K GD +N+EVD + RY+ R+  ++
Sbjct: 173 VTTLRHLKAGDRVNLEVDMIARYVERMLTMS 203


>gi|269127206|ref|YP_003300576.1| riboflavin synthase subunit alpha [Thermomonospora curvata DSM
           43183]
 gi|268312164|gb|ACY98538.1| riboflavin synthase, alpha subunit [Thermomonospora curvata DSM
           43183]
          Length = 202

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 112/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+ P     RL V     T     G SIA  G+CLTVV ++ E    
Sbjct: 1   MFTGIVEELGEVVAVEPAGDSARLTVRGPLVTQDAVHGASIAVNGVCLTVVEVNGEE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++     G+ +NLER V+L DRL GHLV GH+DG   I+      
Sbjct: 58  --FTADVMKETLDRSSLGVLEPGSPVNLERPVRLSDRLGGHLVQGHVDGVGRIVSRRAEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +S+P  L ++I  KGS+ ++GVSLTV   G     V LI  T+E TT      G
Sbjct: 116 RWHLVTVSVPAELSRYIVEKGSIAIDGVSLTVVEAGPEQLSVSLIPTTLELTTLGRKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL A  T++
Sbjct: 176 DPVNLEVDVIAKYVERLTAHRTAE 199


>gi|93007293|ref|YP_581730.1| riboflavin synthase subunit alpha [Psychrobacter cryohalolentis K5]
 gi|92394971|gb|ABE76246.1| riboflavin synthase, alpha subunit [Psychrobacter cryohalolentis
           K5]
          Length = 223

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 114/206 (55%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ +M P    +RL + +   + S +KLG SIA  GICLTVV     H  
Sbjct: 1   MFTGIIESVGKVKSMQPTGGDIRLTIESDGLDFSDVKLGDSIASNGICLTVVDFGSNH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y V+V  ET   T +     G  +NLE+++    R  GH+V+GH+DG   +  L   
Sbjct: 59  ---YSVDVSRETIARTALEDLKPGHLVNLEKAMLPTTRFGGHIVAGHVDGVGIVSKLQKD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH-K 178
             S+Y  + +P  L  + A KGS+ L+G+SLT NLV  N   + +I HT + T    H  
Sbjct: 116 ARSIYIEIEIPKELVHYTATKGSITLDGISLTTNLVRDNIVSLNIIPHTAQVTNIAQHWL 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
           +G  +N+EVD + RY+ RL  LN SQ
Sbjct: 176 IGSKVNVEVDIVARYLERL--LNKSQ 199


>gi|188993055|ref|YP_001905065.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734815|emb|CAP53025.1| Riboflavin synthase, alpha chain [Xanthomonas campestris pv.
           campestris]
          Length = 200

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 111/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +     T S     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLAARQPQGGDVHFTFATGSLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + S   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGSLQEGAVLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V    F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPQVLRYVAKKGSICVDGVSLTVNEVDDAGFEVALIPHTVANTAFSETAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|148244611|ref|YP_001219305.1| riboflavin synthase subunit alpha [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326438|dbj|BAF61581.1| riboflavin synthase alpha chain [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 201

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 121/197 (61%), Gaps = 8/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  IGKI ++         +   S+   ++K+G SIA  G+CLT +++      D
Sbjct: 1   MFTGIIQAIGKIKSIE--LGSFCFQAKKSF-FDEVKIGDSIAVNGVCLTTIKID-----D 52

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N+++V++  ET R T  +  G+ + +NLE++++L   +DGHLVSGH+DG V+++     G
Sbjct: 53  NYFKVDISKETLRCTIFSHLGVDSLVNLEKTLRLNQGIDGHLVSGHVDGIVKVVGRSIEG 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+  ++  P NL ++I  KGS+C+NGVSLTVN +     D+ ++ +T++ TT    ++ 
Sbjct: 113 KSIRFKMKTPKNLIKYITKKGSICINGVSLTVNNINDCVLDINIVPYTLKTTTLGELEIN 172

Query: 181 DLINIEVDSMMRYIARL 197
              N+EVD + R+I RL
Sbjct: 173 SKANLEVDIIARHIERL 189


>gi|134095548|ref|YP_001100623.1| riboflavin synthase subunit alpha [Herminiimonas arsenicoxydans]
 gi|133739451|emb|CAL62502.1| riboflavin synthase alpha chain [Herminiimonas arsenicoxydans]
          Length = 205

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 121/206 (58%), Gaps = 17/206 (8%)

Query: 1   MFTGIVTDIGKIIAMTPI---AKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  +GKI A++P+   A G RL V       + + LG SI   G C+TVV  +E 
Sbjct: 1   MFTGIVAAVGKITAISPLGDQAAGHRLTVDAGGLPLADVALGDSITLNGACMTVVAKTE- 59

Query: 57  HSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               + +EV+V  E+ N  T + + G    +NLE++V L +RL GHLVSGH+DG   +  
Sbjct: 60  ----STFEVDVSRESLNCTTGLDAIG---EVNLEKAVTLSERLGGHLVSGHVDGLGTVQK 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIEE 171
            + +G+S    +  P  L +FIAVKGS+ +NGVSLTVN V        F V LI HT++ 
Sbjct: 113 FEPVGESWLLVVKAPKELAKFIAVKGSIVINGVSLTVNTVADGADACEFSVNLIPHTVQV 172

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           TT K  + G  +N+E+D + RY+ R+
Sbjct: 173 TTLKHLQTGSKVNLEIDLIARYVERM 198


>gi|220918024|ref|YP_002493328.1| riboflavin synthase, alpha subunit [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955878|gb|ACL66262.1| riboflavin synthase, alpha subunit [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 215

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 108/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V D+G +  + P   G RL +  +     ++ LG SIA +G CLTVV        
Sbjct: 1   MFTGLVADVGVVERIVPRQGGARLTLRPARLPVDELVLGESIACSGACLTVVERG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +   ET   T +  W  G  +NLER++ +G+RL GHLV GH+D   E+L     
Sbjct: 56  GGLVSFDAVPETLARTTVGGWRPGAKVNLERALAVGERLGGHLVQGHVDAVGEVLRRVPE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      +SLP ++   +A KGS+ ++GVSLTV   G++ F++ LI  T+  TT      
Sbjct: 116 GQGARLTISLPPSIAPLVAEKGSIAVDGVSLTVATAGRDRFELALIPETLARTTLGQAAA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E D + R++ARL A  
Sbjct: 176 GTKVNLEADVLARHVARLRAFE 197


>gi|312113515|ref|YP_004011111.1| riboflavin synthase, subunit alpha [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218644|gb|ADP70012.1| riboflavin synthase, alpha subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 200

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+T  G ++     A   R  +   +  + +  G SIA  G CLTV  + +     
Sbjct: 1   MFTGIITAQGTVLE----ADNGRFAIACPWEATGIVHGASIACDGCCLTVTGV-DSFGGG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET   T +  W  G  INLERS++ GD + GHLVSGH+DG   I  +   G
Sbjct: 56  SIFRVDVSNETLSKTTLGGWAKGRKINLERSLRFGDEMGGHLVSGHVDGVARIESITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    +  P  L +FIA KGSV L+GVSLT+N V  + F + LI  T+E T +   + G
Sbjct: 116 FSKIFAIRAPDALAKFIAPKGSVALDGVSLTINDVDGSLFTINLIPTTLEVTIFGGKQPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+EVD + RY+ARL
Sbjct: 176 DSINMEVDLIARYVARL 192


>gi|300781125|ref|ZP_07090979.1| riboflavin synthase subunit alpha [Corynebacterium genitalium ATCC
           33030]
 gi|300532832|gb|EFK53893.1| riboflavin synthase subunit alpha [Corynebacterium genitalium ATCC
           33030]
          Length = 197

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 117/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G +  +  + + +RL V     T+  + G SIA  G+CLTVV      +  
Sbjct: 1   MFTGLVEEVGSVEKLERLDEAVRLTVRGPKVTADAQPGDSIAVDGVCLTVV-----EAAG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   + + S+ +G+ +NLER++  G R+ GH+V GH+DG  E++  +   
Sbjct: 56  DVFTADVMQETLNRSRLGSYEVGSNVNLERALAAGARMGGHIVQGHVDGVGELISRESSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SLP  L ++I  KGS+ LNG SLTV+ V  ++ +V LI  T+ ETT+    VG
Sbjct: 116 HWDVLRFSLPEQLTRYIVEKGSIALNGTSLTVSAVSADYVEVSLIPTTLAETTFGELAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           + +N+EVD + +Y+ ++ A
Sbjct: 176 EPVNMEVDVVAKYVEKMVA 194


>gi|24374974|ref|NP_719017.1| riboflavin synthase subunit alpha [Shewanella oneidensis MR-1]
 gi|24349700|gb|AAN56461.1|AE015783_4 riboflavin synthase, alpha subunit [Shewanella oneidensis MR-1]
          Length = 218

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLTDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLAAPTELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + RY+ RL   ++ +
Sbjct: 176 GDKVNIEVDLIARYLERLMRFDSKE 200


>gi|170703036|ref|ZP_02893864.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria
           IOP40-10]
 gi|170132060|gb|EDT00560.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria
           IOP40-10]
          Length = 209

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVHAGGLDLADVALGDSIAVQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----TGFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTVDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N+E+D + RY+ R+ +
Sbjct: 173 VTTLRHVKAGDKVNLEIDMIARYVERMLS 201


>gi|147678095|ref|YP_001212310.1| riboflavin synthase subunit alpha [Pelotomaculum thermopropionicum
           SI]
 gi|146274192|dbj|BAF59941.1| riboflavin synthase alpha chain [Pelotomaculum thermopropionicum
           SI]
          Length = 216

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+       RL +  +     +++G SIA  G+CLT      E    
Sbjct: 1   MFTGIVEELGVVRAVRSGTASARLVIGATKVLEDLRVGDSIAVNGVCLTA-----ESFTS 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   TN+     G  +NLER+++LGDRL GHLVSGHIDG   I   +   
Sbjct: 56  REFTADVMAETLAKTNLGGLSPGDRVNLERALRLGDRLGGHLVSGHIDGVGTITRQERFD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  PH + +++  KGSV ++G+SLTV   G + F V LI HT   TT    KVG
Sbjct: 116 IATLITIKAPHEVMRYVIKKGSVAIDGISLTVVDFGPDSFQVSLIPHTARVTTLGFKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +YI RL  L   +
Sbjct: 176 DTVNLEGDIIGKYIERLMELRREE 199


>gi|115350874|ref|YP_772713.1| riboflavin synthase subunit alpha [Burkholderia ambifaria AMMD]
 gi|115280862|gb|ABI86379.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria AMMD]
          Length = 209

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVHAGGLDLADVALGDSIAIQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----TGFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N+E+D + RY+ R+ +
Sbjct: 173 VTTLRHVKAGDKVNLEIDMIARYVERMLS 201


>gi|148976616|ref|ZP_01813303.1| riboflavin synthase subunit alpha [Vibrionales bacterium SWAT-3]
 gi|145963967|gb|EDK29225.1| riboflavin synthase subunit alpha [Vibrionales bacterium SWAT-3]
          Length = 218

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V +   + + ++LG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLSAITPRGEDITVTVNVGKLDMADVQLGDSIATNGVCLTVVEFN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  DHSYSADLSLETLKKTGFVDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWVEMPAEISKYVAQKGSITVDGISLTVNDLRKNAFKLTIVPHTSSETTIDQFHV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDVLARYMERL 193


>gi|172059886|ref|YP_001807538.1| riboflavin synthase subunit alpha [Burkholderia ambifaria MC40-6]
 gi|171992403|gb|ACB63322.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria MC40-6]
          Length = 209

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 122/209 (58%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVHAGGLDLADVALGDSIAIQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----TGFDVDVSRESLNRTVGLAQPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N+E+D + RY+ R+ +
Sbjct: 173 VTTLRNVKAGDKVNLEIDMIARYVERMLS 201


>gi|269467888|gb|EEZ79627.1| riboflavin synthase alpha chain [uncultured SUP05 cluster
           bacterium]
          Length = 197

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG+I       KG   R  +   + S + +G SIA  G+CLT V +  +   
Sbjct: 1   MFTGIIQAIGQIKTKDVHNKGAVFRFESKDLDFSNVAIGDSIAVNGVCLTAVEIGGD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             +++ ++  ET   +  ++  +G  +NLE++++L   +DGHLVSGH+DG  +++     
Sbjct: 58  --YFQADLSQETLDCSVFSNLEVGDSVNLEKALRLSQGIDGHLVSGHVDGVAKVIDKYSE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GDS   ++S P NL ++IA KGSVC+NGVSLTVN +    FD+ ++ HT+  TT     V
Sbjct: 116 GDSTRFKISTPKNLVKYIARKGSVCINGVSLTVNDISDEMFDINIVPHTLIATTLGELVV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + R++ +L
Sbjct: 176 GSKVNLEVDIIARHLEQL 193


>gi|302550092|ref|ZP_07302434.1| riboflavin synthase, alpha subunit [Streptomyces viridochromogenes
           DSM 40736]
 gi|302467710|gb|EFL30803.1| riboflavin synthase, alpha subunit [Streptomyces viridochromogenes
           DSM 40736]
          Length = 202

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A+  +    R R+     T   K G SIA  G+CLTVV    +H  D
Sbjct: 1   MFTGIVEELGEITAVETLDDACRFRLRGPVVTQGAKHGDSIAVNGVCLTVV----DHEGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +   G+ +NLER + +G+RL GH+V GH+DGT EIL      
Sbjct: 57  E-FTADVMAETLNRSSLGALKAGSRVNLERPMAVGERLGGHIVQGHVDGTGEILERKPSD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G + F V LI  T+  TT    + G
Sbjct: 116 HWEIVKISLPADLTRYVVEKGSITVDGISLTVVDAGPDHFTVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ R+
Sbjct: 176 DPVNLEVDVIAKYVERM 192


>gi|163786852|ref|ZP_02181300.1| riboflavin synthase, alpha subunit [Flavobacteriales bacterium
           ALC-1]
 gi|159878712|gb|EDP72768.1| riboflavin synthase, alpha subunit [Flavobacteriales bacterium
           ALC-1]
          Length = 196

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 112/200 (56%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G I  +      + + V T+  TS++K+  S+AH G+CLTVV +       
Sbjct: 1   MFTGIIEDLGTINKIIKDNGNLHITVTTTI-TSELKIDQSVAHNGVCLTVVSIDS----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   TN+        +N+ER++KLGDRLDGH+V GHID T + + +    
Sbjct: 55  NTYTVTAIQETLNKTNLDLLSENDIVNIERAMKLGDRLDGHIVQGHIDQTAKCISIVEEN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         NL      KGS+ +NGVSLTV    KN F V +I +T   TT+K  K+G
Sbjct: 115 GSWIFTFEYDKNLNNITIEKGSITVNGVSLTVVNSKKNSFSVAIIPYTYNHTTFKNLKIG 174

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D++N+E D + +Y+ RL  L
Sbjct: 175 DIVNLEFDVIGKYVKRLNEL 194


>gi|84625290|ref|YP_452662.1| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|122879294|ref|YP_202493.6| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188575266|ref|YP_001912195.1| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84369230|dbj|BAE70388.1| riboflavin synthase alpha chain [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519718|gb|ACD57663.1| riboflavin synthase, alpha subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 200

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPIDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V +  F+  LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEEGFEAALIPHTMANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GATVNLEIDLVARYVERL 193


>gi|327399585|ref|YP_004340454.1| riboflavin synthase subunit alpha [Hippea maritima DSM 10411]
 gi|327182214|gb|AEA34395.1| riboflavin synthase, alpha subunit [Hippea maritima DSM 10411]
          Length = 210

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 116/197 (58%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++GKIIA+ P + G +L V     + + K G SIA  G CLTVV  S     +
Sbjct: 1   MFTGIVEEVGKIIAIKPESNGKKLIVGCKL-SKETKEGDSIAVNGACLTVVEKS-----N 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  E+   TN+    IG ++NLER++ +G RLDGH+V GHID T +I  +  +G
Sbjct: 55  NSFAVDVSFESLSKTNLGYLNIGDYVNLERALLVGGRLDGHIVLGHIDTTAKIQSIRRVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D     + +   + Q    KGS+ +NG+SLT+  + K   +V +I  T E T  K  KV 
Sbjct: 115 DFFILTVQIDDYIYQNSVEKGSISINGISLTIANLSKTQLNVAIIPFTFENTNLKYLKVQ 174

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+EVD + +Y+ + 
Sbjct: 175 DIVNVEVDIIGKYVRKF 191


>gi|254286059|ref|ZP_04961020.1| riboflavin synthase, alpha subunit [Vibrio cholerae AM-19226]
 gi|150423969|gb|EDN15909.1| riboflavin synthase, alpha subunit [Vibrio cholerae AM-19226]
          Length = 217

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   N   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLNMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|288817689|ref|YP_003432036.1| riboflavin synthase alpha chain [Hydrogenobacter thermophilus TK-6]
 gi|288787088|dbj|BAI68835.1| riboflavin synthase alpha chain [Hydrogenobacter thermophilus TK-6]
 gi|308751287|gb|ADO44770.1| riboflavin synthase, alpha subunit [Hydrogenobacter thermophilus
           TK-6]
          Length = 207

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 116/194 (59%), Gaps = 7/194 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V D+GK+  +   +KG  L V+TS    ++K+G SIA  G+CLTV ++      D
Sbjct: 1   MFTGLVEDVGKVKNIKISSKGGTLEVITSL--KEIKVGDSIAVNGVCLTVTKVE-----D 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +    ++  ET R +N++   +G  +NLER++K+GDRL GH++ GH+D T  I     +G
Sbjct: 54  SIISFDLSPETLRRSNLSKAFVGDLVNLERAIKVGDRLGGHILLGHVDFTSRIESFRSVG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D    ++ +P     +   KGSV ++G+SLTVN V  N   + +I HT + T  K  K G
Sbjct: 114 DHYELKIYIPDEWILYFVEKGSVGIDGISLTVNTVEGNLISLNIIPHTYQNTNLKGRKEG 173

Query: 181 DLINIEVDSMMRYI 194
           D +NIEVD + +Y+
Sbjct: 174 DHVNIEVDILGKYV 187


>gi|225849240|ref|YP_002729404.1| riboflavin synthase subunit alpha [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643682|gb|ACN98732.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 210

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GK+ ++   + GMRL V          LG SI+  G+CLTVV + +E +  
Sbjct: 1   MFTGLIEEVGKVKSVIKNSDGMRLVVSCRKVLDGTVLGDSISVNGVCLTVVDMDKESA-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET + +N +    G ++NLERS+    RL GH+V GH+D T  I+    +G
Sbjct: 59  ---SFDVSQETIKRSNFSFLKTGDYVNLERSLTPQSRLGGHIVQGHVDTTGSIVSKTSLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++S     +  +  KGS+ ++G+SLTVN + +N  D+ +I HT+E T  K  KVG
Sbjct: 116 SHTNFKISFSPEYKNLVIEKGSIAIDGISLTVNYINENIIDLNIIPHTLENTNLKYRKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIE D + +Y+A++
Sbjct: 176 DVVNIEFDILGKYVAKM 192


>gi|149179739|ref|ZP_01858244.1| riboflavin synthase subunit alpha [Bacillus sp. SG-1]
 gi|148851931|gb|EDL66076.1| riboflavin synthase subunit alpha [Bacillus sp. SG-1]
          Length = 218

 Score =  131 bits (329), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  +   +  M L ++       +KLG SI+  G CLTV   S      
Sbjct: 1   MFTGIIEEIGTIENLKKSSASMVLSILAKKVLEDVKLGDSISVNGTCLTVTSFS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T++   G GT +NLER++    R  GH V+GH+DGT  I+   F+ 
Sbjct: 56  RSFTVDVMPETFENTSLKLLGAGTKVNLERAMAANGRFGGHFVTGHVDGTGTIVSTQFVE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P  L ++   +GSVCL+G SLTV  +G N   V LI  T  +T     KVG
Sbjct: 116 NALYITIEIPGELSRYFINRGSVCLDGTSLTVFEIGNNTITVSLIPQTRHDTILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E D M +YI + 
Sbjct: 176 DIVNLECDMMAKYIYQF 192


>gi|119774154|ref|YP_926894.1| riboflavin synthase subunit alpha [Shewanella amazonensis SB2B]
 gi|119766654|gb|ABL99224.1| riboflavin synthase, alpha subunit [Shewanella amazonensis SB2B]
          Length = 217

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++  +      +RL V +   + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGQLRRIDRKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVV-----ECL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET ++T    +  G  +NLE++V    RL GHLVSGH+DG   ++    +
Sbjct: 56  ADGYVADVSAETVKLTGFGDYRPGQAVNLEKAVTPTTRLGGHLVSGHVDGRAMVVSRSHL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L  P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT     V
Sbjct: 116 GKAIEFWLEAPAELARYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + RY+ RL
Sbjct: 176 GDKVNLEVDQIARYLERL 193


>gi|110667358|ref|YP_657169.1| riboflavin synthase subunit alpha [Haloquadratum walsbyi DSM 16790]
 gi|109625105|emb|CAJ51524.1| riboflavin synthase alpha chain [Haloquadratum walsbyi DSM 16790]
          Length = 209

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 113/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV--MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+   G I A T    G RLR+    + N  +++ G SIA +G CLTV   SE  +
Sbjct: 1   MFTGIIEGTGVITAATADEGGRRLRIEPPAAINAKQLEHGQSIAVSGACLTV-ESSEART 59

Query: 59  VDN--WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
            D   ++EV + AET   T +    +G  +N+ER++   DR DGHLV GH+D T +I  +
Sbjct: 60  TDTNGYFEVFLAAETIDKTYLGEINVGDRVNIERALAADDRFDGHLVQGHVDMTAQITSI 119

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
           D IGD       LP ++  ++  KGS+ ++G+SLTV       F V +I  T E TT   
Sbjct: 120 DRIGDDWTFGFDLPTSIAPYVVQKGSITVDGISLTVAERNSTEFSVAIIPTTYEVTTLSE 179

Query: 177 HKVGDLINIEVDSMMRYIARL 197
             VGD +++EVD + +Y+ +L
Sbjct: 180 KAVGDPVHLEVDVVAKYVEQL 200


>gi|71066694|ref|YP_265421.1| riboflavin synthase subunit alpha [Psychrobacter arcticus 273-4]
 gi|71039679|gb|AAZ19987.1| probable riboflavin synthase alpha chain [Psychrobacter arcticus
           273-4]
          Length = 223

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 114/206 (55%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ +M P    +RL + +   + S +KLG SIA  GICLTVV     H  
Sbjct: 1   MFTGIIESVGKVKSMQPTGGDIRLTIESDGLDFSDVKLGDSIASNGICLTVVDFGSNH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y V+V  ET   T +     G  +NLE+++    R  GH+V+GH+DG   +  L   
Sbjct: 59  ---YSVDVSRETIARTALKDLKPGHIVNLEKAMLPTTRFGGHIVAGHVDGVGVVSKLQKD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH-K 178
             S+Y  + +P  L  + A KGS+ L+G+SLT NLV  N   + +I HT + T    H  
Sbjct: 116 ARSIYIEIEIPVELAHYTATKGSITLDGISLTTNLVRDNIVSLNIIPHTAQVTNIAQHWL 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
           +G  +N+EVD + RY+ RL  LN SQ
Sbjct: 176 LGSKVNVEVDIVARYLERL--LNKSQ 199


>gi|161529125|ref|YP_001582951.1| riboflavin synthase subunit alpha [Nitrosopumilus maritimus SCM1]
 gi|160340426|gb|ABX13513.1| riboflavin synthase, alpha subunit [Nitrosopumilus maritimus SCM1]
          Length = 197

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 115/200 (57%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSK----MKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  IGK+  ++   K  R  V  + N  K    +K+G S+A  G+CLT  +LS+ 
Sbjct: 4   MFTGIVKGIGKVEKISKNTKN-RSAVQMTVNLGKHAKGLKIGQSVALNGVCLTATKLSKS 62

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
             +      E+  ET + T++ +  +G  +N+ERS+K GDRL+GH V GH+DG   I  +
Sbjct: 63  SCI-----FEMIEETTKKTDLGNLEVGGIVNIERSLKAGDRLEGHFVLGHVDGVGIIKKI 117

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
                 +     +P  L +++  KGS+ ++G+SLTV  + KN   V LI HTIE T ++ 
Sbjct: 118 QKKPKEVQVWFEVPKKLAKYVVKKGSIAVDGISLTVTDIKKNLASVSLIPHTIEVTNFQT 177

Query: 177 HKVGDLINIEVDSMMRYIAR 196
            KVGD +NIE D + +YI +
Sbjct: 178 KKVGDKVNIETDILGKYILK 197


>gi|256821697|ref|YP_003145660.1| riboflavin synthase subunit alpha [Kangiella koreensis DSM 16069]
 gi|256795236|gb|ACV25892.1| riboflavin synthase, alpha subunit [Kangiella koreensis DSM 16069]
          Length = 202

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G I A+ P  +  R R  T   + S ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEATGYIAAIEPKGEDARYRFQTGKLDLSDVELGDSIACNGVCLTVIE-----KF 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           ++ +  +V  ET ++T    +     IN E+++    R  GH+VSGH+DG  E++ ++  
Sbjct: 56  NDGFAADVSVETIKVTCFKHYQAQQPINFEKAMLPTTRFGGHMVSGHVDGIGEVMAIEDA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   +  P ++  +IA+KGS+ ++G SLTVN + ++ F + L+ HT++ET    +KV
Sbjct: 116 GRSIQYTIRAPQDVLHYIAIKGSITVDGTSLTVNQIKEDCFFLNLVPHTLQETIADSYKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  IN+E+D + RY+ RL
Sbjct: 176 GTKINLEIDLIARYLERL 193


>gi|197119394|ref|YP_002139821.1| riboflavin synthase subunit alpha [Geobacter bemidjiensis Bem]
 gi|197088754|gb|ACH40025.1| riboflavin synthase [Geobacter bemidjiensis Bem]
          Length = 214

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 111/199 (55%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+++++        L V TS    ++ +G SIA  G CLTVVR        
Sbjct: 1   MFTGLIETVGELVSIEKRGASGSLTVKTSLPLDEVAIGASIAINGACLTVVRKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                ++  ET   T   +   G+ +N+ER+++L DRLDGHLVSGH+D    ++    + 
Sbjct: 56  GAVTFDISPETIDRTGFKNLKSGSPVNMERAMRLSDRLDGHLVSGHVDCVATVIERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++      P    ++IA KGSV ++G+SLTVN  G + F + +I HT  +TT    +VG
Sbjct: 116 GNIVFSFRFPPQYGKYIAAKGSVAIDGISLTVNSAGPDSFSINVIPHTAAKTTLIGKRVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +NIE D + RY+ RL A
Sbjct: 176 DEVNIETDLLCRYLERLLA 194


>gi|86159163|ref|YP_465948.1| riboflavin synthase subunit alpha [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85775674|gb|ABC82511.1| riboflavin synthase, alpha subunit [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 215

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 109/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V D+G +  + P   G RL +  +     ++ LG SIA +G CLTVV        
Sbjct: 1   MFTGLVADVGVVERIVPWQGGARLTLRPARLPVDELVLGESIACSGACLTVVERG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +   ET   T + SW  GT +NLER++ +G+RL GHLV GH+D   E+L     
Sbjct: 56  GGLVSFDAVPETLSRTTVGSWRPGTKVNLERALAVGERLGGHLVQGHVDAVGEVLRRVPE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      +SLP ++   +A KGS+ ++GVSLTV    ++ F++ LI  T+  TT      
Sbjct: 116 GQGARLAISLPASIAPLVAEKGSIAVDGVSLTVATAARDRFELALIPETLVRTTLGQAAA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E D + R++ARL A  
Sbjct: 176 GTKVNLEADVLARHVARLRAFE 197


>gi|261211386|ref|ZP_05925674.1| riboflavin synthase alpha chain [Vibrio sp. RC341]
 gi|260839341|gb|EEX65967.1| riboflavin synthase alpha chain [Vibrio sp. RC341]
          Length = 217

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDARS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPADLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTMDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|315125801|ref|YP_004067804.1| riboflavin synthase subunit alpha [Pseudoalteromonas sp. SM9913]
 gi|315014315|gb|ADT67653.1| riboflavin synthase subunit alpha [Pseudoalteromonas sp. SM9913]
          Length = 217

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   GKI  +      + +R+ + + + S +KLG SIA  G+CLTVV   ++H +
Sbjct: 1   MFTGIVEATGKIALLQKKQGDLAIRIQSKNLDMSDVKLGDSIATNGVCLTVV---DKH-I 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  ++  ET  +T  A + +G  +NLE++++   RL GHLVSGH+DG   I  ++  
Sbjct: 57  DG-FSADLSNETISLTGFAHYALGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITAINAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   NL ++I  KGSVC++G+SLTVN V  N F + ++ HT  +TT    +V
Sbjct: 116 ARATEYWLATDENLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSGQTTIADFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTQVNLEVDQIARYLERL 193


>gi|168210246|ref|ZP_02635871.1| riboflavin synthase, alpha subunit [Clostridium perfringens B str.
           ATCC 3626]
 gi|170711629|gb|EDT23811.1| riboflavin synthase, alpha subunit [Clostridium perfringens B str.
           ATCC 3626]
          Length = 217

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 118/201 (58%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTMTTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  + +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGKFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+NIE D + +Y+ +L    
Sbjct: 176 DLVNIECDPIGKYVEKLLGFK 196


>gi|254253007|ref|ZP_04946325.1| Riboflavin synthase alpha chain [Burkholderia dolosa AUO158]
 gi|124895616|gb|EAY69496.1| Riboflavin synthase alpha chain [Burkholderia dolosa AUO158]
          Length = 209

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 120/209 (57%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIETIKPLGASPDAGVRLTVHAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  -DKTDTAFDVDVSRESLNRTVGLAEPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N+EVD + RY+ R+ +
Sbjct: 173 VTTLRHLKSGDKVNLEVDMIARYVERMLS 201


>gi|330830922|ref|YP_004393874.1| riboflavin synthase subunit alpha [Aeromonas veronii B565]
 gi|328806058|gb|AEB51257.1| Riboflavin synthase, alpha subunit [Aeromonas veronii B565]
          Length = 217

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      M L V     + S +KLG SIA  G+CLTVV L      
Sbjct: 1   MFTGIIEAVGTLAELRRQGDDMALTVHAPGLDFSDVKLGDSIATNGVCLTVVALG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  Y  +V  ET   T  A+  +G  +NLE+++    RL GHLVSGH+DG  E+  +   
Sbjct: 56  DKSYTADVSLETLSRTGFAAARVGDRVNLEKALMPTSRLGGHLVSGHVDGVGEVKSVSSS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P  L ++IA KGS+ ++G+SLTVN V  + F + ++ HT +ETT    K 
Sbjct: 116 GRAIEYWIKAPGELSRYIAEKGSIAVDGISLTVNAVQGDLFRLTIVPHTAQETTIASWKP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GHKVNLEVDQIARYLERL 193


>gi|72161482|ref|YP_289139.1| riboflavin synthase subunit alpha [Thermobifida fusca YX]
 gi|71915214|gb|AAZ55116.1| Lumazine-binding protein [Thermobifida fusca YX]
          Length = 205

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 114/201 (56%), Gaps = 9/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPI----AKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV ++G ++ +TP+    A  +RL +     TS    G SIA  G+CLTV  L+  
Sbjct: 1   MFTGIVEELGTVVEVTPVGSDSADAIRLTIHGPDVTSDASPGDSIAVNGVCLTVTELA-- 58

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
              D  +  +V  ET   +N+ +  +G+ +NLER++K+  RL GH+V GH+DGT  +   
Sbjct: 59  ---DGRFSADVMKETLDRSNLGALTVGSPVNLERALKVSSRLGGHIVQGHVDGTGVVTER 115

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
               D      SLP  L +++  KGS+ ++GVSLTV     + F V LI  T++ TT   
Sbjct: 116 VPGTDWETVTFSLPARLSRYVVEKGSIAVDGVSLTVAACTDSSFTVSLIPTTLQATTLGF 175

Query: 177 HKVGDLINIEVDSMMRYIARL 197
             VG  +NIEVD++ +Y+ RL
Sbjct: 176 ATVGTKVNIEVDTLAKYVERL 196


>gi|58428071|gb|AAW77108.1| riboflavin synthase alpha chain [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 332

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T +     ++LG SIA  G+CLTVV        
Sbjct: 133 MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAAS-- 190

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 191 ---FQADASTETLSLTTLGALPEGALLNLERAMRPIDRLGGHLVSGHVDGLGQVQSVHDD 247

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V +  F+  LI HT+  T +    V
Sbjct: 248 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEEGFEAALIPHTMANTAFAQTAV 307

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 308 GATVNLEIDLVARYVERL 325


>gi|298207052|ref|YP_003715231.1| riboflavin synthase alpha chain [Croceibacter atlanticus HTCC2559]
 gi|83849686|gb|EAP87554.1| riboflavin synthase alpha chain [Croceibacter atlanticus HTCC2559]
          Length = 198

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 115/203 (56%), Gaps = 7/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +T     + +  + ++ +S++K+  S+AH G+CLTVV ++     D
Sbjct: 1   MFTGIVEELGRVKDLTKDGDNLHI-FIEAHMSSELKIDQSVAHNGVCLTVVAVT-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   +N+ S  +   +NLER +KLG RLDGH+V GH+D   E +      
Sbjct: 55  NTYSVTAIQETLNKSNLGSLKVNDLVNLERGMKLGARLDGHIVQGHVDQVAECILAQEKD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R      L      KGS+ +NGVSLTV     N F V +I +T E TT+K  + G
Sbjct: 115 GSWEYRFKYDPALNNVTIEKGSITINGVSLTVVDSEINTFSVAIIPYTYEHTTFKQLQKG 174

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+ RL   NTS
Sbjct: 175 DVVNLEFDVIGKYVKRLLG-NTS 196


>gi|283765808|gb|ADB28296.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 85/135 (62%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           + P+ +G+RL + T Y    +K+G SIA AGICLT+V    + +  +W+ VE W E  R+
Sbjct: 6   VQPLKQGVRLNIATRYAIESLKIGASIACAGICLTIVERGSKQADTSWFAVEAWEEALRL 65

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     GD++   L +P    
Sbjct: 66  TNLAQWTKGTSINLERSLRLGDEVGGHLVFGHIDGLAEIIDQKNEGDAVRFFLQIPTRFT 125

Query: 135 QFIAVKGSVCLNGVS 149
            FI  KGS+ LNG S
Sbjct: 126 SFIVNKGSIALNGTS 140


>gi|312883785|ref|ZP_07743504.1| riboflavin synthase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368534|gb|EFP96067.1| riboflavin synthase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 216

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP  + + + + +   + S +KLG SIA  G+CLTVV  ++    
Sbjct: 1   MFTGIIEAVGTLTELTPKGEDVSVTIDVGKLDMSDVKLGDSIAANGVCLTVVNFTQSS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET R T    + IG  +NLE+++    R  GH+VSGH+D   EI     +
Sbjct: 59  ---YSADLSLETLRKTGFNQYQIGRKLNLEKAMLPTTRFGGHIVSGHVDAVGEITERISV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G +    +S+P +L ++IA KGS+ ++GVSLTVN + K+ F + ++ HT +ETT    +V
Sbjct: 116 GRAWEFWVSVPADLTRYIAEKGSITVDGVSLTVNALRKDAFKLTIVPHTSKETTIASFEV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     S+
Sbjct: 176 GQAVNLEVDILARYMERLLTGRQSE 200


>gi|319789428|ref|YP_004151061.1| riboflavin synthase, alpha subunit [Thermovibrio ammonificans HB-1]
 gi|317113930|gb|ADU96420.1| riboflavin synthase, alpha subunit [Thermovibrio ammonificans HB-1]
          Length = 213

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++     +KG  L V     +   KLG SIA  G+CLTV ++       
Sbjct: 1   MFTGLVEEVGEVVRFGRSSKGGTLLVEAPLCSQGTKLGDSIAVNGVCLTVTKVE-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  E  V  ET + +N++    G  +NLER++KLGDRL GHL+ GH+D T +I  +   G
Sbjct: 56  NRLEFFVSPETLKRSNLSQLRPGFRVNLERALKLGDRLGGHLLLGHVDTTTKIEGIRREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS      LP +    +  KGS+ ++G+SLTV  +    F V +I HT+  T  K  K G
Sbjct: 116 DSFLFLFKLPRSFSHLLVEKGSIGIDGISLTVAGLFPTTFSVAVIPHTLNNTNLKFRKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+E D + +Y+ RL
Sbjct: 176 ETVNLEFDVIGKYVVRL 192


>gi|306836171|ref|ZP_07469156.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49726]
 gi|304567954|gb|EFM43534.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49726]
          Length = 204

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + A+   A  +RL +      S  +LG SIA  G+CLT+  L       
Sbjct: 1   MFTGLVQELGTVAALEQQADALRLSIRAPQTVSDARLGDSIAINGVCLTIAELD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  E+   T +     G  +N+E ++    RL GH++ GH+DGT  ++  +   
Sbjct: 56  DIFCADVMQESLDRTGLGQLKEGARVNVEPALLPTTRLGGHMMQGHVDGTARLVSREHSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SLP +L +++  KGS+ +NG SLTV+ VG+++F+V LI  T+ ETT    KVG
Sbjct: 116 HWDVLRFSLPRDLARYVVEKGSIAVNGTSLTVSAVGEDWFEVSLIPTTLRETTHGESKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+EVD + +Y+ ++
Sbjct: 176 DIVNLEVDVLAKYVEKM 192


>gi|255020758|ref|ZP_05292817.1| Riboflavin synthase alpha chain [Acidithiobacillus caldus ATCC
           51756]
 gi|254969820|gb|EET27323.1| Riboflavin synthase alpha chain [Acidithiobacillus caldus ATCC
           51756]
          Length = 195

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 105/163 (64%), Gaps = 5/163 (3%)

Query: 35  MKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKL 94
           + LG SIA +G+CLTVV LS        + V+V  ET   + +A  G+G+ +NLE++++L
Sbjct: 13  VALGDSIAVSGVCLTVVALSPPT-----FAVDVSRETLERSILADLGVGSAVNLEKALRL 67

Query: 95  GDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNL 154
            DRL GHLV+GH+DG   +      G S+  R++ P  L ++IA KGS+C++G+SLTVN 
Sbjct: 68  SDRLGGHLVAGHVDGVGTVREAQPSGRSIVFRIAAPAELRRYIAAKGSICVDGISLTVNA 127

Query: 155 VGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           +    F + LI HT+E+TT +  + G  +N+EVD + RY+ +L
Sbjct: 128 LEGETFSLNLIPHTLEQTTAREWRGGQRVNLEVDLLARYLEQL 170


>gi|149194755|ref|ZP_01871850.1| riboflavin synthase subunit alpha [Caminibacter mediatlanticus
           TB-2]
 gi|149135178|gb|EDM23659.1| riboflavin synthase subunit alpha [Caminibacter mediatlanticus
           TB-2]
          Length = 201

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 12/198 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF G++ +IGKI +        +LRV++ Y   K ++G SIA  G+CLTV      ++  
Sbjct: 1   MFNGLIREIGKIKSFF----NNKLRVLSKY---KPQIGDSIAINGVCLTVT-----NTFS 48

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EVE+  ET +I  + ++    F+++E +++ GDR+DGHL+ GHID   EIL +    
Sbjct: 49  DGFEVELSPETQKIIPLENYSPNKFVHIEPALRFGDRIDGHLIQGHIDAIGEILEIKKNK 108

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S    +    N+ ++IA KGS+ ++GVSLT+N V  + F + +I HT E T +K +K+ 
Sbjct: 109 NSYDVIIKTSPNIMKYIAPKGSIAIDGVSLTINEVFSDRFRLTIIPHTFENTLFKYYKIH 168

Query: 181 DLINIEVDSMMRYIARLY 198
             +NIE D   RY+  ++
Sbjct: 169 QKVNIETDIFARYLYHMF 186


>gi|167044540|gb|ABZ09214.1| putative Lumazine binding domain protein [uncultured marine
           crenarchaeote HF4000_APKG6N3]
          Length = 194

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 113/199 (56%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+   GK+  + P  K    +++ V        +K+G S+A  G+CL+  ++S   
Sbjct: 1   MFTGIIVGTGKVTKLNPKPKSRSAIQMTVDLGKYARGLKIGQSVAINGVCLSATKISRNK 60

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
            +      E+  ET + T++ +   G+ +N+ERS+K+GDRL+GH V GHIDG   I  ++
Sbjct: 61  CI-----FEMIDETTKKTDLGNVKAGSIVNIERSLKVGDRLEGHFVLGHIDGVATITKIE 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                +     +P  L ++I  KGS+ L+G+SLTV    K+   V LI HTI+ T +K  
Sbjct: 116 KKPKEVKFWFKIPKKLTKYIVKKGSITLDGISLTVVDAKKDVASVCLIPHTIKVTNFKSK 175

Query: 178 KVGDLINIEVDSMMRYIAR 196
           KVGD +NIE D + +YI +
Sbjct: 176 KVGDKLNIETDILGKYIKK 194


>gi|59711308|ref|YP_204084.1| riboflavin synthase subunit alpha [Vibrio fischeri ES114]
 gi|59479409|gb|AAW85196.1| riboflavin synthase, alpha subunit [Vibrio fischeri ES114]
          Length = 218

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V +   + S +KLG SIA  G+CLTVV ++E    
Sbjct: 1   MFTGIIESVGILQAITPKGEDISVTVNVGQLDMSDVKLGDSIATNGVCLTVVAMTE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T    + +G  +NLE+++    R  GH+VSGH+D   E++     
Sbjct: 57  -RTYTADLSLETLKRTGFVDYKVGDKVNLEKAMLPTTRFGGHIVSGHVDAVGELIERHQT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + LP  L +++  KGS+ ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWIQLPQTLAKYVVEKGSITVDGISLTVNDIRKNAFKLTIVPHTAAETTMDNFSV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GQKVNLEVDVIARYLERL 193


>gi|118602514|ref|YP_903729.1| riboflavin synthase subunit alpha [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567453|gb|ABL02258.1| riboflavin synthase, alpha subunit [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
          Length = 192

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 121/197 (61%), Gaps = 8/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GKI     I  G+          +++K+G SI+  G+CLT + +      D
Sbjct: 1   MFTGIIQIVGKI---KSIKAGVFCFEAQGSFFNEVKIGDSISVNGVCLTAIEIG-----D 52

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           ++++ ++  ET R T     GI   +NLE++++L   +DGHLVSGH+DG  +++     G
Sbjct: 53  DYFKADISQETFRYTIFNHLGINNSVNLEKALRLNQGIDGHLVSGHVDGIAKVVDRFIEG 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   ++S P NL ++I+ KGS+C+NGVSLTVN +    FD+ ++ +T++ TT    K+ 
Sbjct: 113 ESTRFKISTPKNLIKYISKKGSICINGVSLTVNNINDCVFDINIVPYTLKATTLGGLKIN 172

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+EVD ++RY+ +L
Sbjct: 173 NEVNLEVDIIVRYLEQL 189


>gi|225181337|ref|ZP_03734781.1| riboflavin synthase, alpha subunit [Dethiobacter alkaliphilus AHT
           1]
 gi|225167918|gb|EEG76725.1| riboflavin synthase, alpha subunit [Dethiobacter alkaliphilus AHT
           1]
          Length = 217

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  ++      +L V      + ++LG SIA  G+CLTV   S +  V 
Sbjct: 1   MFTGIVEELGTVKTLSVRGDAGKLSVKAKQVLTDVRLGDSIAVNGVCLTVTSFSAQEFV- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET R TN+     G  +NLER++ LG RL GHLVSGH+DG   I+     G
Sbjct: 60  ----ADVMPETLRKTNLLQLQGGDPVNLERALALGGRLGGHLVSGHVDGVGAIVEKRPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+S P  + ++I  KGSV ++G+SLTV  V    F V +I HT   TT    K G
Sbjct: 116 NAVIYRISAPPEVLRYIIAKGSVAIDGISLTVADVSSEAFSVSVIPHTASVTTLGYKKEG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +Y+ RL +
Sbjct: 176 DAVNLENDMIGKYVERLLS 194


>gi|262166345|ref|ZP_06034082.1| riboflavin synthase alpha chain [Vibrio mimicus VM223]
 gi|262026061|gb|EEY44729.1| riboflavin synthase alpha chain [Vibrio mimicus VM223]
          Length = 217

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTMDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|258627341|ref|ZP_05722125.1| Riboflavin synthase alpha chain [Vibrio mimicus VM603]
 gi|258580379|gb|EEW05344.1| Riboflavin synthase alpha chain [Vibrio mimicus VM603]
          Length = 217

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+EVD + RY+ RL   N
Sbjct: 176 GRRVNLEVDVLARYMERLLQGN 197


>gi|167042937|gb|ABZ07652.1| putative Lumazine binding domain protein [uncultured marine
           crenarchaeote HF4000_ANIW137N13]
          Length = 194

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 113/199 (56%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+   GK+  + P  K    +++ V        +K+G S+A  G+CL+  ++S   
Sbjct: 1   MFTGIIVGTGKVTKLNPKPKSRSAIQMTVDLGKYAKGLKIGQSVAINGVCLSATKISRNK 60

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
            +      E+  ET + T++ +   G+ +N+ERS+K+GDRL+GH V GHIDG   I  ++
Sbjct: 61  CI-----FEMIDETTKKTDLGNVKAGSTVNIERSLKVGDRLEGHFVLGHIDGVATITKIE 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                +     +P  L ++I  KGS+ L+G+SLTV    K+   V LI HTI+ T +K  
Sbjct: 116 KKPKEVKFWFKIPKKLTKYIVKKGSITLDGISLTVVDAKKDVASVCLIPHTIKVTNFKSK 175

Query: 178 KVGDLINIEVDSMMRYIAR 196
           KVGD +NIE D + +YI +
Sbjct: 176 KVGDKLNIETDILGKYIKK 194


>gi|150388846|ref|YP_001318895.1| riboflavin synthase subunit alpha [Alkaliphilus metalliredigens
           QYMF]
 gi|149948708|gb|ABR47236.1| riboflavin synthase, alpha subunit [Alkaliphilus metalliredigens
           QYMF]
          Length = 218

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 117/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG + A+   +K  +L +       ++KLG SI+  G+CLTVV   +     
Sbjct: 1   MFTGLIEEIGTVEAVRKGSKSAQLTIKAKQVVERVKLGDSISTNGVCLTVVEFGQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +N+ +   G+ +NLER++KLGDRL GH+VSGHIDG   I  ++   
Sbjct: 56  NGFTVDVMPETMRRSNLKNVKHGSSVNLERALKLGDRLGGHMVSGHIDGVGIIQGIEEED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++ +  +  P    +++  KGS+ ++G SLTV  V +    V +I  T +ETT    KVG
Sbjct: 116 NATWVTIKAPIGTLKYVIEKGSIAIDGTSLTVAYVDQETLKVSIIPLTRDETTLLSKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+E D + +YI RL
Sbjct: 176 EEVNLECDMVGKYIERL 192


>gi|332530149|ref|ZP_08406098.1| riboflavin synthase subunit alpha [Hylemonella gracilis ATCC 19624]
 gi|332040419|gb|EGI76796.1| riboflavin synthase subunit alpha [Hylemonella gracilis ATCC 19624]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 119/220 (54%), Gaps = 23/220 (10%)

Query: 1   MFTGIVTDIGKIIAM----TPIAKGMRLRVMTSYNTSK------MKLGCSIAHAGICLTV 50
           MFTGI+T +G+I+A     + +  G RL +     TS       + LG SIA  G C+TV
Sbjct: 1   MFTGIITGVGRIVASHDLGSSLQHGKRLTIACPPETSPPDYLDDVGLGDSIALNGACMTV 60

Query: 51  VRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGT 110
             L         + +++ AE+  +      G G  +NLE++++ GDRL GH+VSGH+DG 
Sbjct: 61  TTLDASR---RQFTIDISAES--LAKTTGLGQGQTVNLEKALRAGDRLGGHIVSGHVDGV 115

Query: 111 VEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV--------GKNFFDV 162
             +     +G+S   R+ +P  L +++A KGS+ +NGVSLTVN V        G     +
Sbjct: 116 GTVSHFAQVGESWELRIRIPQELARYLAYKGSITVNGVSLTVNQVVDQPAVSGGGCEISI 175

Query: 163 LLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
            LI HT++ T     K G  +N+E+D++ RY+ R+   N+
Sbjct: 176 NLIPHTVQNTALGQLKTGSGVNLEIDTVARYVERMLKANS 215


>gi|145298018|ref|YP_001140859.1| riboflavin synthase subunit alpha [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850790|gb|ABO89111.1| riboflavin synthase, alpha subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 217

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+    + M L V   + +   +KLG SIA  G+CLTV+ L      
Sbjct: 1   MFTGIIEAVGTLAALRRQGEDMALTVHAPTLDFGDVKLGDSIATNGVCLTVIGLG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  Y  +V  ET   T  A   +G  +NLE+++    RL GHLVSGH+DG  E+      
Sbjct: 56  DKSYTADVSLETLSCTGFAKAKVGDPVNLEKALMPTSRLGGHLVSGHVDGVGEVKSKSSS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P  L ++IA KGS+ ++G+SLTVN V  + F + ++ HT +ETT    K 
Sbjct: 116 GRAIEYWIKAPGELSRYIAEKGSIAVDGISLTVNAVQGDLFRLTIVPHTAQETTIARWKP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GHHVNLEVDQIARYLERL 193


>gi|254516857|ref|ZP_05128915.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR5-3]
 gi|219674362|gb|EED30730.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR5-3]
          Length = 221

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 111/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +RLR+ T   +   + +G SIA  G+CLTV  L      
Sbjct: 1   MFTGIIQAVGTVAAQQPSGGDLRLRIQTGKLSLDDVAIGDSIATNGVCLTVTELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T +     G+ +NLE+S+    RL GH+VSGH+DG  EI+ L   
Sbjct: 56  GDGFWADVSRETLSLTTLGGLSQGSPVNLEKSLTPQSRLGGHIVSGHVDGLGEIVSLKED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P+ L ++I  KGS+C++G SLTVN V    FD+ +I  T+ ET +  +  
Sbjct: 116 ARSWRIVVRAPYELAKYIVHKGSICIDGTSLTVNAVDGANFDLNIIPQTMAETLFAHYSP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSRVNLEVDVIARYLERL 193


>gi|134280348|ref|ZP_01767059.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 305]
 gi|134248355|gb|EBA48438.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 305]
          Length = 211

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 125/214 (58%), Gaps = 20/214 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I A+TPIA     G+RL +     + + + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIEAITPIAASPDAGVRLTLRAGGLDLADVALGDSIAIQGACMTVVAKTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                + ++VEV  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----DTFDVEVSRESLNRTVGLAEPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRVLAPRELGRYLAYKGSITVNGVSLTVNSVDDRDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT +    G  +N+E+D + RY+ R+  L+ SQ
Sbjct: 173 VTTLRHLTAGAKVNLEIDMIARYVERM--LSASQ 204


>gi|111024119|ref|YP_707091.1| riboflavin synthase subunit alpha [Rhodococcus jostii RHA1]
 gi|110823649|gb|ABG98933.1| riboflavin synthase alpha subunit [Rhodococcus jostii RHA1]
          Length = 202

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 116/203 (57%), Gaps = 8/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A   +A   R  V     TS    G SIA  G+CLTVV    E   D
Sbjct: 1   MFTGIVEELGEVVAKEELADAARFTVRGPVVTSDASHGDSIAVNGVCLTVV----EVLAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++    +G+ +NLER+  L  RL GHLV GH+DGT  I+      
Sbjct: 57  GSFTADVMQETLNRSSLQKIDVGSRVNLERAAALNSRLGGHLVQGHVDGTGHIISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
           +    R++LP  + +++  KGS+ ++GVSLTV+ +    G+ +F++ LI  T++ TT   
Sbjct: 117 NWEVVRIALPDAISRYVVEKGSITVDGVSLTVSALGGERGEEYFEISLIPTTLQLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
             VG  +N+EVD + +Y+ RL A
Sbjct: 177 ASVGTPVNLEVDVIAKYVERLQA 199


>gi|218888178|ref|YP_002437499.1| riboflavin synthase subunit alpha [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759132|gb|ACL10031.1| riboflavin synthase, alpha subunit [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 230

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 109/200 (54%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G I+A+    K  RLR+   +  S + +G SIA  G+CLTV    E H   
Sbjct: 1   MFTGIIQGQGGIVAVESAGKETRLRIRPLFMLSDIVVGESIAANGVCLTV----ETHGGS 56

Query: 61  N---WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
               WY     AET R+T +A    G  +NLER++ +GDRL GH+V+GH+D    +  + 
Sbjct: 57  RDAAWYTCYASAETMRLTTLADLKTGDRVNLERALAMGDRLGGHMVTGHVDCVATVAEVR 116

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G+S   +L  P      +  KGSV L+GVSLTVN  G +F +V +I  T   TT    
Sbjct: 117 EEGESRRYQLKFPQEFGPQVIPKGSVALDGVSLTVNHCGPDFLEVNVIPETQRVTTIAGW 176

Query: 178 KVGDLINIEVDSMMRYIARL 197
           K G  +N+E D + +Y+ R+
Sbjct: 177 KPGVRVNMETDLIGKYVQRM 196


>gi|153005590|ref|YP_001379915.1| riboflavin synthase subunit alpha [Anaeromyxobacter sp. Fw109-5]
 gi|152029163|gb|ABS26931.1| riboflavin synthase, alpha subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 215

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 107/198 (54%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V D+G + A+ P   G RL V  +      + LG SIA +G CLTVV        
Sbjct: 1   MFTGLVADLGLVEAIVPRQGGARLTVRPAALPVDALVLGESIACSGACLTVVERG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +   ET   T +  W  GT +NLER++ +G+RL GHLV GH+D   E++     
Sbjct: 56  GGRVSFDAVPETLSRTTVGGWRPGTKVNLERALAVGERLGGHLVQGHVDAVGEVVQRRPE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      +SLP ++   +A KGS+ ++GVSLTV    ++ F+V LI  T+  TT      
Sbjct: 116 GQGARLTISLPASIAPLVAEKGSIAVDGVSLTVAAATRDRFEVALIPETLARTTLGEAGP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E D + R++ARL
Sbjct: 176 GTKVNLEADVIARHVARL 193


>gi|170725744|ref|YP_001759770.1| riboflavin synthase subunit alpha [Shewanella woodyi ATCC 51908]
 gi|169811091|gb|ACA85675.1| riboflavin synthase, alpha subunit [Shewanella woodyi ATCC 51908]
          Length = 220

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 119/207 (57%), Gaps = 8/207 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   +   ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERRGDDIRLTVASGKLDLGDVRLGDSIATNGVCLTVV-----ECM 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +G  +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  SDGYVADISAETVSLTGFAHYQVGRKVNLEKAVTPTTRLGGHMVSGHVDGIASVDDRQLR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  N F + ++ HT  ETT    K 
Sbjct: 116 GKAIEFWLTAPAELARYIAHKGSITIDGVSLTVNEVQDNRFRLTIVPHTAGETTLVDMKA 175

Query: 180 GDLINIEVDSMMRYIARL--YALNTSQ 204
           GD +N+EVD + R++ RL  YA + +Q
Sbjct: 176 GDTVNLEVDLIARHLERLMSYAGDKAQ 202


>gi|119472107|ref|ZP_01614338.1| riboflavin synthase subunit alpha [Alteromonadales bacterium TW-7]
 gi|119445127|gb|EAW26420.1| riboflavin synthase subunit alpha [Alteromonadales bacterium TW-7]
          Length = 217

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI  +      + +R+ ++  + S +KLG SIA  G+CLTVV   ++H V
Sbjct: 1   MFTGIIEATGKIALLQKKQGDLAIRIQSADLDMSDVKLGDSIATNGVCLTVV---DKH-V 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  ++  ET  +T  A + IG  +NLE++++   RL GHLVSGH+DG   I  +   
Sbjct: 57  DG-FSADLSNETIHLTGFAHYSIGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITAITAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   +L ++I  KGSVC++G+SLTVN V  N F + ++ HT  +TT    KV
Sbjct: 116 ARATEYWLTTDESLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSGQTTIADFKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTQVNLEVDQIARYLERL 193


>gi|226942826|ref|YP_002797899.1| riboflavin synthase subunit alpha [Azotobacter vinelandii DJ]
 gi|226717753|gb|ACO76924.1| riboflavin synthase, alpha subunit [Azotobacter vinelandii DJ]
          Length = 219

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP     R+ V T   + S +KLG SIA  GICLT V L      
Sbjct: 1   MFTGIIEAIGTIRALTPKGGDARVYVHTGKLDLSDVKLGDSIAVNGICLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRETLARTAFIDLKAGSRVNLEKALTPTSRLGGHLVSGHVDGVGEVLSREDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA+KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFRIHAPRELARYIALKGSITVDGTSLTVNGVNGAEFELTIVPHTLGETIMADYRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRQVNLEVDLLARYLERL 193


>gi|229524272|ref|ZP_04413677.1| riboflavin synthase alpha chain [Vibrio cholerae bv. albensis
           VL426]
 gi|229337853|gb|EEO02870.1| riboflavin synthase alpha chain [Vibrio cholerae bv. albensis
           VL426]
          Length = 227

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   +   +KLG SIA  G+CLTVV   +    
Sbjct: 11  MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 68

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 69  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 125

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 126 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 185

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 186 GRRVNLEVDVLARYMERL 203


>gi|258620987|ref|ZP_05716021.1| Riboflavin synthase alpha chain [Vibrio mimicus VM573]
 gi|258586375|gb|EEW11090.1| Riboflavin synthase alpha chain [Vibrio mimicus VM573]
          Length = 217

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|302343808|ref|YP_003808337.1| riboflavin synthase, subunit alpha [Desulfarculus baarsii DSM 2075]
 gi|301640421|gb|ADK85743.1| riboflavin synthase, alpha subunit [Desulfarculus baarsii DSM 2075]
          Length = 219

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 116/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G I  +        LR+   ++ ++  LG SIA  G CLTV  L       
Sbjct: 1   MFTGLVEGLGAIGRIERKGPDAVLRIRPPWDAARTVLGESIAVLGACLTVTGLG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++V+V AE+   T +     G  +NLER+++LGDRL GHLVSGH+D    +  +   G
Sbjct: 56  DGFDVDVSAESLARTKLGGLRAGDAVNLERAMQLGDRLGGHLVSGHVDCLGRVTLIAPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S +  +++P    + +  KGSV ++GVSLTVN V  + F + +I HT  ETT  + + G
Sbjct: 116 GSQHLEIAIPAEHMRLVVEKGSVTVDGVSLTVNQVWDDRFALNIIPHTWRETTLSLLRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+ARL   + + 
Sbjct: 176 DVVNIETDLIGKYVARLMGRDAAP 199


>gi|327484785|gb|AEA79192.1| Riboflavin synthase alpha chain [Vibrio cholerae LMA3894-4]
          Length = 217

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+EVD + RY+ RL  + 
Sbjct: 176 GRRVNLEVDVLARYMERLLQVQ 197


>gi|292492825|ref|YP_003528264.1| riboflavin synthase, subunit alpha [Nitrosococcus halophilus Nc4]
 gi|291581420|gb|ADE15877.1| riboflavin synthase, alpha subunit [Nitrosococcus halophilus Nc4]
          Length = 218

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G ++A+        LR+ +   + +++ +G SIA +G+CLTV RL+     
Sbjct: 1   MFTGIIRAVGTVVALQRKGSEAALRIDSGKLDLAEVGIGDSIAVSGVCLTVARLA----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +  ++ +V  ET   T +     G  +NLE ++ L D L GHL SGH DG   ++    +
Sbjct: 56  NQVFDFDVSQETLSRTVLGKLQPGEGVNLEPALTLKDHLGGHLTSGHCDGVGRVVERTSV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S+   +  P  L ++IA KGS+ ++GVSLTVN V  N F+V +I HT++ TT   ++ 
Sbjct: 116 GESVRFSIRAPAGLAKYIAEKGSIGVDGVSLTVNGVKGNLFEVNIIPHTLQATTLNEYRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GREVNLEVDLLARYLERL 193


>gi|146281222|ref|YP_001171375.1| riboflavin synthase subunit alpha [Pseudomonas stutzeri A1501]
 gi|145569427|gb|ABP78533.1| riboflavin synthase, alpha subunit [Pseudomonas stutzeri A1501]
 gi|327479376|gb|AEA82686.1| riboflavin synthase subunit alpha [Pseudomonas stutzeri DSM 4166]
          Length = 220

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAIGTIRALTPKGGDVRVLVETGKLDLGDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  E++  +  
Sbjct: 56  GNGFWADVSRETLARTAFIDLKAGSRVNLEKALTPTSRLGGHLVSGHVDGVGEVVAREDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA+KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFRIRAPRELAKYIALKGSITVDGTSLTVNAVNGAEFELTIVPHTLGETIMADYRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRQVNLEVDLLARYLERL 193


>gi|237809264|ref|YP_002893704.1| riboflavin synthase, alpha subunit [Tolumonas auensis DSM 9187]
 gi|237501525|gb|ACQ94118.1| riboflavin synthase, alpha subunit [Tolumonas auensis DSM 9187]
          Length = 219

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+ P  + + +RV +   + S +KLG SIA  G+CLTVV L+     
Sbjct: 1   MFTGIIEAVGTLAALQPKGEDISVRVKSGKLDLSDVKLGDSIATNGVCLTVVELT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++  ET + ++   +  G  +NLER++    RL GHLVSGH+DG  EI+ +  +
Sbjct: 56  GDGYVADLSLETLQRSSFVYYQAGQKVNLERALTPDTRLGGHLVSGHVDGVGEIVSVKPL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G +    +  P  L ++IA KGS+ ++G+SLTVN +    F + ++ HT  ETT    + 
Sbjct: 116 GRAKEYWIKAPDELAKYIAEKGSITVDGISLTVNAIDGARFKLTIVPHTSGETTVDEWQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GVKVNLEVDVIARYLERL 193


>gi|88811148|ref|ZP_01126404.1| riboflavin synthase subunit alpha [Nitrococcus mobilis Nb-231]
 gi|88791687|gb|EAR22798.1| riboflavin synthase subunit alpha [Nitrococcus mobilis Nb-231]
          Length = 206

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 111/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G +   +P  +  RL +     +++ ++ G S+A  G CLT+V        
Sbjct: 1   MFTGIVQAVGTVRQASPYGQDRRLLIEPGDLDSNGLQPGDSLAVDGCCLTLV-----SKA 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + + V+V AET   T +     G  +NLE ++ L   L GHLVSGH+DG  E+L+    
Sbjct: 56  ADGFVVDVSAETLSRTTLGDLTAGNQVNLEPALTLSSALGGHLVSGHVDGVAELLWRSPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      L  P  L ++IA KGS+CL GVSLTVN V    F+V L+ HT++ TT    + 
Sbjct: 116 GRCERWCLRGPQRLARYIAEKGSICLAGVSLTVNAVAGAEFEVALVPHTLQVTTLGTRRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G+ +N+E+D + RY+ RL
Sbjct: 176 GECMNLEIDLVARYLERL 193


>gi|308272934|emb|CBX29538.1| Riboflavin synthase alpha chain [uncultured Desulfobacterium sp.]
          Length = 221

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 116/203 (57%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I ++    + G RL V T  N    ++G SIA  G CLTVV +  +   
Sbjct: 1   MFTGIIESLGTISSIRSSGRIGKRLAVETDINLDGTEIGDSIAVNGACLTVVEIERKR-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++V+V  ET   T + +   G   N+ER+++L DRLDGHLVSGHIDG  +I      
Sbjct: 59  ---FDVDVSPETLDKTILGNAKTGDRANIERALRLSDRLDGHLVSGHIDGIGKISRKKLT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+++     +P ++ ++I  KGSV ++GVSLTVN   + +F+V +I HT + TT  +   
Sbjct: 116 GNALIITFEVPVSVSRYIIKKGSVAVDGVSLTVNNCDEGWFEVSIIPHTAKLTTMGLKVE 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
            D +NIE D + +YI R     T
Sbjct: 176 NDPVNIETDMIGKYIERFVGSQT 198


>gi|159897833|ref|YP_001544080.1| riboflavin synthase subunit alpha [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890872|gb|ABX03952.1| riboflavin synthase, alpha subunit [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 216

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 113/195 (57%), Gaps = 6/195 (3%)

Query: 1   MFTGIVTDIGKI-IAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV +IG I +A T + +   LR+  +  TS  +LG SIA  G+CLTV   + +   
Sbjct: 14  MFTGIVEEIGTILVANTGLERDNTLRIGCTLATSDAQLGDSIAVNGVCLTVTAFAAD--- 70

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W+EV +  ET R TN+    +G+ +NLER++  G R+ GH V GH+DGT EI+ ++  
Sbjct: 71  --WFEVGLAPETLRRTNLGQLKVGSSVNLERALAAGRRMGGHYVQGHVDGTGEIIAIEPD 128

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    + +   L ++I  KG + ++G SLT+     + F + +I HT         +V
Sbjct: 129 GESKAITIRVAPALMRYIVEKGFIAVDGTSLTITRTTDDSFGLAIIAHTQAWAIIGQQQV 188

Query: 180 GDLINIEVDSMMRYI 194
           GD +NIEVD + +Y+
Sbjct: 189 GDTVNIEVDILAKYV 203


>gi|295136446|ref|YP_003587122.1| riboflavin synthase subunit alpha [Zunongwangia profunda SM-A87]
 gi|294984461|gb|ADF54926.1| riboflavin synthase subunit alpha [Zunongwangia profunda SM-A87]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 112/201 (55%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++GKI  +   +  + + +     T ++K+  S++H G+CLTVV +      D
Sbjct: 1   MFTGIVEEVGKIRKLVKESTNLHIEIEAKM-TPELKIDQSVSHNGVCLTVVSIK-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET   TN+     G  +NLER +KLGDRLDGH+V GH+D T +   +  I 
Sbjct: 55  HQYTVTAIQETLNKTNLNGLVEGDSVNLERGMKLGDRLDGHIVQGHVDQTAKCTDVQDID 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +L      KGS+ +NGVSLTV   G+N F V +I +T E TT+K  + G
Sbjct: 115 GSWQFTFEYDPSLNNITIEKGSITINGVSLTVVNSGRNSFSVAIIPYTFENTTFKQIEKG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+E D + +Y+ R+  L+
Sbjct: 175 STVNLEFDVIGKYVKRITELS 195


>gi|15642268|ref|NP_231901.1| riboflavin synthase subunit alpha [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121586177|ref|ZP_01675968.1| riboflavin synthase, alpha subunit [Vibrio cholerae 2740-80]
 gi|121729761|ref|ZP_01682200.1| riboflavin synthase, alpha subunit [Vibrio cholerae V52]
 gi|147673055|ref|YP_001217784.1| riboflavin synthase subunit alpha [Vibrio cholerae O395]
 gi|153216171|ref|ZP_01950310.1| riboflavin synthase, alpha subunit [Vibrio cholerae 1587]
 gi|153823260|ref|ZP_01975927.1| riboflavin synthase, alpha subunit [Vibrio cholerae B33]
 gi|153828200|ref|ZP_01980867.1| riboflavin synthase, alpha subunit [Vibrio cholerae 623-39]
 gi|227082394|ref|YP_002810945.1| riboflavin synthase, alpha subunit [Vibrio cholerae M66-2]
 gi|229507657|ref|ZP_04397162.1| riboflavin synthase alpha chain [Vibrio cholerae BX 330286]
 gi|229512148|ref|ZP_04401627.1| riboflavin synthase alpha chain [Vibrio cholerae B33]
 gi|229513911|ref|ZP_04403373.1| riboflavin synthase alpha chain [Vibrio cholerae TMA 21]
 gi|229519283|ref|ZP_04408726.1| riboflavin synthase alpha chain [Vibrio cholerae RC9]
 gi|229522215|ref|ZP_04411632.1| riboflavin synthase alpha chain [Vibrio cholerae TM 11079-80]
 gi|229607161|ref|YP_002877809.1| riboflavin synthase subunit alpha [Vibrio cholerae MJ-1236]
 gi|254226774|ref|ZP_04920348.1| riboflavin synthase, alpha subunit [Vibrio cholerae V51]
 gi|254849399|ref|ZP_05238749.1| riboflavin synthase subunit alpha [Vibrio cholerae MO10]
 gi|255747036|ref|ZP_05420981.1| riboflavin synthase alpha chain [Vibrio cholera CIRS 101]
 gi|262161420|ref|ZP_06030530.1| riboflavin synthase alpha chain [Vibrio cholerae INDRE 91/1]
 gi|262168269|ref|ZP_06035966.1| riboflavin synthase alpha chain [Vibrio cholerae RC27]
 gi|262190239|ref|ZP_06048513.1| riboflavin synthase alpha chain [Vibrio cholerae CT 5369-93]
 gi|297580913|ref|ZP_06942838.1| riboflavin synthase [Vibrio cholerae RC385]
 gi|298500356|ref|ZP_07010161.1| riboflavin synthase, alpha subunit [Vibrio cholerae MAK 757]
 gi|9656832|gb|AAF95414.1| riboflavin synthase, alpha subunit [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121549589|gb|EAX59613.1| riboflavin synthase, alpha subunit [Vibrio cholerae 2740-80]
 gi|121628512|gb|EAX60998.1| riboflavin synthase, alpha subunit [Vibrio cholerae V52]
 gi|124114429|gb|EAY33249.1| riboflavin synthase, alpha subunit [Vibrio cholerae 1587]
 gi|125620712|gb|EAZ49072.1| riboflavin synthase, alpha subunit [Vibrio cholerae V51]
 gi|126519221|gb|EAZ76444.1| riboflavin synthase, alpha subunit [Vibrio cholerae B33]
 gi|146314938|gb|ABQ19477.1| riboflavin synthase, alpha subunit [Vibrio cholerae O395]
 gi|148876289|gb|EDL74424.1| riboflavin synthase, alpha subunit [Vibrio cholerae 623-39]
 gi|227010282|gb|ACP06494.1| riboflavin synthase, alpha subunit [Vibrio cholerae M66-2]
 gi|227014166|gb|ACP10376.1| riboflavin synthase, alpha subunit [Vibrio cholerae O395]
 gi|229341140|gb|EEO06145.1| riboflavin synthase alpha chain [Vibrio cholerae TM 11079-80]
 gi|229343972|gb|EEO08947.1| riboflavin synthase alpha chain [Vibrio cholerae RC9]
 gi|229349092|gb|EEO14049.1| riboflavin synthase alpha chain [Vibrio cholerae TMA 21]
 gi|229352113|gb|EEO17054.1| riboflavin synthase alpha chain [Vibrio cholerae B33]
 gi|229355162|gb|EEO20083.1| riboflavin synthase alpha chain [Vibrio cholerae BX 330286]
 gi|229369816|gb|ACQ60239.1| riboflavin synthase alpha chain [Vibrio cholerae MJ-1236]
 gi|254845104|gb|EET23518.1| riboflavin synthase subunit alpha [Vibrio cholerae MO10]
 gi|255735438|gb|EET90838.1| riboflavin synthase alpha chain [Vibrio cholera CIRS 101]
 gi|262023161|gb|EEY41865.1| riboflavin synthase alpha chain [Vibrio cholerae RC27]
 gi|262028731|gb|EEY47385.1| riboflavin synthase alpha chain [Vibrio cholerae INDRE 91/1]
 gi|262033884|gb|EEY52350.1| riboflavin synthase alpha chain [Vibrio cholerae CT 5369-93]
 gi|297534739|gb|EFH73575.1| riboflavin synthase [Vibrio cholerae RC385]
 gi|297541049|gb|EFH77103.1| riboflavin synthase, alpha subunit [Vibrio cholerae MAK 757]
          Length = 217

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|239905103|ref|YP_002951842.1| riboflavin synthase alpha chain [Desulfovibrio magneticus RS-1]
 gi|239794967|dbj|BAH73956.1| riboflavin synthase alpha chain [Desulfovibrio magneticus RS-1]
          Length = 217

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G+I A+       R R+   ++   + LG SIA  G+CLTV     E   D
Sbjct: 1   MFTGLVMGLGRIAAVESRGNETRFRIKALFDLDNIVLGESIAVNGVCLTV-----ETFGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y      ET   +N+    IG  +NLER++ LGDRL GH+VSGH+D   E+  +   G
Sbjct: 56  REYTAYASGETLSRSNLGKLKIGGVVNLERALALGDRLGGHMVSGHVDCLAEVATVTPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            SM  ++  P     F+  KGSV L+G+SLTVN  G+ +  V +I  T   TT    K G
Sbjct: 116 QSMQYKIDFPKEFSIFVVPKGSVALDGISLTVNECGEGWLTVNIIPSTQGATTISGWKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
            +IN+E D + +Y+ R+
Sbjct: 176 TVINMETDVLGKYVLRM 192


>gi|283765814|gb|ADB28299.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765820|gb|ADB28302.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 86/135 (63%)

Query: 15  MTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRI 74
           + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +   W+ VE W E  R+
Sbjct: 6   VQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVKQATAGWFAVEAWEEALRL 65

Query: 75  TNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLE 134
           TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     GD++   L +     
Sbjct: 66  TNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHIDGLAEIIDQKNEGDAIRFYLKVVRQFM 125

Query: 135 QFIAVKGSVCLNGVS 149
            FI  KGS+ LNG S
Sbjct: 126 PFIVNKGSIALNGTS 140


>gi|163854922|ref|YP_001629220.1| riboflavin synthase subunit alpha [Bordetella petrii DSM 12804]
 gi|163258650|emb|CAP40949.1| riboflavin synthase, alpha subunit [Bordetella petrii]
          Length = 209

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 124/209 (59%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTG+V  +G+I+ + P+A     G+RL +         + +G SIA  G C+TVV L +
Sbjct: 1   MFTGLVAAVGRIVRVKPLADAAQGGVRLHIDAGELGLGDVGIGDSIAVQGACMTVVALDD 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
            H     ++V+V  E+  +T          +NLE+S+++GD++ GHLVSGH+DG   +L 
Sbjct: 61  RH-----FQVDVSRESLNLT--VGLDRAGEVNLEKSLRVGDQIGGHLVSGHVDGLGTVLR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD-----VLLIRHTIE 170
            D +G+S    + +P +L +F+A KGSV +NG+SLTVN V  +  D     + +I HT  
Sbjct: 114 FDNVGESRELAIRVPPHLARFLAYKGSVTVNGISLTVNRV-TDVADGCDISINIIPHTQA 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K GD +N+E+D++ RY+ R+ A
Sbjct: 173 VTTLRNVKPGDRVNLEIDTIARYVERMLA 201


>gi|52080842|ref|YP_079633.1| riboflavin synthase subunit alpha [Bacillus licheniformis ATCC
           14580]
 gi|52786213|ref|YP_092042.1| riboflavin synthase subunit alpha [Bacillus licheniformis ATCC
           14580]
 gi|319645200|ref|ZP_07999433.1| RibE protein [Bacillus sp. BT1B_CT2]
 gi|52004053|gb|AAU23995.1| riboflavin synthase (alpha subunit) [Bacillus licheniformis ATCC
           14580]
 gi|52348715|gb|AAU41349.1| RibE [Bacillus licheniformis ATCC 14580]
 gi|317393009|gb|EFV73803.1| RibE protein [Bacillus sp. BT1B_CT2]
          Length = 215

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I+ M      M L + ++     +KLG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGTILDMKKAGSAMSLVIQSNKVIEDVKLGDSIAVNGVCLTVNEFGS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET + T++ +   G+ +NLER++    R  GH+VSGH+DGT  I+ ++   
Sbjct: 56  SSFTADVMLETLKATSLGTLKKGSRVNLERAMAANGRFGGHMVSGHVDGTASIVRIEKAA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L L  +L + + +KGS+ ++GVSLT+  + ++   V LI HT++ET +   KVG
Sbjct: 116 NTVYYDLKLDPSLAKMLVLKGSIAVDGVSLTIFGLTEDQVTVSLIPHTLDETIFPAKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
            ++NIE D + +YI R 
Sbjct: 176 SIVNIECDMIGKYIYRF 192


>gi|149921259|ref|ZP_01909715.1| riboflavin synthase subunit alpha [Plesiocystis pacifica SIR-1]
 gi|149817919|gb|EDM77381.1| riboflavin synthase subunit alpha [Plesiocystis pacifica SIR-1]
          Length = 216

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 115/206 (55%), Gaps = 14/206 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTG+V   G I A+T  ++  RLR+  S       LG S+  +G+CLTV       S  
Sbjct: 11  VFTGLVQSTGVIEAITDASEAKRLRIGASLAEGDRALGASVCVSGVCLTVT-----DSGP 65

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET  +T +    +G+ +NLE S+++GD L GHLVSGH+DG   +  ++  G
Sbjct: 66  DFFTADAAFETLAVTTLGGLTVGSKVNLEPSLRVGDSLGGHLVSGHVDGVGRLRRVEARG 125

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW-----K 175
           D+  C    P  L +++AVKGS+ ++GVSLTVN V    F V LI HT+E TT       
Sbjct: 126 DARECWFWAPEELRRYVAVKGSITVDGVSLTVNAVDDEGFMVGLIPHTLEVTTLGALIDA 185

Query: 176 MHKVGD----LINIEVDSMMRYIARL 197
           +   G+      N+EVD + RY+ RL
Sbjct: 186 LAGAGEGEEPRCNLEVDLLARYVERL 211


>gi|114776394|ref|ZP_01451439.1| riboflavin synthase subunit alpha [Mariprofundus ferrooxydans PV-1]
 gi|114553224|gb|EAU55622.1| riboflavin synthase subunit alpha [Mariprofundus ferrooxydans PV-1]
          Length = 202

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 108/197 (54%), Gaps = 4/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G+I A+    + M ++V ++ +     LG S+A  G CLT+      H   
Sbjct: 1   MFTGIIQDVGRITAIASEPQQMHIQVESTLDMQGWALGDSVAVNGCCLTITAFPSAH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +   +  ET  +T  A   +G  +NLE ++++GD L GH+VSGH+DG   +  +  +G
Sbjct: 58  -HFAATLSQETLDLTCFARAAVGDAVNLEPALRMGDALGGHMVSGHVDGVGTLCSITPVG 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +       LP  L +++ VKGSV ++GVSLTVN V    F V LI HT+  T     K G
Sbjct: 117 EHRVFEFELPVALARYVVVKGSVAVHGVSLTVNSVDGCRFSVNLIPHTLTHTCLGTLKSG 176

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D   RY+ RL
Sbjct: 177 GRVNIETDMYGRYVERL 193


>gi|313889100|ref|ZP_07822756.1| riboflavin synthase, alpha subunit [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312844840|gb|EFR32245.1| riboflavin synthase, alpha subunit [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 214

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 114/194 (58%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGI+ +IG +  +   +    LRV         K+G SIA  G+CLTV  L E+    
Sbjct: 4   IFTGIIEEIGSLSDIKRESDLYSLRVSCKKVLEGTKIGDSIATNGVCLTVTDLGED---- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            +Y+ +V  ET + T   +   G  +NLER++    RLDGH+V GH+DG  EI+ +   G
Sbjct: 60  -FYKADVMVETIKSTTFKNLKRGEKLNLERALSPSKRLDGHIVQGHVDGLGEIISILNHG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           + +  R+    +  ++IA KGS+ L+G+SLTV+ VG+ +F+V +I  TI +T     KVG
Sbjct: 119 NEIVYRIKFDSDNFKYIAPKGSIALDGISLTVSRVGEKYFEVSIIPTTIRDTNLINKKVG 178

Query: 181 DLINIEVDSMMRYI 194
           D+INIE D + RY+
Sbjct: 179 DMINIETDIIGRYV 192


>gi|117618861|ref|YP_857821.1| riboflavin synthase subunit alpha [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560268|gb|ABK37216.1| riboflavin synthase, alpha subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 217

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +    + M L V   + +   +KLG SIA  G+CLTV+ L      
Sbjct: 1   MFTGIIEAVGTLAELRRQGEDMALTVHAPTLDFGDVKLGDSIATNGVCLTVIALG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  Y  +V  ET   T  A+  +G  +NLE+++    RL GHLVSGH+DG  E+      
Sbjct: 56  DKSYTADVSLETLSRTGFATARVGDRVNLEKALMPTSRLGGHLVSGHVDGIGEVKSKSAS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P  L ++IA KGS+ ++G+SLTVN V  + F + ++ HT EETT    K 
Sbjct: 116 GRAIEYWIKAPGELSRYIAEKGSIAVDGISLTVNAVRGDLFRLTIVPHTAEETTIAQWKP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD ++RY+ RL
Sbjct: 176 GYRVNLEVDQIVRYLERL 193


>gi|310657725|ref|YP_003935446.1| riboflavin synthase subunit alpha [Clostridium sticklandii DSM 519]
 gi|308824503|emb|CBH20541.1| riboflavin synthase (alpha subunit) [Clostridium sticklandii]
          Length = 225

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 119/203 (58%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ + G I+ + P +K   + +  S       +G SIA  GICLTV       S D
Sbjct: 1   MFTGLIEETGSILNIRPGSKSTSVSIKASKVLEDANIGDSIAVNGICLTVT----SKSAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET + TN+     G+ +NLER++KLGDRL GH+VSGHID T EI+ +    
Sbjct: 57  N-FTADVMPETIKRTNLHRLTKGSKVNLERALKLGDRLGGHMVSGHIDSTGEIIKITPDE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   + L  NL  +I  KGSV ++G+SLTV  V K  F V +I HT + TT +    G
Sbjct: 116 NAVLIEIGLSENLLPYIIEKGSVSIDGISLTVASVTKRSFIVSVIPHTKKMTTLEKAMPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++NIE D + +YI +++  N++
Sbjct: 176 QMVNIECDMIGKYI-QIFVANSN 197


>gi|226366359|ref|YP_002784142.1| riboflavin synthase subunit alpha [Rhodococcus opacus B4]
 gi|226244849|dbj|BAH55197.1| riboflavin synthase alpha chain [Rhodococcus opacus B4]
          Length = 202

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 115/203 (56%), Gaps = 8/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A   +A   R  V     TS    G SIA  G+CLTVV    E   D
Sbjct: 1   MFTGIVEELGEVVAKEELADAARFTVRGPVVTSDASHGDSIAVNGVCLTVV----EVLAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++    +G+ +NLER+  L  RL GHLV GH+DGT  I+      
Sbjct: 57  GSFTADVMQETLNRSSLEKIDVGSRVNLERAAALNSRLGGHLVQGHVDGTGHIISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
           +    R++LP  + +++  KGS+ ++GVSLTV+ +    G  +F++ LI  T++ TT   
Sbjct: 117 NWEIVRIALPDAISRYVVEKGSITVDGVSLTVSALGGERGAEYFEISLIPTTLQLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
             VG  +N+EVD + +Y+ RL A
Sbjct: 177 ASVGTPVNLEVDVIAKYVERLQA 199


>gi|146293871|ref|YP_001184295.1| riboflavin synthase subunit alpha [Shewanella putrefaciens CN-32]
 gi|145565561|gb|ABP76496.1| riboflavin synthase, alpha subunit [Shewanella putrefaciens CN-32]
 gi|319427243|gb|ADV55317.1| riboflavin synthase, alpha subunit [Shewanella putrefaciens 200]
          Length = 218

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLTDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDKVNIEVDLIARYLERL 193


>gi|329938906|ref|ZP_08288280.1| riboflavin synthase subunit alpha [Streptomyces griseoaurantiacus
           M045]
 gi|329301791|gb|EGG45684.1| riboflavin synthase subunit alpha [Streptomyces griseoaurantiacus
           M045]
          Length = 201

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 114/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV    E    
Sbjct: 1   MFTGIVEELGEVTAVENLGDAARFRLRGPVVTEGAQHGDSIAVNGVCLTVVDHEGEE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER   +G RL GH+V GH+DGT EIL      
Sbjct: 58  --FTADVMAETLTRSSLGALTVGSRVNLERPTAVGARLGGHIVQGHVDGTGEILARTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G+  F V LI  T+  TT    + G
Sbjct: 116 HWEIVKVSLPPDLARYVVEKGSITVDGISLTVVEAGEAHFTVSLIPTTLALTTLGRKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + +Y+ RL   +
Sbjct: 176 DPVNLEVDIVAKYVERLLGAD 196


>gi|312139594|ref|YP_004006930.1| riboflavin synthase alpha chain ribc [Rhodococcus equi 103S]
 gi|311888933|emb|CBH48246.1| riboflavin synthase alpha chain RibC [Rhodococcus equi 103S]
          Length = 203

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 119/202 (58%), Gaps = 8/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A   +A   R  V     TS    G SIA  G+CLTVV + +  +  
Sbjct: 1   MFTGIVEELGEIVAKEDLADAARFTVKGPLVTSDAGHGDSIAVNGVCLTVVDVLDGEA-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ S GIG+ +NLER+  +  RL GH+V GH+DGT E++      
Sbjct: 59  --FTADVMRETLVRSSLGSLGIGSRVNLERAAAVNSRLGGHIVQGHVDGTGEVISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
           +    R+SLP ++ +++  KGS+ ++GVSLTV+ +    G  +F++ LI  T+  TT   
Sbjct: 117 NWTVVRISLPSSISRYVVEKGSITVDGVSLTVSALGGEPGDEYFEISLIPTTLGLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLY 198
            + G  +N+EVD + +Y+ RL+
Sbjct: 177 AEPGTPVNLEVDVIAKYVERLH 198


>gi|262404603|ref|ZP_06081158.1| riboflavin synthase alpha chain [Vibrio sp. RC586]
 gi|262349635|gb|EEY98773.1| riboflavin synthase alpha chain [Vibrio sp. RC586]
          Length = 217

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 120/204 (58%), Gaps = 10/204 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS---YNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +GK+ A+ P  KG  + ++      + + +KLG SIA  G+CLTVV      
Sbjct: 1   MFTGIIEAVGKLTAIIP--KGSDVTIIVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS 58

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+   
Sbjct: 59  -----FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGLGEIVERI 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    
Sbjct: 114 PVGRAVELWVNMPAELNKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTMDEF 173

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
           +VG  +N+EVD + RY+ RL   N
Sbjct: 174 QVGRRVNLEVDVLARYMERLLQGN 197


>gi|218960785|ref|YP_001740560.1| putative riboflavin synthase, alpha subunit [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729442|emb|CAO80353.1| putative riboflavin synthase, alpha subunit [Candidatus Cloacamonas
           acidaminovorans]
          Length = 207

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 105/194 (54%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+    KII + PI+    + +        +K+GCSIA  GICLTVV+       D
Sbjct: 12  MFTGIIEATEKIITLQPISGKKLITISRPAIFDDLKIGCSIACDGICLTVVQFD-----D 66

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET + +   +W  G  +NLER++KL  R+DGH V GHID  + ++      
Sbjct: 67  KAFTVEIMNETLQKSTAKNWTSGKILNLERALKLNSRVDGHFVQGHIDRELRLISHLKRE 126

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + Y  L  P      I  +G++ LNGVSLT+  +  N+F V LI HT+  T     K G
Sbjct: 127 GTDYLHLEFPRQESNLIVPQGAIALNGVSLTIAEIRSNYFSVALIGHTLTHTNLGTIKTG 186

Query: 181 DLINIEVDSMMRYI 194
           + +N+E D + +Y+
Sbjct: 187 EKVNVEYDILGKYV 200


>gi|325676731|ref|ZP_08156405.1| riboflavin synthase subunit alpha [Rhodococcus equi ATCC 33707]
 gi|325552513|gb|EGD22201.1| riboflavin synthase subunit alpha [Rhodococcus equi ATCC 33707]
          Length = 203

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 119/202 (58%), Gaps = 8/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A   +A   R  V     TS    G SIA  G+CLTVV + +  +  
Sbjct: 1   MFTGIVEELGEIVAKEDLADAARFTVKGPLVTSDAGHGDSIAVNGVCLTVVDVLDGEA-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ S GIG+ +NLER+  +  RL GH+V GH+DGT E++      
Sbjct: 59  --FTADVMRETLVRSSLGSLGIGSRVNLERAAAVNSRLGGHIVQGHVDGTGEVISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
           +    R+SLP ++ +++  KGS+ ++GVSLTV+ +    G  +F++ LI  T+  TT   
Sbjct: 117 NWTVVRISLPSSISRYVVEKGSITVDGVSLTVSALCGEPGDEYFEISLIPTTLGLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLY 198
            + G  +N+EVD + +Y+ RL+
Sbjct: 177 AEPGTPVNLEVDVIAKYVERLH 198


>gi|53720235|ref|YP_109221.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei
           K96243]
 gi|53725939|ref|YP_103714.1| riboflavin synthase subunit alpha [Burkholderia mallei ATCC 23344]
 gi|67643978|ref|ZP_00442721.1| riboflavin synthase, alpha subunit [Burkholderia mallei GB8 horse
           4]
 gi|76809358|ref|YP_334474.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 1710b]
 gi|121599416|ref|YP_992111.1| riboflavin synthase subunit alpha [Burkholderia mallei SAVP1]
 gi|124385681|ref|YP_001028556.1| riboflavin synthase subunit alpha [Burkholderia mallei NCTC 10229]
 gi|126441416|ref|YP_001060026.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 668]
 gi|126450382|ref|YP_001081546.1| riboflavin synthase subunit alpha [Burkholderia mallei NCTC 10247]
 gi|126454751|ref|YP_001067305.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 1106a]
 gi|166998346|ref|ZP_02264206.1| riboflavin synthase, alpha subunit [Burkholderia mallei PRL-20]
 gi|167720795|ref|ZP_02404031.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei DM98]
 gi|167739779|ref|ZP_02412553.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 14]
 gi|167817000|ref|ZP_02448680.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 91]
 gi|167825411|ref|ZP_02456882.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 9]
 gi|167846902|ref|ZP_02472410.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei B7210]
 gi|167895479|ref|ZP_02482881.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 7894]
 gi|167903862|ref|ZP_02491067.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei NCTC
           13177]
 gi|167912129|ref|ZP_02499220.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei 112]
 gi|167920102|ref|ZP_02507193.1| riboflavin synthase subunit alpha [Burkholderia pseudomallei
           BCC215]
 gi|217421220|ref|ZP_03452725.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 576]
 gi|226193860|ref|ZP_03789462.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237813428|ref|YP_002897879.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           MSHR346]
 gi|242317820|ref|ZP_04816836.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           1106b]
 gi|254175430|ref|ZP_04882090.1| riboflavin synthase, alpha subunit [Burkholderia mallei ATCC 10399]
 gi|254180982|ref|ZP_04887580.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 1655]
 gi|254191827|ref|ZP_04898330.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254196063|ref|ZP_04902488.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei S13]
 gi|254202413|ref|ZP_04908776.1| riboflavin synthase, alpha subunit [Burkholderia mallei FMH]
 gi|254207744|ref|ZP_04914094.1| riboflavin synthase, alpha subunit [Burkholderia mallei JHU]
 gi|254260624|ref|ZP_04951678.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           1710a]
 gi|254298895|ref|ZP_04966345.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 406e]
 gi|254356355|ref|ZP_04972631.1| riboflavin synthase, alpha subunit [Burkholderia mallei 2002721280]
 gi|52210649|emb|CAH36633.1| riboflavin synthase alpha chain [Burkholderia pseudomallei K96243]
 gi|52429362|gb|AAU49955.1| riboflavin synthase, alpha subunit [Burkholderia mallei ATCC 23344]
 gi|76578811|gb|ABA48286.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           1710b]
 gi|121228226|gb|ABM50744.1| riboflavin synthase, alpha subunit [Burkholderia mallei SAVP1]
 gi|124293701|gb|ABN02970.1| riboflavin synthase, alpha subunit [Burkholderia mallei NCTC 10229]
 gi|126220909|gb|ABN84415.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 668]
 gi|126228393|gb|ABN91933.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           1106a]
 gi|126243252|gb|ABO06345.1| riboflavin synthase, alpha subunit [Burkholderia mallei NCTC 10247]
 gi|147746660|gb|EDK53737.1| riboflavin synthase, alpha subunit [Burkholderia mallei FMH]
 gi|147751638|gb|EDK58705.1| riboflavin synthase, alpha subunit [Burkholderia mallei JHU]
 gi|148025352|gb|EDK83506.1| riboflavin synthase, alpha subunit [Burkholderia mallei 2002721280]
 gi|157808996|gb|EDO86166.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 406e]
 gi|157939498|gb|EDO95168.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696474|gb|EDP86444.1| riboflavin synthase, alpha subunit [Burkholderia mallei ATCC 10399]
 gi|169652807|gb|EDS85500.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei S13]
 gi|184211521|gb|EDU08564.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 1655]
 gi|217396632|gb|EEC36649.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 576]
 gi|225934165|gb|EEH30150.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504376|gb|ACQ96694.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238525454|gb|EEP88882.1| riboflavin synthase, alpha subunit [Burkholderia mallei GB8 horse
           4]
 gi|242141059|gb|EES27461.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           1106b]
 gi|243065415|gb|EES47601.1| riboflavin synthase, alpha subunit [Burkholderia mallei PRL-20]
 gi|254219313|gb|EET08697.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei
           1710a]
          Length = 204

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 121/207 (58%), Gaps = 18/207 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I A+TPIA     G+RL +     + + + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIEAITPIAASPDAGVRLTLRAGGLDLADVALGDSIAIQGACMTVVAKTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           +      ++VEV  E+ NR   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  D-----TFDVEVSRESLNRTVGLAEPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRVLAPRELGRYLAYKGSITVNGVSLTVNSVDDRDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARL 197
            TT +    G  +N+E+D + RY+ R+
Sbjct: 173 VTTLRHLTAGAKVNLEIDMIARYVERM 199


>gi|219668834|ref|YP_002459269.1| riboflavin synthase subunit alpha [Desulfitobacterium hafniense
           DCB-2]
 gi|219539094|gb|ACL20833.1| riboflavin synthase, alpha subunit [Desulfitobacterium hafniense
           DCB-2]
          Length = 214

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +  +    +L +  +      ++G SIA  GICLTVV++       
Sbjct: 1   MFTGIIEELGKVTDLKVLPDSAQLTLEGTKVLESTQIGDSIAVNGICLTVVKMQ-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V AET   TN+     GT +NLER+++L  RL GHLVSGH+DG   I  +  +G
Sbjct: 56  NLFTVDVMAETLHKTNLKECSRGTQVNLERALQLSTRLGGHLVSGHVDGVGTIQKITPVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     L  ++  KGS+ ++G+SLTV  +    F V LI HT +ETT     VG
Sbjct: 116 IARVFTIKATPELLNYVLPKGSIAIDGISLTVVELLPQAFTVSLIPHTRQETTLGFKGVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E D + +Y+AR 
Sbjct: 176 DVVNLETDLIGKYVARF 192


>gi|258546001|ref|ZP_05706235.1| riboflavin synthase, alpha subunit [Cardiobacterium hominis ATCC
           15826]
 gi|258518730|gb|EEV87589.1| riboflavin synthase, alpha subunit [Cardiobacterium hominis ATCC
           15826]
          Length = 214

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 111/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G +           L + + +++ S+  LG SIA  G+CLT V L+  HS 
Sbjct: 1   MFTGIIETTGSLQRRDDHGDDCTLTIASDTFDFSRCALGDSIAVNGVCLTAVALTP-HS- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET R+T + S   G  +NLE ++ L   L GHLVSGH+DG  E+L  +  
Sbjct: 59  ---FSADVSHETLRLTTLGSLQSGDAVNLEYALTLATPLGGHLVSGHVDGVGELLAREAD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S     + P  L ++IA KGS+ +NGVSLTVN V  N F V ++ HT+  TT    + 
Sbjct: 116 ARSERLTFAAPAPLARYIAAKGSITINGVSLTVNTVDANRFSVNIVPHTMSRTTLGALQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + RY+ RL
Sbjct: 176 GDAVNLEVDLVARYLERL 193


>gi|163754504|ref|ZP_02161626.1| riboflavin synthase, alpha subunit [Kordia algicida OT-1]
 gi|161325445|gb|EDP96772.1| riboflavin synthase, alpha subunit [Kordia algicida OT-1]
          Length = 198

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 114/200 (57%), Gaps = 4/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I  +    + + + V +   T+++K+  S+AH G+CLTVV   + +  +
Sbjct: 1   MFTGIIEELGVITHLEREKENLHITVQSGL-TNELKIDQSVAHNGVCLTVV---DRNLDE 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   TN+ +W +   +NLER++KLGDRLDGH+V GH+D       ++   
Sbjct: 57  NTYVVTAIQETLDKTNVGNWQVNDRVNLERAMKLGDRLDGHIVQGHVDQVATCTSVEESN 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S Y       +L      KGS+ +NG SLTV    +N F V +I +T   T ++  KVG
Sbjct: 117 GSWYYTFEYDSSLNNITIEKGSITVNGTSLTVVNSERNSFSVAIIPYTYSHTVFQYMKVG 176

Query: 181 DLINIEVDSMMRYIARLYAL 200
            ++N+E D + +Y+ARL  L
Sbjct: 177 SIVNLEFDVIGKYVARLQGL 196


>gi|332141885|ref|YP_004427623.1| riboflavin synthase subunit alpha [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551907|gb|AEA98625.1| riboflavin synthase subunit alpha [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 220

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +      +RL V + + + S + LG SIA  G+CLTV  +  +   
Sbjct: 1   MFTGIIQALGTIKKLDNRGNDIRLTVSSPTLDMSDVALGDSIATNGVCLTVTDMGAD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             +Y  +V AET ++T  A +  G+ +NLE++++  DR  GH+VSGH+DG  E+  +   
Sbjct: 58  --YYCADVSAETIKLTGFAHYSAGSTVNLEKAMRPTDRFGGHIVSGHVDGVGEVTQIIKH 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D +   +  P  + ++IA KGS+ ++G+SLTVN V    F + +I HT++ET    +KV
Sbjct: 116 SDYVEFWVKAPEAIAKYIAHKGSITVDGISLTVNEVNGAEFMLWIIPHTLQETIMGSYKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTAVNLEVDVIARYLERL 193


>gi|88704436|ref|ZP_01102150.1| riboflavin synthase alpha chain [Congregibacter litoralis KT71]
 gi|88701487|gb|EAQ98592.1| riboflavin synthase alpha chain [Congregibacter litoralis KT71]
          Length = 221

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +RLR+ T   +   + +G SIA  G+CLTV  L  +   
Sbjct: 1   MFTGIIQAVGTVAAQQPSGGDLRLRIHTGKLSLDDVGIGDSIATNGVCLTVTELPGD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET  +T + +   G+ +NLE+S+    RL GH+VSGH+DG  EI+ +   
Sbjct: 58  --GFWADVSRETLNLTTLGNLSQGSPVNLEKSLTPQSRLGGHIVSGHVDGLGEIVSMVED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++IA KGS+C++G SLTVN V    FD+ +I  T+ ET ++ +  
Sbjct: 116 ARSWRVVVRAPDALAKYIAHKGSICIDGTSLTVNAVDGACFDLNIIPQTMTETVFEHYSP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSPVNLEVDVIARYLERL 193


>gi|297198284|ref|ZP_06915681.1| riboflavin synthase, alpha subunit [Streptomyces sviceus ATCC
           29083]
 gi|297147048|gb|EDY59571.2| riboflavin synthase, alpha subunit [Streptomyces sviceus ATCC
           29083]
          Length = 211

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 119/199 (59%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I A+  +    R R+     T   K G SIA  G+CLTVV    +H  D
Sbjct: 11  VFTGIVEELGEITAVENLGDACRFRLRGPVVTEGAKHGDSIAVNGVCLTVV----DHEGD 66

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ + G+G+ +NLER   +G RL GH+V GH+DGT E+L      
Sbjct: 67  E-FTADVMAETLDRSSLGALGVGSRVNLERPTAVGARLGGHIVQGHVDGTGEVLERKPSE 125

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 126 NWEIIKISLPADLSRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGLKQPG 185

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ RL A
Sbjct: 186 APVNLEVDVVAKYVERLLA 204


>gi|70732822|ref|YP_262589.1| riboflavin synthase subunit alpha [Pseudomonas fluorescens Pf-5]
 gi|68347121|gb|AAY94727.1| riboflavin synthase, alpha subunit [Pseudomonas fluorescens Pf-5]
          Length = 220

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + + +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLADVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  E++  +  
Sbjct: 56  GDGFWADVSRETLDCTAFHQLKAGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVVAREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRIRAPKELAKYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLAETIMADYRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRQVNLEVDLLARYLERL 193


>gi|104779849|ref|YP_606347.1| riboflavin synthase subunit alpha [Pseudomonas entomophila L48]
 gi|95108836|emb|CAK13532.1| riboflavin synthase alpha chain [Pseudomonas entomophila L48]
          Length = 221

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I +MTP    +R+ V T   +   +KLG SIA  G+CLT V L  +   
Sbjct: 1   MFTGIIESIGTIRSMTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVELPGDGF- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W +V V  ET + T +     G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 60  --WADVSV--ETLKRTAMVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVDGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|153001670|ref|YP_001367351.1| riboflavin synthase subunit alpha [Shewanella baltica OS185]
 gi|151366288|gb|ABS09288.1| riboflavin synthase, alpha subunit [Shewanella baltica OS185]
          Length = 218

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAIGTLRKLERKGDDIRLTVASGKLDLNDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIAMVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDKVNIEVDLIARYLERL 193


>gi|295839978|ref|ZP_06826911.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB74]
 gi|295827730|gb|EFG65560.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB74]
          Length = 203

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 119/206 (57%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV     H   
Sbjct: 1   MFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVV----AHE-G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GHLV GH+DGT  IL  +   
Sbjct: 56  TEFTADVMAETLQRSSLGALAPGSRVNLERPTPVGGRLGGHLVQGHVDGTGTILRREPSA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV   G++ F V LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEAGEDSFSVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARL--YALNTSQ 204
             +N+EVD + +Y+ R+  + +N ++
Sbjct: 176 APVNLEVDVLAKYVERMLRHGVNPTE 201


>gi|258405544|ref|YP_003198286.1| riboflavin synthase subunit alpha [Desulfohalobium retbaense DSM
           5692]
 gi|257797771|gb|ACV68708.1| riboflavin synthase, alpha subunit [Desulfohalobium retbaense DSM
           5692]
          Length = 220

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G + A+       RLR+   ++ +  + G SIA  G+CLTV          
Sbjct: 1   MFTGLILGVGTVSALDKKGDESRLRIRPHFSLTDCEYGESIAVNGVCLTVETFGR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V   AET R +N+     G  +NLER++ +GDRL GHLVSGH+D    I  +   G
Sbjct: 56  DWFTVYASAETLRRSNLGGLRPGDAVNLERALAVGDRLGGHLVSGHVDCLARIEQITAAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    L  P     F+  KGSVCL+G+SLTVN        V +I  T +ETT    +VG
Sbjct: 116 QSTAYTLGFPKQWGPFVVDKGSVCLDGISLTVNACTPTTLAVNIIPTTRKETTIASWQVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ ++ A
Sbjct: 176 SQVNMEVDIIGKYVQKMVA 194


>gi|262274778|ref|ZP_06052589.1| riboflavin synthase alpha chain [Grimontia hollisae CIP 101886]
 gi|262221341|gb|EEY72655.1| riboflavin synthase alpha chain [Grimontia hollisae CIP 101886]
          Length = 220

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +TP    + L V +   + S +KLG SIA  G+CLTVV L+     
Sbjct: 1   MFTGIIEAVGHIQKITPKGGDISLTVDSGKLDLSDVKLGDSIATNGVCLTVVALT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++  ET + T  A++  G  +NLE+++    R  GH+VSGH+DG   ++     
Sbjct: 56  GSGYVADLSGETLKRTAFATYKAGHRVNLEKAMLPTTRFGGHMVSGHVDGVATVVSRTQA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L  P  L +++A KGSV ++G+SLT+N V  N F + ++ HT  ETT +   V
Sbjct: 116 GRAIEFWLEAPAGLAKYLAEKGSVTIDGISLTINAVDGNRFKLTIVPHTALETTIEGFSV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +NIEVD + RY+ RL
Sbjct: 176 GHQVNIEVDVIARYLERL 193


>gi|182415673|ref|YP_001820739.1| riboflavin synthase, alpha subunit [Opitutus terrae PB90-1]
 gi|177842887|gb|ACB77139.1| riboflavin synthase, alpha subunit [Opitutus terrae PB90-1]
          Length = 198

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 110/202 (54%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK++  TP  +  RL++        + LG SIA  G CLTV  ++      
Sbjct: 1   MFTGIVEETGKVVGFTPEREAWRLQIEARAALGGVALGDSIAVNGCCLTVAGVA-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +  + +V  ET R+TN A    G  +NLERS++   ++ GH V+GHIDG   I  L+  G
Sbjct: 56  SVLQFDVLEETRRLTNFAMLAPGAPVNLERSLRFDGKVGGHFVTGHIDGLGVIELLEPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
              Y ++  P +   ++  KGS+ ++G+SLTV  V    FDV LI  T+  T     K G
Sbjct: 116 KDHYLKVRAPDDCAHYLVHKGSIAIDGISLTVAAVDGPVFDVWLIPTTMTVTNLGARKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           + +N+E D + +Y+ +L A  +
Sbjct: 176 EAVNLEFDLLGKYVEKLLAARS 197


>gi|221632528|ref|YP_002521749.1| riboflavin synthase subunit alpha [Thermomicrobium roseum DSM 5159]
 gi|221157003|gb|ACM06130.1| riboflavin synthase, alpha subunit [Thermomicrobium roseum DSM
           5159]
          Length = 222

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV +IG+++A+ P++ G +RLR+         +LG SIA  G+CLTV  L+     
Sbjct: 2   MFTGIVEEIGRVLAIQPVSGGGLRLRIGCRTVVEGTRLGDSIAVDGVCLTVTDLA----- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++VE+   T R + +    +G  +NLER++ +G R  GH V GH+D    I+ +   
Sbjct: 57  PDSFQVELQPVTVRRSTLGRIAVGDLVNLERALPVGGRFGGHYVQGHVDTVGRIVMMYRD 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++  R++ P    +++  +G + ++G SLTV     + F+V L+ +T E  T    + 
Sbjct: 117 GAALIVRIAAPAEAMRYVVERGFIAVDGASLTVQRRFPSEFEVSLVAYTQEHITLPRKRP 176

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G L+N+EVD + +Y+ +  AL  S
Sbjct: 177 GALVNLEVDIIAKYVEQFLALGAS 200


>gi|297195568|ref|ZP_06912966.1| riboflavin synthase subunit alpha [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721391|gb|EDY65299.1| riboflavin synthase subunit alpha [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 202

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEVTAVEDLGDASRFRLRGPLVTEDAKHGDSIAVNGVCLTVVETG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++     G+ +NLER   +G RL GH+V GH+DGT  ++      
Sbjct: 56  GEFTADVMAETLKRSSLGVLRAGSRVNLERPTAVGARLGGHIVQGHVDGTGTVVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP  L +++  KGS+ ++GVSLTV   G + F + LI  T+  TT  + + G
Sbjct: 116 NWEIVKISLPSGLARYVVEKGSITVDGVSLTVVDAGTDHFTISLIPTTLALTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL      +
Sbjct: 176 DPVNLEVDIIAKYVERLLGTQAEE 199


>gi|330812013|ref|YP_004356475.1| riboflavin synthase subunit alpha [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380121|gb|AEA71471.1| riboflavin synthase alpha chain [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 225

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T +     G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFLADVSRETLDCTAMNDLKGGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVSRTDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F + +I HT+ ET    ++ 
Sbjct: 116 ARAVEFRIRAPKELAKYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|262170763|ref|ZP_06038441.1| riboflavin synthase alpha chain [Vibrio mimicus MB-451]
 gi|261891839|gb|EEY37825.1| riboflavin synthase alpha chain [Vibrio mimicus MB-451]
          Length = 217

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  + + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFSQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELNKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+EVD + RY+ RL   N
Sbjct: 176 GRRVNLEVDVLARYMERLLQGN 197


>gi|330888053|gb|EGH20714.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 220

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  ++  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFKVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|307825580|ref|ZP_07655798.1| riboflavin synthase, alpha subunit [Methylobacter tundripaludum
           SV96]
 gi|307733466|gb|EFO04325.1| riboflavin synthase, alpha subunit [Methylobacter tundripaludum
           SV96]
          Length = 218

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GKI A+   +   RL + T     + + LG SIA  G+CLT V L ++   
Sbjct: 1   MFTGIILAVGKISAIERKSGDCRLTIATGKLPLNDVVLGDSIAVNGVCLTAVELGKD--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             ++  +V  ET   T + +  +GT +NLE ++    RL GH+VSGH+DG   ++     
Sbjct: 58  --YFCADVSNETLSRTLLNAATVGTPVNLELALTPTTRLGGHIVSGHVDGIGTVMEKRAD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   +   P NL ++IA KGS+C+NG+SLTVN V    F V ++ HT++ETT     V
Sbjct: 116 GRSFRFKFKAPDNLAKYIAEKGSICINGISLTVNDVDGAVFSVNIVPHTLKETTLGDAVV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTKVNLEVDLLARYLERL 193


>gi|257055602|ref|YP_003133434.1| riboflavin synthase, alpha subunit [Saccharomonospora viridis DSM
           43017]
 gi|256585474|gb|ACU96607.1| riboflavin synthase, alpha subunit [Saccharomonospora viridis DSM
           43017]
          Length = 208

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 113/201 (56%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  + P A+  RL V     T   + G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTRVEPNAEATRLTVRGPVVTQDARHGDSIAVNGVCLTVV-----DTTD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET + T++     G  +NLER++    R  GH+V GH+DGT   L  D  G
Sbjct: 56  DEFTVDVVPETLQRTSLNGIEPGRLVNLERAMSADGRFGGHVVQGHVDGTGTFLSRDHDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  + P +L +++  KGS+ ++GVSLTV  V    F V LI  T+  TT   ++ G
Sbjct: 116 ---LAHFAYPPSLSRYLVEKGSIAVDGVSLTVARVTDQEFAVALIPTTLRATTLGRNQPG 172

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + +Y+ +L A++
Sbjct: 173 DSVNLEVDVLAKYVEKLAAVH 193


>gi|295131276|ref|YP_003581939.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK137]
 gi|291375341|gb|ADD99195.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK137]
          Length = 199

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 108/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 1   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +   G G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 58  --FGCDVMAETLNRTALGGLGPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 116 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 176 DEVNVEVDIIAKYLEAL 192


>gi|209694492|ref|YP_002262420.1| riboflavin synthase subunit alpha [Aliivibrio salmonicida LFI1238]
 gi|208008443|emb|CAQ78608.1| riboflavin synthase alpha chain [Aliivibrio salmonicida LFI1238]
          Length = 218

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + A+TP  + + + V +   +   +KLG SIA  G+CLTVV +++    
Sbjct: 1   MFTGIIESIGTLQAITPKGEDVSVTVNVGKLDMGDVKLGDSIATNGVCLTVVAMTK---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+D   EI+     
Sbjct: 57  -NSYTADLSLETLKRTGFVHYKAGDKVNLEKAMLPTTRFGGHIVSGHVDAVGEIIERHQT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + LP +L +++  KGS+ ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAVEFWIQLPQDLAKYVVEKGSITIDGISLTVNDLRKNAFKLTIVPHTASETTMDTFTV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ +L
Sbjct: 176 GKKVNLEVDLIARYLEKL 193


>gi|88608601|ref|YP_506720.1| riboflavin synthase subunit alpha [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600770|gb|ABD46238.1| riboflavin synthase, alpha subunit [Neorickettsia sennetsu str.
           Miyayama]
          Length = 200

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 110/198 (55%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF GIV  +G +  +    K + L V        ++LG SIA  G+CLTV  ++     +
Sbjct: 1   MFKGIVQTLGLVTKLIVRDKQIFLAVDAKELAQSVELGSSIACNGVCLTVTSIT-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
              E  V  ET   TN  +   G+ +NLE S+++GD LDGH V GH+D T  I  ++  G
Sbjct: 56  TELEFYVSQETFSRTNFHALEKGSKVNLETSLRIGDTLDGHFVQGHVDETTMITAIEKTG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S     +L   +  FI  KGSVC++G SLTVN V +N F V +I +T  +T +   KVG
Sbjct: 116 ESHVFTFALTEGISPFITYKGSVCIDGTSLTVNEVFENEFSVNIIPYTWSQTIFHSKKVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + RY+ RL+
Sbjct: 176 DKVNVESDLLARYLKRLF 193


>gi|332977387|gb|EGK14165.1| riboflavin synthase subunit alpha [Desmospora sp. 8437]
          Length = 213

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 113/196 (57%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+I +M      MRL +        +++G SIA  G+CLTVV    +    
Sbjct: 1   MFTGLVEEVGRIGSMDREGDAMRLSISCEQVLEGVQVGESIAVNGVCLTVVGFDSDQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+    +G+ +NLER++++GDRL GH V GH+DG   IL      
Sbjct: 58  --FWTDVMPETMNRSNLGQLTLGSPVNLERALRVGDRLGGHFVQGHVDGMGRILARTPRE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+ +P  L +++  +GSV +NG+SLT+  V    F V +I HT+E T  K  + G
Sbjct: 116 NAVLFRIGVPPELTRWMVDQGSVAVNGISLTIVTVEPEAFTVSIIPHTLEHTQLKEAEPG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +NIE D + +Y A+
Sbjct: 176 DSVNIECDMIGKYAAK 191


>gi|254442782|ref|ZP_05056258.1| riboflavin synthase, alpha subunit [Verrucomicrobiae bacterium
           DG1235]
 gi|198257090|gb|EDY81398.1| riboflavin synthase, alpha subunit [Verrucomicrobiae bacterium
           DG1235]
          Length = 203

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 109/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK++A   +    R RV      +++ LG S+A  G CLTVV + E     
Sbjct: 6   MFTGIVEEKGKVVACEELEGSWRYRVAVEVVGAEISLGDSVAVNGCCLTVVEIGE----- 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET R+TN+    +G+ +NLERS++   R+ GH VSGHIDGT  I  L   G
Sbjct: 61  GVLSFDVLEETRRLTNLRDIAVGSSVNLERSLRFDGRVGGHFVSGHIDGTGVIRTLRPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
             +   +  P   E+++  KG + ++G+SLTV  V      + LI HT+E T+     VG
Sbjct: 121 KDVILEIEAPEGFEKYLVYKGCIAIDGMSLTVAEVKGRMVTIWLIPHTLEVTSIGEKGVG 180

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +Y  ++ A
Sbjct: 181 DAVNLEFDLIAKYTEKIVA 199


>gi|302206247|gb|ADL10589.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           C231]
 gi|308276489|gb|ADO26388.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           I19]
          Length = 213

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 118/201 (58%), Gaps = 9/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G ++++ P+   + L +          LG SIA  G+CLTV  + E     
Sbjct: 1   MFSGIVEEVGTVVSLEPLTDSIVLSIAAHKVLEGTSLGDSIAVNGVCLTVTDIQE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++  +V  E+   +++     GT +NLER+++   RLDGH+V GH+DGT E++  D   
Sbjct: 56  GFFSADVMQESLVRSSLGGLTAGTPVNLERALRADGRLDGHIVQGHVDGTAELISKDPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
                R +LP  L +++  KGS+ ++G SLTV+ +G++    +F+V LI  T++ TT   
Sbjct: 116 HWTVLRFTLPKELSRYVVEKGSISVDGTSLTVSGLGESEGNHWFEVSLIPTTLQSTTHGQ 175

Query: 177 HKVGDLINIEVDSMMRYIARL 197
            ++GD +N+EVD + +Y+ R+
Sbjct: 176 CQLGDRVNLEVDVLAKYVERM 196


>gi|269839782|ref|YP_003324475.1| riboflavin synthase, subunit alpha [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791512|gb|ACZ43652.1| riboflavin synthase, alpha subunit [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 201

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 116/197 (58%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV + G+++ +  + + +RLRV         +LG SIA  G+CLTV  L E     
Sbjct: 1   MFSGIVEETGRVLELH-LKEPLRLRVACQRVLEGTQLGDSIAVNGVCLTVDALDE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V +  ET R TN+    +G  +NLERS++   R+ GH V GH+D T  IL     G
Sbjct: 55  GSFTVGLMPETLRRTNLGGLQLGDEVNLERSLRFDGRVGGHFVQGHVDATGTILDRCPDG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +++ ++ LP +L +++  KG + ++GVSLTV    K+ F V L+ HT ++ T    +VG
Sbjct: 115 GALWLKIGLPRDLARYVVPKGCIAVDGVSLTVVDALKDAFTVSLVYHTQQKVTLARKQVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           +L+N+EVD + +Y+ RL
Sbjct: 175 ELVNLEVDMLGKYVERL 191


>gi|121533689|ref|ZP_01665516.1| riboflavin synthase, alpha subunit [Thermosinus carboxydivorans
           Nor1]
 gi|121307680|gb|EAX48595.1| riboflavin synthase, alpha subunit [Thermosinus carboxydivorans
           Nor1]
          Length = 218

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  +   AK +RL V        +K+G SIA  G CLTVV   E     
Sbjct: 1   MFTGLVEELGQVKVVARGAKSIRLTVTARKVLDDVKIGDSIAVNGTCLTVVEFGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+  +V  ET   T +A    G  +NLER+++LGDRL GH+V+GHIDG   I   +   
Sbjct: 56  NWFTADVMPETVARTVLAHLKPGDAVNLERTLRLGDRLGGHIVTGHIDGIGYIQAKERSD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+     + ++I  KGSV ++GVSLTV   G ++F V LI HT   TT  +   G
Sbjct: 116 NAVIVRIGAGPEVMRYIVRKGSVAIDGVSLTVIDYGSDWFTVSLIPHTAAVTTVGLKGTG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ +L
Sbjct: 176 APVNLEADIIGKYVEKL 192


>gi|126175360|ref|YP_001051509.1| riboflavin synthase subunit alpha [Shewanella baltica OS155]
 gi|217972397|ref|YP_002357148.1| riboflavin synthase subunit alpha [Shewanella baltica OS223]
 gi|304410190|ref|ZP_07391809.1| riboflavin synthase, alpha subunit [Shewanella baltica OS183]
 gi|307302099|ref|ZP_07581857.1| riboflavin synthase, alpha subunit [Shewanella baltica BA175]
 gi|125998565|gb|ABN62640.1| riboflavin synthase, alpha subunit [Shewanella baltica OS155]
 gi|217497532|gb|ACK45725.1| riboflavin synthase, alpha subunit [Shewanella baltica OS223]
 gi|304351599|gb|EFM15998.1| riboflavin synthase, alpha subunit [Shewanella baltica OS183]
 gi|306914137|gb|EFN44558.1| riboflavin synthase, alpha subunit [Shewanella baltica BA175]
          Length = 218

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLNDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIAMVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDKVNIEVDLIARYLERL 193


>gi|313793373|gb|EFS41431.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA1]
 gi|327451700|gb|EGE98354.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL092PA1]
          Length = 204

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 108/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD++ +Y+  L
Sbjct: 181 DEVNVEVDTIAKYLEAL 197


>gi|301059429|ref|ZP_07200350.1| riboflavin synthase, alpha subunit [delta proteobacterium NaphS2]
 gi|300446465|gb|EFK10309.1| riboflavin synthase, alpha subunit [delta proteobacterium NaphS2]
          Length = 220

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+   IG I  M  +   M + V+  +  +  KLG S++ +G+CLTV R+      D
Sbjct: 1   MFTGLAEGIGTIKGMRRMQDHMEICVVPLFEMAGCKLGDSVSVSGVCLTVSRME----AD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            +Y ++V  ET   + +     G  +NLER+++L DRL GHLV GH+DG  +I   +   
Sbjct: 57  AFY-MDVSGETLSRSTLGLMKQGDHVNLERALRLMDRLGGHLVLGHVDGLGKITKKEERN 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R+ +P NL ++I  KGS+ ++G+SLT+N     FFDV +I HT  ET      VG
Sbjct: 116 KSWLLRIKIPANLSRYIIEKGSIAVDGISLTINACENEFFDVNIIPHTGTETALLRKNVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           + +NIE D + +Y+ +L     S+
Sbjct: 176 EPVNIETDLIGKYVEKLLLTKPSE 199


>gi|304312169|ref|YP_003811767.1| Riboflavin synthase, alpha subunit [gamma proteobacterium HdN1]
 gi|301797902|emb|CBL46124.1| Riboflavin synthase, alpha subunit [gamma proteobacterium HdN1]
          Length = 219

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +       +L V T   +   ++LG SIA +G+CLTV  L     +
Sbjct: 1   MFTGIIEAVGHISRIDRKGGDWQLTVKTGKLDLGDVRLGDSIAVSGVCLTVTAL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++ +V  ET   T       G+ +NLE+++ L  RL GHLVSGH+DG  E++     
Sbjct: 56  SDGFQADVSNETLACTAFRDLKAGSRVNLEKALTLAARLGGHLVSGHVDGVGEVINRSED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   +  P++L ++IA KGS+C+NGVSLTVN V  + F + +I HT  ETT +  + 
Sbjct: 116 GRSIRLEIRAPNSLARYIAEKGSICVNGVSLTVNSVNGDCFGLNVIPHTAAETTVEEWRT 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GASLNLEVDLIARYLERL 193


>gi|223939369|ref|ZP_03631248.1| riboflavin synthase, alpha subunit [bacterium Ellin514]
 gi|223891973|gb|EEF58455.1| riboflavin synthase, alpha subunit [bacterium Ellin514]
          Length = 218

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 113/202 (55%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSE-EHSV 59
           MFTGIV + G I  + P  K + L V        +KLG S++  G CLTVV++S  +   
Sbjct: 16  MFTGIVEETGTIERIKPSVKSIELVVRAKICARGLKLGESVSVNGCCLTVVKVSAVKKGG 75

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 ++  ET   TN+ S  +G+ +NLER++ +G RL GH V+GHIDGT  I+  +  
Sbjct: 76  GKLVHFDLLQETWNRTNLQSAKVGSLVNLERALAVGARLGGHFVTGHIDGTGRIIRWERS 135

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      ++ P  + +++  KGS+ ++G+SLTV  V K  F + +I HT E T  +   V
Sbjct: 136 GQDHVLEIAAPAEVMRYVIFKGSIAVDGISLTVAQVSKKSFRIWIIPHTFEVTALRERAV 195

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +N+E D + +Y+ +  ++ 
Sbjct: 196 GDAVNLEADLLGKYVHQFVSVR 217


>gi|148264236|ref|YP_001230942.1| riboflavin synthase subunit alpha [Geobacter uraniireducens Rf4]
 gi|146397736|gb|ABQ26369.1| riboflavin synthase, alpha subunit [Geobacter uraniireducens Rf4]
          Length = 215

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GK++ +        L V  ++   ++ LG SIA  G+CLTV +        
Sbjct: 1   MFTGLIEEVGKVVKLEVTGAAGILTVAAAFPQDEVALGDSIAINGVCLTVTQKGA----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + + S   G+ +NLER++ L  RLDGH+VSGH+D    I     I 
Sbjct: 56  GTFGFDVSPETIERSALRSMKNGSPVNLERALPLSGRLDGHIVSGHVDCVATIGDRREIS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      + H   +++A KGSV ++G+SLTVN V ++ F V +I HT   TT K  +VG
Sbjct: 116 GNTVFSFRMAHEYLKYVATKGSVAIDGISLTVNAVAEDGFSVNIIPHTTANTTLKYRQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE D + +Y+ RL
Sbjct: 176 DQVNIETDILAKYVERL 192


>gi|152984636|ref|YP_001346432.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa PA7]
 gi|150959794|gb|ABR81819.1| riboflavin synthase, alpha subunit [Pseudomonas aeruginosa PA7]
          Length = 219

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|153826801|ref|ZP_01979468.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-2]
 gi|149739388|gb|EDM53630.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-2]
          Length = 217

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTICVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|160876408|ref|YP_001555724.1| riboflavin synthase subunit alpha [Shewanella baltica OS195]
 gi|160861930|gb|ABX50464.1| riboflavin synthase, alpha subunit [Shewanella baltica OS195]
 gi|315268598|gb|ADT95451.1| riboflavin synthase, alpha subunit [Shewanella baltica OS678]
          Length = 218

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 118/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +    + +RL V +   + + ++LG SIA  G+CLTVV+      +
Sbjct: 1   MFTGIIEAVGTLRKLERKGEDIRLTVASGKLDLNDVRLGDSIATNGVCLTVVQ-----QL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFAHYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIAMVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDKVNIEVDLIARYLERL 193


>gi|120598058|ref|YP_962632.1| riboflavin synthase subunit alpha [Shewanella sp. W3-18-1]
 gi|120558151|gb|ABM24078.1| riboflavin synthase, alpha subunit [Shewanella sp. W3-18-1]
          Length = 218

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGILRKLERKGDDIRLTVASGKLDLTDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ RL
Sbjct: 176 GDKVNIEVDLIARYLERL 193


>gi|282866176|ref|ZP_06275223.1| riboflavin synthase, alpha subunit [Streptomyces sp. ACTE]
 gi|282558960|gb|EFB64515.1| riboflavin synthase, alpha subunit [Streptomyces sp. ACTE]
          Length = 206

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV L       
Sbjct: 1   MFTGIVEELGEVTAVEKLDDASRFRLRGPVVTEGAKHGDSIAVNGVCLTVVDLD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +   G+ +NLER + LG RL GH+V GH+DGT  I+      
Sbjct: 56  GEFTADVMAETLDRSSLGALTTGSRVNLERPMALGGRLGGHIVQGHVDGTGRIVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++GVSLTV   G + F V LI  T+  TT  +   G
Sbjct: 116 HWELVKVSLPGGLARYVVEKGSITVDGVSLTVVDAGADHFTVSLIPTTLALTTLGIKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+ RL   +++
Sbjct: 176 DPVNLEVDVLAKYVERLLGASSA 198


>gi|146308870|ref|YP_001189335.1| riboflavin synthase subunit alpha [Pseudomonas mendocina ymp]
 gi|145577071|gb|ABP86603.1| riboflavin synthase, alpha subunit [Pseudomonas mendocina ymp]
          Length = 220

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAIGSIRAMTPKGGDVRVYVATGKLDLGDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLARTAFVDLKPGSAVNLEKALTPTSRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFRVRAPRELAKYIAHKGSITVDGTSLTVNAVDGAEFELTIVPHTLAETIMVDYQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|240172787|ref|ZP_04751446.1| riboflavin synthase subunit alpha [Mycobacterium kansasii ATCC
           12478]
          Length = 215

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 115/200 (57%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++IA   +    RL +     TS    G SIA  G+CLTVV    E   D
Sbjct: 1   MFTGIVEELGEVIARDTLTDAARLTIRGPVVTSDAGHGDSIAVNGVCLTVV----EVLPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++    +G+ +NLER+  L  RL GH+V GH+DGT EI+      
Sbjct: 57  GQFTADVMAETLNRSSLGDLRVGSRVNLERAAALNSRLGGHIVQGHVDGTGEIVARTPSQ 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  L ++I  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEVPATLARYIVEKGSITVDGISLTVSGLGAQPRDWFEVSLIPTTRELTTLGSA 176

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  +N+EVD + +Y+ RL
Sbjct: 177 PVGTRVNLEVDVLAKYVERL 196


>gi|145594418|ref|YP_001158715.1| riboflavin synthase subunit alpha [Salinispora tropica CNB-440]
 gi|145303755|gb|ABP54337.1| riboflavin synthase, alpha subunit [Salinispora tropica CNB-440]
          Length = 221

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G++I +T  A+    + +      +  + G SIA  G+CLTVV L+     
Sbjct: 1   MFTGIVEELGEVIHITETAEDSAVVTINGPLVVTDARPGDSIAVNGVCLTVVELA----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET R + +     G  +NLER+  LG RL GHLV GH++G  E+L  +  
Sbjct: 56  GGAFTADVMGETLRRSALGVLRPGDPVNLERAATLGSRLGGHLVQGHVNGIGELLAREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP  L +++  KGS+ ++GVSLTV  +G ++F+V LI  T+  TT    +V
Sbjct: 116 ARWETVRFRLPTALARYVVTKGSITVDGVSLTVASIGPDWFEVGLIPTTLRLTTLGSRRV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +N+EVD + +Y+ RL   + S
Sbjct: 176 GDAVNLEVDVLAKYVERLLGRDQS 199


>gi|255528572|ref|ZP_05395346.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
 gi|296188129|ref|ZP_06856521.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
 gi|255507737|gb|EET84203.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
 gi|296047255|gb|EFG86697.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
          Length = 217

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 118/197 (59%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I++++      ++ +        +KLG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGRILSISKGINSAQINIEAKKVLEDVKLGDSIAVNGVCLTVTSFKH----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +++ +   G+ +NLER++ LGDRL GH+VSGHID T +++ +    
Sbjct: 56  NSFTVDVMPETMRRSSLNNLKKGSLVNLERALALGDRLGGHIVSGHIDCTGKVVNIKNED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +  + +P +  ++I +KGS+ ++GVSLTV  V +  F V LI HT  ETT     +G
Sbjct: 116 IATWITVEVPDDALKYIVLKGSITIDGVSLTVAEVNEKSFSVSLIPHTKGETTLYEKNLG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +NIE D + +Y+ RL
Sbjct: 176 EEVNIECDLIGKYVERL 192


>gi|120437660|ref|YP_863346.1| riboflavin synthase subunit alpha [Gramella forsetii KT0803]
 gi|117579810|emb|CAL68279.1| riboflavin synthase alpha chain [Gramella forsetii KT0803]
          Length = 195

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 111/199 (55%), Gaps = 10/199 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IGKII++T  A  + + V     T ++K+  S++H G+CLTVV +      D
Sbjct: 1   MFTGIVEEIGKIISITKSAGNLDITVKAKM-TPELKIDQSVSHNGVCLTVVSIQ-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   TN+ S   G  +NLER +KLG RLDGH+V GH+D T      + I 
Sbjct: 55  NEYTVTAVNETLEKTNLGSLDKGDQVNLERGMKLGARLDGHIVQGHVDQTATC--KEIIE 112

Query: 121 DSMYCRLSLPHNLE--QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                  +  +N E       KGS+ +NGVSLTV    KN F V +I +T   T +   K
Sbjct: 113 KDGSWEFTFEYNPEIGNITIEKGSITVNGVSLTVVNSKKNEFSVAIIPYTFNNTIFNNLK 172

Query: 179 VGDLINIEVDSMMRYIARL 197
            GD++N+E D + +Y+ R+
Sbjct: 173 AGDMVNLEFDVIGKYVKRI 191


>gi|257092177|ref|YP_003165818.1| riboflavin synthase subunit alpha [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044701|gb|ACV33889.1| riboflavin synthase, alpha subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 210

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 13/209 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG---MRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MF+GI+  +G+I  +T    G   +RL +         + LG SIA  G+CLTVV     
Sbjct: 1   MFSGIIAALGQITCITARDDGAGTVRLTIDAGRLALDDVNLGDSIACNGVCLTVV----- 55

Query: 57  HSVDNWYEVEVWAETNRIT-NIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
              DN + V+V  E+   T  +A+ G    +NLE++++L DRL GHLVSGH+DG  E+L 
Sbjct: 56  DRRDNSFCVDVSPESLACTVGLATPGP---VNLEKALRLADRLGGHLVSGHVDGVGEVLR 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            D +GD+    +  P  L ++IA KGS+ ++GVSLT N V    F + LI HT++ TT  
Sbjct: 113 FDPVGDNRLLEIRAPAALARYIARKGSITVDGVSLTTNSVDGAAFSINLIPHTLDATTLG 172

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTSQ 204
             + G  +N+E+D + RY+ R+    + +
Sbjct: 173 RLQPGSRVNLEIDLIARYVERMLGAPSGE 201


>gi|107103569|ref|ZP_01367487.1| hypothetical protein PaerPA_01004639 [Pseudomonas aeruginosa PACS2]
          Length = 219

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSVRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVSGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|300858535|ref|YP_003783518.1| riboflavin synthase subunit alpha [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685989|gb|ADK28911.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302330805|gb|ADL20999.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           1002]
          Length = 213

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 118/201 (58%), Gaps = 9/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G ++++ P+   + L +          LG SIA  G+CLTV  + E     
Sbjct: 1   MFSGIVEEVGTMVSLEPLTDSIVLSIAAHKVLEGTSLGDSIAVNGVCLTVTDIQE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++  +V  E+   +++     GT +NLER+++   RLDGH+V GH+DGT E++  D   
Sbjct: 56  GFFSADVMQESLVRSSLGGLTAGTPVNLERALRADGRLDGHIVQGHVDGTAELISKDPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
                R +LP  L +++  KGS+ ++G SLTV+ +G++    +F+V LI  T++ TT   
Sbjct: 116 HWTVLRFTLPKELSRYVVEKGSISVDGTSLTVSGLGESEGNHWFEVSLIPTTLQSTTHGQ 175

Query: 177 HKVGDLINIEVDSMMRYIARL 197
            ++GD +N+EVD + +Y+ R+
Sbjct: 176 CQLGDRVNLEVDVLAKYVERM 196


>gi|170719754|ref|YP_001747442.1| riboflavin synthase subunit alpha [Pseudomonas putida W619]
 gi|169757757|gb|ACA71073.1| riboflavin synthase, alpha subunit [Pseudomonas putida W619]
 gi|313496882|gb|ADR58248.1| Riboflavin synthase subunit alpha [Pseudomonas putida BIRD-1]
          Length = 221

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I ++TP    +R+ V T   +   +KLG SIA  G+CLT V L  +   
Sbjct: 1   MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVELPGDGF- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W +V V  ET + T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 60  --WADVSV--ETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVDGVGEIISRSDS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|15599250|ref|NP_252744.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa PAO1]
 gi|116052092|ref|YP_789064.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889664|ref|YP_002438528.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa LESB58]
 gi|254236944|ref|ZP_04930267.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa C3719]
 gi|254242737|ref|ZP_04936059.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 2192]
 gi|296387388|ref|ZP_06876887.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa PAb1]
 gi|313109498|ref|ZP_07795454.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 39016]
 gi|9950252|gb|AAG07442.1|AE004822_2 riboflavin synthase alpha chain [Pseudomonas aeruginosa PAO1]
 gi|115587313|gb|ABJ13328.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168875|gb|EAZ54386.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa C3719]
 gi|126196115|gb|EAZ60178.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 2192]
 gi|218769887|emb|CAW25648.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa LESB58]
 gi|310881956|gb|EFQ40550.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 39016]
          Length = 219

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSVRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|283765786|gb|ADB28285.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765788|gb|ADB28286.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765794|gb|ADB28289.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765800|gb|ADB28292.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765802|gb|ADB28293.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    +++G SIA +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLKQGVRLNIATRYAIESLEIGASIACSGICLTIVERGSKQADTSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTSINLERSLRLGDEVGGHLVFGHIDGLAEIIDQKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PTRFTSFIVNKGSIALNGTS 140


>gi|46579611|ref|YP_010419.1| riboflavin synthase subunit alpha [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449026|gb|AAS95678.1| riboflavin synthase, alpha subunit [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233415|gb|ADP86269.1| riboflavin synthase, alpha subunit [Desulfovibrio vulgaris RCH1]
          Length = 220

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 107/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G+++A+ P+    RLR+   +    +  G SIA  G CLTV     E   D
Sbjct: 1   MFTGIIQGQGEVVAVEPMGGETRLRLRALFALDAIVKGESIATNGTCLTV-----ETYGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+     +ET + TN+     G  +NLER++ +GDRL GH+VSGH+D   E+  +   G
Sbjct: 56  RWFTAYASSETMQRTNLGDLRQGARVNLERALAVGDRLGGHIVSGHVDCVAEVRSITQAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   RL  P      +  KGSV L+G+SLTVN  G +F +V +I  T   TT    K G
Sbjct: 116 LSKVYRLGFPSAFGPQVIPKGSVALDGISLTVNHCGPDFLEVNVIPETQGVTTIASWKPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+  + A
Sbjct: 176 TRVNMETDVIGKYVQNMLA 194


>gi|229528729|ref|ZP_04418119.1| riboflavin synthase alpha chain [Vibrio cholerae 12129(1)]
 gi|229332503|gb|EEN97989.1| riboflavin synthase alpha chain [Vibrio cholerae 12129(1)]
          Length = 217

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++  KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVVEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|153803021|ref|ZP_01957607.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-3]
 gi|124121464|gb|EAY40207.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-3]
          Length = 217

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 117/198 (59%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V +   +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +    + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFVQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDVLARYMERL 193


>gi|49078224|gb|AAT49763.1| PA4055 [synthetic construct]
          Length = 220

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSVRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|325276596|ref|ZP_08142338.1| riboflavin synthase subunit alpha [Pseudomonas sp. TJI-51]
 gi|324098275|gb|EGB96379.1| riboflavin synthase subunit alpha [Pseudomonas sp. TJI-51]
          Length = 221

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I ++TP    +R+ V T   +   +KLG SIA  G+CLT V L  +   
Sbjct: 1   MFTGIIESIGSIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVELPGDGF- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W +V V  ET + T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 60  --WADVSV--ETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVDGVGEIISRSDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|283853210|ref|ZP_06370462.1| riboflavin synthase, alpha subunit [Desulfovibrio sp. FW1012B]
 gi|283571383|gb|EFC19391.1| riboflavin synthase, alpha subunit [Desulfovibrio sp. FW1012B]
          Length = 217

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G+++A+       R RV   ++  ++ LG SIA  G+CLTV     E + +
Sbjct: 1   MFTGLVMGLGRVMAVEARGDETRFRVKALFDLDRIVLGESIAVNGVCLTV-----ETAGE 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +     AET   + +     G+ +NLER++ LGDRL GHLVSGH+D    +  +  +G
Sbjct: 56  REFTAYASAETLAASGLGKLKPGSQVNLERALALGDRLGGHLVSGHVDCIATVESVTPLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+  +++ P +   F+  KGSV L+G+SLTVN  G  F  V +I  T   TT    K G
Sbjct: 116 QSVRYKVAFPEDFSVFVVPKGSVALDGISLTVNDCGAGFLTVNIIPSTQGATTISTWKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ R+
Sbjct: 176 TAVNMETDMLGKYVLRM 192


>gi|283765804|gb|ADB28294.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    +++G SIA +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLKQGVRLNIATRYAIESLEIGASIACSGICLTIVERGSKQADTSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTSINLERSLRLGDEVGGHLVLGHIDGLAEIIDQKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PTRFTSFIVNKGSIALNGTS 140


>gi|318057035|ref|ZP_07975758.1| riboflavin synthase subunit alpha [Streptomyces sp. SA3_actG]
 gi|318078666|ref|ZP_07985998.1| riboflavin synthase subunit alpha [Streptomyces sp. SA3_actF]
          Length = 206

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV    EH   
Sbjct: 1   MFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVV----EHE-G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GHLV GH+DGT  IL  +   
Sbjct: 56  AEFTADVMAETLKRSSLGALAPGSRVNLERPTPVGGRLGGHLVQGHVDGTGTILRREPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV     + F V LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEATDDTFSVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +N+EVD + +Y+ R+    T+ 
Sbjct: 176 APVNLEVDVLAKYVERMLRYGTAP 199


>gi|26987253|ref|NP_742678.1| riboflavin synthase subunit alpha [Pseudomonas putida KT2440]
 gi|148545800|ref|YP_001265902.1| riboflavin synthase subunit alpha [Pseudomonas putida F1]
 gi|167031577|ref|YP_001666808.1| riboflavin synthase subunit alpha [Pseudomonas putida GB-1]
 gi|24981895|gb|AAN66142.1|AE016242_10 riboflavin synthase, alpha subunit [Pseudomonas putida KT2440]
 gi|148509858|gb|ABQ76718.1| riboflavin synthase, alpha subunit [Pseudomonas putida F1]
 gi|166858065|gb|ABY96472.1| riboflavin synthase, alpha subunit [Pseudomonas putida GB-1]
          Length = 221

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I ++TP    +R+ V T   +   +KLG SIA  G+CLT V L  +   
Sbjct: 1   MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVELPGDGF- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W +V V  ET + T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 60  --WADVSV--ETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVDGVGEIISRSDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRRVNLEVDLLARYLERL 193


>gi|161721847|gb|ABX76824.1| RibE [Photobacterium leiognathi subsp. mandapamensis]
          Length = 219

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+      + + + T+  + S +KLG SIA  G+CLTV +L+     
Sbjct: 1   MFTGIIEAVGNISAIIRNNDDISMVINTNRLDISDVKLGDSIASNGVCLTVSKLTP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + T   S+ +G  INLE+++    R  GH+VSGH+DG  +I+ L   
Sbjct: 57  -TGFVADLSTETLKRTAFHSYHVGQKINLEKAMLPTTRFGGHIVSGHVDGIGDIIELKRK 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L++F++ KGSVC++G SLT+N V +N   + ++ HT+  TT     V
Sbjct: 116 GRTLDMWITVPIHLKKFVSEKGSVCVDGTSLTINAVYQNVIKLTIVPHTLANTTLANATV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +NIE D M RY+ RL +++  +
Sbjct: 176 GQKVNIEADMMARYLERLISIDKQE 200


>gi|260438156|ref|ZP_05791972.1| riboflavin synthase, alpha subunit [Butyrivibrio crossotus DSM
           2876]
 gi|292809344|gb|EFF68549.1| riboflavin synthase, alpha subunit [Butyrivibrio crossotus DSM
           2876]
          Length = 218

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G I  +        + +          +G SIA  GICLTV  L ++    
Sbjct: 3   LFTGIVEELGIIRKLHVSGHSGSIEIEAHKVLRNTNVGDSIAVNGICLTVTSLGKD---- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++  ++ AET R +++ +   G F+NLER++    R  GH+VSGH+DGT  IL +    
Sbjct: 59  -FFTADIMAETVRRSSLKNATSGDFVNLERAMAADGRFGGHIVSGHVDGTGTILSMKKEE 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +S P ++ +FI  KGSVCL+G+SLTV  VG++ F V +I HT  ETT    K G
Sbjct: 118 NAVWVTISAPPSIMKFIVEKGSVCLDGISLTVAAVGESDFKVSVIPHTGGETTLLKKKAG 177

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           + INIE D + +Y+ RL     S 
Sbjct: 178 NTINIENDVIGKYVDRLLNFKDSS 201


>gi|281491488|ref|YP_003353468.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375206|gb|ADA64719.1| Riboflavin synthase, alpha chain [Lactococcus lactis subsp. lactis
           KF147]
          Length = 216

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 115/199 (57%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG++  +    K  ++ +  S     MKLG SI+  G+CLT+   +++    
Sbjct: 1   MFTGIIEEIGEVSRLQKREKSFKISIRASLILEDMKLGDSISTNGLCLTISEFNQKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  E+   +N  +  +G  +NLER++ L  R  GH+VSGHIDG  +IL +    
Sbjct: 58  --FTADIMPESLNRSNFGTLNVGAKVNLERAMSLNGRFGGHIVSGHIDGVGQILEVKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    NL ++I  KGS+ ++G+SLTV  V    F V +I HT++ET     KVG
Sbjct: 116 NAIWFEIKTSLNLMRYIVEKGSITIDGISLTVAQVKSKSFSVSIIPHTLKETIMADKKVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +YI +L+ 
Sbjct: 176 DTVNLENDILGKYIEKLWG 194


>gi|311894588|dbj|BAJ26996.1| putative riboflavin synthase alpha chain [Kitasatospora setae
           KM-6054]
          Length = 219

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 122/205 (59%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV- 59
           MFTGI+ ++G+++++  I +  R+R+     T+  + G SIA  G+CLTV+  +E+ +  
Sbjct: 1   MFTGIIEELGEVVSIEEIGESSRIRLRGPVVTADARHGDSIAVNGVCLTVLDDNEQLAAR 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF---- 115
           D  +  +V  ET + +++     G+ +NLER++ LG RL GHLV GH+D T  +L     
Sbjct: 61  DGEFSADVMRETLQRSSLGVLRPGSRVNLERAMALGARLGGHLVQGHVDATGTLLSREPG 120

Query: 116 -LDFIGDSMY--CRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
            LD  G+  +   R +LP  + +++  KGS+ ++GVSLTV     + F V LI  T+  T
Sbjct: 121 DLDADGNPRWEVLRFTLPQPIARYLVEKGSITVDGVSLTVVEAALDSFTVSLIPATLALT 180

Query: 173 TWKMHKVGDLINIEVDSMMRYIARL 197
           T    +VG+ +N+EVD + +Y+ RL
Sbjct: 181 TLGAKQVGEPVNLEVDVLAKYVERL 205


>gi|167590678|ref|ZP_02383066.1| riboflavin synthase subunit alpha [Burkholderia ubonensis Bu]
          Length = 211

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 123/213 (57%), Gaps = 18/213 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+    
Sbjct: 1   MFTGIVAAVGRIESIKPLGASPDAGVRLTVKAGGLDLADVALGDSIAIQGACMTVI---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           E + D  ++VEV  E+ N    +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 57  EKTAD-AFDVEVSRESLNLTVGLAEPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVS 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRIVAPRQLGRYLAYKGSITVNGVSLTVNSVADRADGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
            TT +  + G  +N+E+D + RY+ R+ + + S
Sbjct: 173 VTTLRHLRAGSQVNLEIDMIARYVERMLSTSPS 205


>gi|119963571|ref|YP_947579.1| riboflavin synthase subunit alpha [Arthrobacter aurescens TC1]
 gi|119950430|gb|ABM09341.1| riboflavin synthase, alpha subunit [Arthrobacter aurescens TC1]
          Length = 209

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 111/210 (52%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV + G ++++         LR+        + LG SIA  G+CLT  ++  +   
Sbjct: 1   MFTGIVAEQGTVLSIEHEGDASATLRLKAPTTAEGLPLGGSIAVNGVCLTATQIDGQD-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T I     G  +NLER V  G RLDGH+V GH+DG  E+L  + +
Sbjct: 59  ---FSVDVMGETLVRTTIGELTPGDAVNLERCVPAGGRLDGHVVQGHVDGVGELLEREPL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK-----NFFDVLLIRHTIEETTW 174
           G+    R  +P  L ++IA KGS+ ++GVSLTV  V        +F+V LI  T+EET  
Sbjct: 116 GNWDRLRFGVPAPLARYIAEKGSIAVDGVSLTVTAVSPAAETAPWFEVGLIPTTLEETGL 175

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
               VG  +N+EVD + +Y  RL +    Q
Sbjct: 176 GAKAVGGRVNLEVDVLAKYTERLLSFAPQQ 205


>gi|294628306|ref|ZP_06706866.1| riboflavin synthase, alpha subunit [Streptomyces sp. e14]
 gi|292831639|gb|EFF89988.1| riboflavin synthase, alpha subunit [Streptomyces sp. e14]
          Length = 209

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV    EH  D
Sbjct: 1   MFTGIVEELGEVTAVENLGDAARFRLRGPVVTQGAQHGDSIAVNGVCLTVV----EHQGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++    +G+ +NLER   +G RL GH+V GH+DGT  IL      
Sbjct: 57  E-FTADVMAETLKRSSLGVLAVGSRVNLERPTAVGARLGGHIVQGHVDGTGTILERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G + F V LI  T+  TT  + K G
Sbjct: 116 HWEIVKISLPADLARYVVEKGSITVDGISLTVVEAGADHFTVSLIPTTLALTTLGLKKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ RL
Sbjct: 176 DPVNLEVDVVAKYVERL 192


>gi|330505154|ref|YP_004382023.1| riboflavin synthase subunit alpha [Pseudomonas mendocina NK-01]
 gi|328919440|gb|AEB60271.1| riboflavin synthase subunit alpha [Pseudomonas mendocina NK-01]
          Length = 220

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +R+ V T   +   +KLG SIA  GICLT V L      
Sbjct: 1   MFTGIIEAIGSIRAMTPKGGDVRVYVATGKLDLGDVKLGDSIAVNGICLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLARTAFVDLKPGSAVNLEKALTPTSRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  ++  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFKVRAPRELAKYIAHKGSITVDGTSLTVNAVDGAEFELTIVPHTLAETIMVDYQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|71736279|ref|YP_276622.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|289629166|ref|ZP_06462120.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289647765|ref|ZP_06479108.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298488890|ref|ZP_07006914.1| Riboflavin synthase alpha chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556832|gb|AAZ36043.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298156565|gb|EFH97661.1| Riboflavin synthase alpha chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322800|gb|EFW78893.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330414|gb|EFW86393.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330869909|gb|EGH04618.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874036|gb|EGH08185.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330988220|gb|EGH86323.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 220

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|183220793|ref|YP_001838789.1| riboflavin synthase subunit alpha [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910893|ref|YP_001962448.1| riboflavin synthase subunit alpha [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167775569|gb|ABZ93870.1| Riboflavin synthase alpha chain [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779215|gb|ABZ97513.1| Riboflavin synthase alpha chain [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 200

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 114/200 (57%), Gaps = 4/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +GK++ + PI  G++  + T +    +KLG SIA  G C+TV + S+   + 
Sbjct: 1   MFTGLVETLGKVVQIEPIDSGIQFTIQTEWENPDLKLGDSIAINGACMTVTKFSD---LG 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N ++     ++  +TN++  G GT +NLER++ LG R  GH+V GH+DG  +++    I 
Sbjct: 58  NIFQFYASFKSLELTNLSRLGEGTLVNLERAMALGQRFGGHMVQGHVDGMAKVVSRKQIE 117

Query: 121 DSM-YCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           + +    + +P  L +F   KGSV L+G+SLTV  V      ++LI  T+++T     K 
Sbjct: 118 NEVEEFWVEVPEELRRFFVKKGSVTLDGISLTVVDVKDGNIQLILIPETMQKTNANTWKK 177

Query: 180 GDLINIEVDSMMRYIARLYA 199
              +N+EVD + +YI    A
Sbjct: 178 DQRLNVEVDVLAKYIENYLA 197


>gi|226314398|ref|YP_002774294.1| riboflavin synthase alpha subunit [Brevibacillus brevis NBRC
           100599]
 gi|226097348|dbj|BAH45790.1| riboflavin synthase alpha subunit [Brevibacillus brevis NBRC
           100599]
          Length = 218

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + A+    +  RL +        +KLG SI+  GICLTV   +     +
Sbjct: 1   MFTGLVEEVGVLEAIQGNEQARRLVIRAQQVLEGVKLGDSISVNGICLTVTSYT-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T++     G  +NLER+++LGDR  GH+VSGH+DGT  +   +   
Sbjct: 56  RQFSVDVMPETMNKTSLRQLRSGQRVNLERAMRLGDRFGGHIVSGHVDGTGMVASREVNA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+     L +++  +GS+C++G+SLTV  V  + F V +I HT+  T+    + G
Sbjct: 116 NAVVFRIEAKPQLLKYVIARGSICIDGISLTVVEVNDSGFTVSIIPHTLANTSLADRRPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+E D + +Y+ RL
Sbjct: 176 DLVNLETDVIGKYVERL 192


>gi|328956809|ref|YP_004374195.1| riboflavin synthase, subunit alpha [Carnobacterium sp. 17-4]
 gi|328673133|gb|AEB29179.1| riboflavin synthase, subunit alpha [Carnobacterium sp. 17-4]
          Length = 217

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 119/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I ++    K   L++         ++G SI+  GICLTV ++      +
Sbjct: 1   MFTGIIEEMGTIQSIKRGEKSSILKIKGQKVLQGTRIGDSISTNGICLTVTKIG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +V +E+ + TNI     G+++NLER++ L  RL GH+VSGHIDGT EI  +    
Sbjct: 56  DSFDADVMSESLKRTNIGELAPGSYVNLERALSLETRLGGHMVSGHIDGTGEIREMKRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGS+ ++GVSLTV  V    F V +I HT EET     ++G
Sbjct: 116 NAVWITVETSPKLLRYIIEKGSIAIDGVSLTVVTVDDQSFKVSVIPHTGEETVLLRKQLG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ +L  L++
Sbjct: 176 DAVNLECDMIGKYVEKLLGLDS 197


>gi|326336107|ref|ZP_08202279.1| riboflavin synthase subunit alpha [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325691616|gb|EGD33583.1| riboflavin synthase subunit alpha [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 212

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 119/204 (58%), Gaps = 13/204 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV  IG+I  +T   K      + S   +++K+  S+AH G+CLTVV +  +    
Sbjct: 14  MFTGIVEKIGRIAKITSQGKNCHF-FIESQLAAELKIDQSVAHNGVCLTVVGIENQQ--- 69

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             YEV    ET + T++++W +G  +NLER++KLGDRLDGH+V GH+D T        I 
Sbjct: 70  --YEVVAINETLQKTSLSTWQVGDMVNLERAMKLGDRLDGHIVQGHVDQTG---LCHSIE 124

Query: 121 DSMYCRLSLPH---NLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
           D+   R+   H   +L      KGS+ +NGVSLTV    K  F V +I +T E T++   
Sbjct: 125 DAQGSRVFTFHYDPSLGNMTIEKGSITVNGVSLTVVNSQKGVFSVAVIPYTYEHTSFYTL 184

Query: 178 KVGDLINIEVDSMMRYI-ARLYAL 200
           K GD++N+E D + +Y+ A++ AL
Sbjct: 185 KEGDVVNLEFDVIGKYVLAKVNAL 208


>gi|257053098|ref|YP_003130931.1| riboflavin synthase, alpha subunit [Halorhabdus utahensis DSM
           12940]
 gi|256691861|gb|ACV12198.1| riboflavin synthase, alpha subunit [Halorhabdus utahensis DSM
           12940]
          Length = 211

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G + A+   A  + L V  S   + ++LG S+A  G CLTVV + E     
Sbjct: 1   MFTGIIEDVGSVEAIDRRANALVLTVH-STELTDLELGDSVAVNGPCLTVVEIDESAET- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VEV  ET R TN+     G+ +NLE +++L D LDGHLV+GHIDGT  +  L    
Sbjct: 59  --FTVEVTPETYRRTNLRELQPGSPVNLESALQLNDGLDGHLVTGHIDGTGVVTDLRREE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L  ++A KGSV ++GVSLTV  V +  F V +  +T +ET      VG
Sbjct: 117 KARIYSIRPPEKLLPYLAEKGSVAVDGVSLTVVDVDRT-FSVSITDYTEDETILTETGVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ RL
Sbjct: 176 DEVNLEVDVIARYVERL 192


>gi|229542332|ref|ZP_04431392.1| riboflavin synthase, alpha subunit [Bacillus coagulans 36D1]
 gi|229326752|gb|EEN92427.1| riboflavin synthase, alpha subunit [Bacillus coagulans 36D1]
          Length = 215

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 109/198 (55%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  +    + ++L V        ++LG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEIGILKRVERGPRSLKLAVQARTVLQDVRLGDSIAVNGVCLTVTSYTP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   T +A   IG+ +NLER++  G R  GH V+GH+DGT  +     + 
Sbjct: 56  NAFTADVMPETFFSTALAGLNIGSKVNLERAMAAGGRFGGHFVTGHVDGTGTVCLKQRME 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  +S+P +L  F+  KGSV L+G SLTV         V L+ HT + T     K+G
Sbjct: 116 NAVYITISVPSSLSAFLIPKGSVALDGTSLTVFGAADGQLTVSLVPHTQQHTILPEKKIG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +NIE D + +Y+A L+
Sbjct: 176 DAVNIECDILAKYMAGLF 193


>gi|256824049|ref|YP_003148009.1| riboflavin synthase subunit alpha [Kytococcus sedentarius DSM
           20547]
 gi|256687442|gb|ACV05244.1| riboflavin synthase, alpha subunit [Kytococcus sedentarius DSM
           20547]
          Length = 204

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 116/200 (58%), Gaps = 4/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSE--EHS 58
           MFTGI+ ++G+I  + P    +RL V     TS    G SIA  G+CLTV  L E  + +
Sbjct: 1   MFTGIIEELGRIEVIDPAGDDVRLTVHGPLVTSDASRGDSIAVNGVCLTVTDLGEAGDSA 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               +  +V  ET   +++ +   G+ +NLER+V++  RL GH+V GH+DG V  +    
Sbjct: 61  SPARFTADVMPETLTHSSLGALTPGSPVNLERAVRVDARLGGHIVQGHVDG-VGTIADRT 119

Query: 119 IGDS-MYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            GD     R+S+P  L +++  KGS+ L+GVSLTV+ VG ++ +V LI  T+  TT    
Sbjct: 120 PGDRWEVVRVSIPVALARYVVDKGSITLDGVSLTVSGVGTDWLEVSLIPETLARTTLGTA 179

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  +N+EVD + +Y+ +L
Sbjct: 180 AVGSPVNVEVDVLAKYVEKL 199


>gi|167044794|gb|ABZ09462.1| putative Lumazine binding domain protein [uncultured marine
           crenarchaeote HF4000_APKG8D6]
          Length = 194

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 112/199 (56%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+   GK+  + P  K    +++ V        +K+G S+A  G+CL+  ++S   
Sbjct: 1   MFTGIIIGTGKVTKLVPKPKSRSAIQMTVDLGKYARGLKIGQSVAINGVCLSATKISRNK 60

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
            V      E+  ET + T++ +   G+ +N+ERS+K+GDRL+GH V GHIDG   I  ++
Sbjct: 61  CV-----FEMIDETIKKTDLGNVNAGSIVNIERSLKVGDRLEGHFVLGHIDGVTTITKIE 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                +     +P  L +++  KGS+ L+G+SLTV    K+   V LI  TI+ T +K  
Sbjct: 116 KKPKEVKFWFKIPKKLTKYVVKKGSIALDGISLTVVDAKKDITSVCLIPQTIKVTNFKSK 175

Query: 178 KVGDLINIEVDSMMRYIAR 196
           KVGD +NIE D + +YI +
Sbjct: 176 KVGDKLNIETDILGKYIKK 194


>gi|257483268|ref|ZP_05637309.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331012490|gb|EGH92546.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGMGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|153843224|ref|ZP_01993551.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ3810]
 gi|149745332|gb|EDM56583.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ3810]
          Length = 203

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 114/184 (61%), Gaps = 6/184 (3%)

Query: 15  MTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNR 73
           MTP+   + + V +   + S +KLG SIA  G+CLTV+         N+Y  ++  ET +
Sbjct: 1   MTPVCWKVTVTVEVGKLDMSDVKLGDSIATNGVCLTVIDFG-----SNYYSADLSLETLK 55

Query: 74  ITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNL 133
            T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +G ++   +++P  +
Sbjct: 56  KTGFANYQVGEKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQVGRAIEFWVAMPAEI 115

Query: 134 EQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRY 193
            +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +VG  +N+EVD + RY
Sbjct: 116 SKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQVGRKVNLEVDVLARY 175

Query: 194 IARL 197
           + RL
Sbjct: 176 MERL 179


>gi|319778562|ref|YP_004129475.1| Riboflavin synthase alpha chain [Taylorella equigenitalis MCE9]
 gi|317108586|gb|ADU91332.1| Riboflavin synthase alpha chain [Taylorella equigenitalis MCE9]
          Length = 212

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 124/215 (57%), Gaps = 26/215 (12%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I +++ +  G+RLR+   + + SK K+G SIA  G C+T+V L      
Sbjct: 1   MFTGIIQTVGNIESVSNLEVGVRLRIAKGNLDMSKFKIGDSIAVNGACMTIVNLD----- 55

Query: 60  DNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           D  +EV+V AE+ ++   +   G   + NLE +++LGD LDGHLVSGH+DG   ++ +  
Sbjct: 56  DAGFEVDVSAESLSKTCGLDEVG---YANLEGAMRLGDTLDGHLVSGHVDGVGRVMSISK 112

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----------------FDV 162
            G+S    + +P  L  F+A KGSV ++GVS+T+N V   F                  +
Sbjct: 113 EGESHVIEVLIPKELAIFMAYKGSVAIDGVSMTINNVTDAFSPEDPHSDDMISEGCIISL 172

Query: 163 LLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
            +I +T + TT +  K GD +NIE+D++ RY+ R+
Sbjct: 173 NVIPYTFQNTTLQYLKGGDKVNIEIDTIARYVRRI 207


>gi|90023097|ref|YP_528924.1| riboflavin synthase subunit alpha [Saccharophagus degradans 2-40]
 gi|89952697|gb|ABD82712.1| Riboflavin synthase, alpha subunit RibE [Saccharophagus degradans
           2-40]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 111/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   G I  + P    +RL V     + S + LG SIA  G+CLT V+L      
Sbjct: 1   MFTGIVEAKGTIAKLEPRDGDVRLWVTAPDLDYSDVALGDSIATNGVCLTAVQLP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET  +T + +W  GT +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLSLTTLVNWQPGTVVNLEKALTPQTRLGGHIVSGHVDGVGEVVSRHPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++IA KGS+ ++G SLTVN V  + F++ ++ HT++ T    +  
Sbjct: 116 ARSERFTIRAPKELAKYIAHKGSITVDGTSLTVNAVNGDLFELNIVPHTLQWTIIDSYTA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTKVNLEVDVIARYLERL 193


>gi|50954247|ref|YP_061535.1| riboflavin synthase subunit alpha [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50950729|gb|AAT88430.1| riboflavin synthase, alpha chain [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 115/208 (55%), Gaps = 9/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I A+       R+ V      S    G SI+ +G+CLTV+    +    
Sbjct: 1   MFTGIIEELGEIAAVDRTTDAARITVRGPLAVSDANHGDSISVSGVCLTVIGWDADG--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET  ++ +     G  +NLER+ ++GDRL GH+V GHIDGT  +L  +   
Sbjct: 58  --FTADVMAETLAMSTLGDVAPGRRVNLERAARVGDRLGGHIVQGHIDGTATVLSAEEGS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
                RLSL   +   +A KGS+ ++GVSLTV+ VG +    +F+V LI  T+  TT   
Sbjct: 116 AWRVVRLSLDPGIASLVARKGSIAIDGVSLTVSAVGGDRDDSWFEVSLIPETLTATTLGE 175

Query: 177 HKVGDLINIEVDSMMRYIARLYALNTSQ 204
              GD +NIE D + R++ ++ AL  ++
Sbjct: 176 RVPGDRVNIETDILARHVEQMLALAPTE 203


>gi|325478593|gb|EGC81705.1| riboflavin synthase, alpha subunit [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 204

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 113/197 (57%), Gaps = 9/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI  ++GK+I     +  +++++         KLG SI   G+CLTV  ++     D
Sbjct: 1   MFTGIAEELGKVIEFKQNSDTVKIKIACKKVLEGTKLGDSIMTDGVCLTVTEMT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           ++Y+ ++  E+ + T      +G  +NLER+++  DRLDGH+V GHIDG   ++    I 
Sbjct: 56  SYYKADIMNESLKKTKFDRNILGKEVNLERALRFSDRLDGHIVQGHIDGVGRLIS---IS 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++Y R      + ++I  KGS+ ++G+SLTV+    + F+V LI  TI  T  K  KVG
Sbjct: 113 KNVY-RFKTNREISKYIVNKGSIAIDGISLTVSFEQDDIFEVSLIPETIARTNIKNKKVG 171

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+E D + R + +L
Sbjct: 172 DLVNLETDILSRIVEKL 188


>gi|125624335|ref|YP_001032818.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|44662841|gb|AAS47501.1| riboflavin synthase alpha subunit [Lactococcus lactis subsp.
           cremoris NZ9000]
 gi|124493143|emb|CAL98107.1| RibB protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|300071119|gb|ADJ60519.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 215

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG++  +    K  +L +  S     +KLG SI+  G+CLTV   + +    
Sbjct: 1   MFTGIIEEIGEVTQIQKRDKSSKLIIRASSILEDLKLGDSISTNGLCLTVSAFNHKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ + +N+    +G+ +NLER+V L  R  GH+VSGHIDGT +IL +    
Sbjct: 58  --FTADVMPESFKRSNLGELTVGSKVNLERAVALNGRFGGHIVSGHIDGTGKILSIKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++       +L +++  KGS+ ++G+SLTV  V    F V +I HTI+ET     KVG
Sbjct: 116 NAVWFEFQTTVDLMKYVVEKGSITIDGISLTVAHVTSKSFSVSIIPHTIKETILSAKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +YI +L
Sbjct: 176 DKVNLENDILGKYIEKL 192


>gi|313773158|gb|EFS39124.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL074PA1]
 gi|313800983|gb|EFS42251.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA2]
 gi|313808723|gb|EFS47177.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL087PA2]
 gi|313810308|gb|EFS48024.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL083PA1]
 gi|313812184|gb|EFS49898.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL025PA1]
 gi|313817903|gb|EFS55617.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL046PA2]
 gi|313819815|gb|EFS57529.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL036PA1]
 gi|313823305|gb|EFS61019.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL036PA2]
 gi|313824947|gb|EFS62661.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL063PA1]
 gi|313828279|gb|EFS65993.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL063PA2]
 gi|313830201|gb|EFS67915.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL007PA1]
 gi|313833123|gb|EFS70837.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL056PA1]
 gi|313838063|gb|EFS75777.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL086PA1]
 gi|314960752|gb|EFT04853.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL002PA2]
 gi|314963427|gb|EFT07527.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL082PA1]
 gi|314968930|gb|EFT13028.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL037PA1]
 gi|314972941|gb|EFT17037.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL053PA1]
 gi|314975460|gb|EFT19555.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL045PA1]
 gi|314979408|gb|EFT23502.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL072PA2]
 gi|314984253|gb|EFT28345.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA1]
 gi|314986171|gb|EFT30263.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA2]
 gi|314988783|gb|EFT32874.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA3]
 gi|315077276|gb|EFT49338.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL053PA2]
 gi|315079955|gb|EFT51931.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL078PA1]
 gi|315083283|gb|EFT55259.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL027PA2]
 gi|315086944|gb|EFT58920.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL002PA3]
 gi|315089870|gb|EFT61846.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL072PA1]
 gi|315096642|gb|EFT68618.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL038PA1]
 gi|315106175|gb|EFT78151.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL030PA1]
 gi|327325059|gb|EGE66865.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL096PA3]
 gi|327325314|gb|EGE67119.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL096PA2]
 gi|327332328|gb|EGE74064.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL097PA1]
 gi|327443829|gb|EGE90483.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL043PA1]
 gi|327449141|gb|EGE95795.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL043PA2]
 gi|327449257|gb|EGE95911.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL013PA2]
 gi|328756398|gb|EGF70014.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL020PA1]
 gi|328761072|gb|EGF74622.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL099PA1]
          Length = 204

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 181 DEVNVEVDIIAKYLEAL 197


>gi|330466989|ref|YP_004404732.1| riboflavin synthase subunit alpha [Verrucosispora maris AB-18-032]
 gi|328809960|gb|AEB44132.1| riboflavin synthase subunit alpha [Verrucosispora maris AB-18-032]
          Length = 209

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 115/206 (55%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRL-RVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++ +TP A+   L  V     TS  + G SIA  G+CLTVV       V
Sbjct: 1   MFTGIVEELGEVVGVTPTAQDSVLVAVRGPLVTSDARHGDSIAVNGVCLTVV------DV 54

Query: 60  DNW-YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           D   +  +V  ET R + + +   G  +NLER+  LG RL GHLV GH+DG  E+L  + 
Sbjct: 55  DGGVFTADVMGETLRRSALGTLRAGDPVNLERAAALGSRLGGHLVQGHVDGVGEVLAREP 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                  R  LP  L +++  KGS+ ++GVSLTV  VG ++F V LI  T+  TT     
Sbjct: 115 APRWETVRFRLPVALSRYVVEKGSITIDGVSLTVAEVGDDWFSVGLIPTTLALTTLGTRA 174

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
           VGD +N+E+D + +Y+ RL     + 
Sbjct: 175 VGDPVNLEMDVLAKYVERLLGARPAD 200


>gi|152980210|ref|YP_001354123.1| riboflavin synthase subunit alpha [Janthinobacterium sp. Marseille]
 gi|151280287|gb|ABR88697.1| riboflavin synthase alpha chain [Janthinobacterium sp. Marseille]
          Length = 203

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 122/213 (57%), Gaps = 19/213 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIA---KGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  IGKI  +TP+     G RL V       + + LG SI   G C+TVV     
Sbjct: 1   MFTGIVAAIGKITHITPLGDAEAGHRLTVDAGGLPLADVALGDSITLNGACMTVVA---- 56

Query: 57  HSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
              D  ++V+V  E+ N    + + G    +NLE++V L +RL GHLVSGH+DG   +  
Sbjct: 57  -KTDKQFDVDVSRESLNCTAGLDAIG---EVNLEKAVTLSERLGGHLVSGHVDGLGVVSK 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIEE 171
            + +G+S    ++ P  L +FIAVKGS+ +NGVSLTVN V  +     F V LI HT++ 
Sbjct: 113 FEPVGESWLLAVTAPKELGKFIAVKGSIVINGVSLTVNTVVDSANGCTFSVNLIPHTVQV 172

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           TT K  + G  +N+E+D + RY+ R+  L+ SQ
Sbjct: 173 TTLKHLQAGSKVNLEIDLIARYVERM--LSQSQ 203


>gi|299538632|ref|ZP_07051915.1| riboflavin synthase alpha chain [Lysinibacillus fusiformis ZC1]
 gi|298726219|gb|EFI66811.1| riboflavin synthase alpha chain [Lysinibacillus fusiformis ZC1]
          Length = 212

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 110/194 (56%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V DIG I A+      M++ + ++  T  +KLG SIA  G+CLTV   +++    
Sbjct: 1   MFTGLVEDIGIIKAVQSDRNSMKITIQSAKITEDVKLGDSIAVNGVCLTVTHFTQQQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
               ++V  ET + TN+    IG  +NLER++    R  GH V+GH+DG  +IL    + 
Sbjct: 58  --LTMDVMPETVKATNLQQLAIGDSVNLERAMPANGRFGGHFVAGHVDGVGKILRKRPVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +   L  F   KGS+ ++G SLT+  V  N   + LI HT +ET   + +VG
Sbjct: 116 NAVYIDIEMSEELTNFCIPKGSITIDGTSLTLFHVEANSVTISLIPHTYKETVLGLKRVG 175

Query: 181 DLINIEVDSMMRYI 194
            ++NIE D + +YI
Sbjct: 176 AIVNIETDLVGKYI 189


>gi|283765792|gb|ADB28288.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 87/140 (62%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    +++G S+A +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLKQGVRLNIATRYAIESLEIGASMACSGICLTIVERGSKQANTSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTSINLERSLRLGDEVGGHLVFGHIDGLAEIIDQKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PTRFTSFIVNKGSIALNGTS 140


>gi|313763121|gb|EFS34485.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL013PA1]
 gi|313814723|gb|EFS52437.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL059PA1]
 gi|314914449|gb|EFS78280.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA4]
 gi|314917773|gb|EFS81604.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL050PA1]
 gi|314919501|gb|EFS83332.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL050PA3]
 gi|314930093|gb|EFS93924.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL067PA1]
 gi|314957062|gb|EFT01167.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL027PA1]
 gi|314957696|gb|EFT01799.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL002PA1]
 gi|315097871|gb|EFT69847.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL059PA2]
 gi|315100735|gb|EFT72711.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL046PA1]
 gi|327451323|gb|EGE97977.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL087PA3]
 gi|327452163|gb|EGE98817.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL083PA2]
 gi|328752419|gb|EGF66035.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL087PA1]
 gi|328755094|gb|EGF68710.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL025PA2]
          Length = 204

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 181 DEVNVEVDIIAKYLEAL 197


>gi|126348663|emb|CAJ90388.1| putative riboflavin synthase [Streptomyces ambofaciens ATCC 23877]
          Length = 200

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A+  +    R RV     T   + G SIA  G+CLTVV    +H  D
Sbjct: 1   MFTGIVEELGEITAVETLDDACRFRVRGPVVTEGARHGDSIAVNGVCLTVV----DHEGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++     G+ +NLER   +G RL GH+V GH+DGT EI+      
Sbjct: 57  E-FTADVMAETLNRSSLGVLATGSRVNLERPTAVGARLGGHIVQGHVDGTGEIVERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPADLARYVVEKGSITVDGISLTVVDAGPDFFTVSLIPTTLALTTLGLKQPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ RL
Sbjct: 176 DPVNLEVDVIAKYVERL 192


>gi|300113758|ref|YP_003760333.1| riboflavin synthase subunit alpha [Nitrosococcus watsonii C-113]
 gi|299539695|gb|ADJ28012.1| riboflavin synthase, alpha subunit [Nitrosococcus watsonii C-113]
          Length = 218

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+++A+  +     LR+     + +++ +G SIA  G+CLTV R       
Sbjct: 1   MFTGIIRAVGRVVALQFMGSMAVLRINGGKLDFAQVSIGDSIAVNGVCLTVTRQE----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +N ++ +V  ET   T +     G  +NLE ++ L D L GHL SGH DG   +     +
Sbjct: 56  NNIFDADVSQETLSRTVLGRLQPGDRVNLEPALTLKDGLGGHLTSGHCDGVGTVAERKPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P +L ++IA KGS+C++GVSLTVN V  N F V +I HT+E TT   ++ 
Sbjct: 116 AGSVGFSIHAPAHLLKYIAEKGSICVDGVSLTVNEVKGNLFKVNIIPHTLEATTLSEYRS 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GREVNVEVDLLARYLERL 193


>gi|120602901|ref|YP_967301.1| riboflavin synthase subunit alpha [Desulfovibrio vulgaris DP4]
 gi|120563130|gb|ABM28874.1| riboflavin synthase, alpha subunit [Desulfovibrio vulgaris DP4]
          Length = 220

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 106/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G++ A+ P+    RLR+ T +    +  G SIA  G CLTV    E     
Sbjct: 1   MFTGIIQGQGEVAAVEPMGGETRLRLRTLFALDAIVKGESIATNGTCLTVETYGER---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+     +ET + TN+     G  +NLER++ +GDRL GH+VSGH+D   E+  +   G
Sbjct: 57  -WFTAYASSETMQRTNLGDLRQGARVNLERALAVGDRLGGHIVSGHVDCVAEVRSITQAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   RL  P      +  KGSV L+G+SLTVN  G +F +V +I  T   TT    K G
Sbjct: 116 LSKVYRLGFPSAFGPQVIPKGSVALDGISLTVNHCGPDFLEVNVIPETQGVTTIASWKPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+  + A
Sbjct: 176 TRVNMETDVIGKYVQNMLA 194


>gi|186475386|ref|YP_001856856.1| riboflavin synthase subunit alpha [Burkholderia phymatum STM815]
 gi|184191845|gb|ACC69810.1| riboflavin synthase, alpha subunit [Burkholderia phymatum STM815]
          Length = 204

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 119/206 (57%), Gaps = 16/206 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G+RL V     +   ++LG SIA  G C+TV+  S 
Sbjct: 1   MFTGIVAAVGRIASITPLGNEPDAGVRLHVEAGGLDMDDVQLGDSIAIQGACMTVIEKSP 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  ++V+V  E+  ++     G    +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  A-----SFDVDVSRES--LSRTVGLGETREVNLEKALRSHDRLGGHIVSGHVDGLGTVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S   R+  P ++ +F+A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FARVGESHELRVLAPRDIGKFLAYKGSITVNGVSLTVNAVTDRDDGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           TT K  K G  +N+E+D + RY+ R+
Sbjct: 174 TTLKALKEGAQVNLEIDLIARYVERM 199


>gi|283765790|gb|ADB28287.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 86/140 (61%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    +++G SIA +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLKQGVRLNIATRYAIESLEIGASIACSGICLTIVERGSKQADTSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INLERS++LGD + GH V GHIDG  EI+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTSINLERSLRLGDEVGGHFVFGHIDGLAEIIDQKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PTRFTSFIVNKGSIALNGTS 140


>gi|312880087|ref|ZP_07739887.1| riboflavin synthase, alpha subunit [Aminomonas paucivorans DSM
           12260]
 gi|310783378|gb|EFQ23776.1| riboflavin synthase, alpha subunit [Aminomonas paucivorans DSM
           12260]
          Length = 230

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 116/201 (57%), Gaps = 9/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM---RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTG+V   G++  + P A+G+    L   T++  S +K G S+  +G CLTVV + +  
Sbjct: 1   MFTGLVEATGRVRNLRPEARGLWSLALETETAFCES-LKAGDSVCVSGACLTVVGMGK-- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                ++ ++ AET+R T + +   G  +NLER++ LG RLDGHLV GH++G   +   +
Sbjct: 58  ---GIFQAQMMAETHRRTTLGTLRPGDRVNLERALALGGRLDGHLVQGHVEGVGTLERGE 114

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G +     SLP  L  F+  KGSV ++GVSLTV   G+  F V LI  T++ TT +  
Sbjct: 115 DEGPTRLLTFSLPPELVPFLVSKGSVAVDGVSLTVIEAGRERFSVGLIPTTLQGTTLQGL 174

Query: 178 KVGDLINIEVDSMMRYIARLY 198
           K GD +N+E D + RY+ R +
Sbjct: 175 KRGDRVNLETDLVGRYLYRFW 195


>gi|50843211|ref|YP_056438.1| riboflavin synthase subunit alpha [Propionibacterium acnes
           KPA171202]
 gi|289424986|ref|ZP_06426765.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK187]
 gi|289427692|ref|ZP_06429404.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J165]
 gi|50840813|gb|AAT83480.1| riboflavin synthase alpha chain [Propionibacterium acnes KPA171202]
 gi|289154685|gb|EFD03371.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK187]
 gi|289159183|gb|EFD07375.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J165]
 gi|332676150|gb|AEE72966.1| riboflavin synthase alpha chain RibE [Propionibacterium acnes 266]
          Length = 199

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 1   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 58  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 116 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 176 DEVNVEVDIIAKYLEAL 192


>gi|313904566|ref|ZP_07837941.1| riboflavin synthase, alpha subunit [Eubacterium cellulosolvens 6]
 gi|313470536|gb|EFR65863.1| riboflavin synthase, alpha subunit [Eubacterium cellulosolvens 6]
          Length = 224

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +       R+R+  S    + ++G SIA  GICLTV  L+      
Sbjct: 1   MFTGIIEETGVVERLELRGSSGRIRIRASKVLEETRIGDSIAVNGICLTVTDLA-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +E +V AET R +++ S G    +NLER+++   R  GH+V+GHIDG   I  +    
Sbjct: 56  NSFEADVMAETVRRSSLGSLGNHDRVNLERAMRADSRFGGHIVTGHIDGCGVIRSMKREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ R+  P  L + I  KGS+ ++G+SLTV  V +N F V +I HT EETT    K G
Sbjct: 116 NAIWVRIVPPEGLLRGIVEKGSIAIDGISLTVAEVDENGFAVSVIPHTGEETTLLGKKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +Y+ +L
Sbjct: 176 DPVNLETDILGKYVEKL 192


>gi|254797186|ref|YP_003082026.1| riboflavin synthase, alpha subunit [Neorickettsia risticii str.
           Illinois]
 gi|254590424|gb|ACT69786.1| riboflavin synthase, alpha subunit [Neorickettsia risticii str.
           Illinois]
          Length = 200

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 111/198 (56%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF GIV  +G +  ++   + + L V        ++LG S+A  G+CLTV  ++     +
Sbjct: 1   MFKGIVQTLGLVTKLSMRDREICLVVDAKELAQNVELGSSVACNGVCLTVTSIT-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
              E  V  ET   TN  +   G+ +NLE S+++GD LDGH V GH+D T  I  ++  G
Sbjct: 56  TELEFYVSQETFSRTNFHALEEGSKVNLETSLRIGDTLDGHFVQGHVDETTTITAIEKTG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S     +L   +  FI  KGSVC++G SLTVN V +N F V +I +T   T +  +KVG
Sbjct: 116 ESHVFTFALTEGISPFITYKGSVCIDGTSLTVNEVFENKFSVNIIPYTWSHTIFHSNKVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + RY+ RL+
Sbjct: 176 DKVNVESDLLARYLKRLF 193


>gi|283765798|gb|ADB28291.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765806|gb|ADB28295.1| riboflavin synthase [uncultured Bartonella sp.]
 gi|283765810|gb|ADB28297.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 86/140 (61%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    +++G SIA +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLKQGVRLNIATRYAIESLEIGASIACSGICLTIVERGSKQADTSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INLERS++LGD + GH V GHIDG  EI+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTSINLERSLRLGDEVGGHFVLGHIDGLAEIIDQKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PTRFTSFIVNKGSIALNGTS 140


>gi|189424809|ref|YP_001951986.1| riboflavin synthase, subunit alpha [Geobacter lovleyi SZ]
 gi|189421068|gb|ACD95466.1| riboflavin synthase, alpha subunit [Geobacter lovleyi SZ]
          Length = 213

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G+++A+    +   L V      S++ +G SIA  G CLTVV +       
Sbjct: 1   MFTGLIECTGRVVALRRGGERAVLEVSAPLPVSEVCIGDSIAVNGACLTVVAMQ-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   T  A+   G+ +NLER+++LG RLDGHLV+GHID    +      G
Sbjct: 56  DRFSFDVSPETVTRTTFATLQPGSPVNLERALRLGGRLDGHLVTGHIDCVGRLESRTNQG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++    SLP    + +  KGSV ++G+SLTVN V  + F V +I HT+E+TT      G
Sbjct: 116 NAVVLEFSLPREQARMLVEKGSVAIDGISLTVNGVTDSGFSVSIIPHTLEKTTLAAVGPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + +Y+ARL
Sbjct: 176 KQVNIETDVIGKYVARL 192


>gi|56477455|ref|YP_159044.1| riboflavin synthase subunit alpha [Aromatoleum aromaticum EbN1]
 gi|56313498|emb|CAI08143.1| riboflavin synthase (alpha chain) [Aromatoleum aromaticum EbN1]
          Length = 201

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 118/201 (58%), Gaps = 9/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV   G+I  +  +  G+RL V     + + +++G SIA++G+CLTVV L      
Sbjct: 1   MFSGIVAACGRIERIEALQDGVRLIVDADGLDLADVQIGDSIANSGVCLTVVALD----- 55

Query: 60  DNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            +  + +V  ET N  T + +  +G  +NLE+++ L DRL GHLV+GH+DG  E++    
Sbjct: 56  GSRVQFDVSRETLNCTTGLDT--VGNEVNLEKALCLADRLGGHLVTGHVDGVGEVVSFTP 113

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +G+S    +  P  L  +IA KGS+ +NGVSLTVN V    F + LI HT+  T  K   
Sbjct: 114 VGESHDLVIRAPAALAGYIAKKGSITVNGVSLTVNRVEAREFSINLIPHTVAVTNLKQLA 173

Query: 179 VGDLINIEVDSMMRYIARLYA 199
            G  +N+E+D + RY+ R+ A
Sbjct: 174 AGSRVNLEIDLIARYVERMLA 194


>gi|94498079|ref|ZP_01304642.1| riboflavin synthase alpha chain [Sphingomonas sp. SKA58]
 gi|94422514|gb|EAT07552.1| riboflavin synthase alpha chain [Sphingomonas sp. SKA58]
          Length = 204

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 114/207 (55%), Gaps = 11/207 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I +       +RL +   Y    + +G SIA +G CLTVV        D
Sbjct: 1   MFTGIITDIGTIRSHEQRGD-LRLVIGCGYAMDSVAIGASIACSGACLTVVDKG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V++ AET   T    W  G  +NLER++K+GD L GH+V+GH+D    ++     G
Sbjct: 55  DWFAVDLSAETVARTAPGLWQQGGRLNLERALKVGDELGGHIVTGHVDAVGHLVSAQSEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
           DS+   +  P  L   +A KGS+ L+G+SLTVN V     G   F + +I HT   TT  
Sbjct: 115 DSIRLVIRAPQALAAALAAKGSITLDGISLTVNSVEDQPDGSVDFGLNIIHHTTAATTLD 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNT 202
             + G   N+E+D + RY+ R+ AL +
Sbjct: 175 RLEDGRAFNLEIDVLARYLGRMQALRS 201


>gi|116511815|ref|YP_809031.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107469|gb|ABJ72609.1| Riboflavin synthase alpha chain [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 215

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++  +    K  +L +  S     +KLG SI+  G+CLTV   + +    
Sbjct: 1   MFTGIIEEVGEVTQIQKRDKSSKLSIRASSILEDLKLGDSISTNGLCLTVSAFNHKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ + +N+    +G+ +NLER+V L  R  GH+VSGHIDGT +IL +    
Sbjct: 58  --FTGDVMPESFKRSNLGELTVGSKVNLERAVALNGRFGGHIVSGHIDGTGKILSIKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    +L +++  KGS+ ++G+SLTV  V    F V +I HTI+ET     KVG
Sbjct: 116 NAVWFEVQTTVDLMKYVVEKGSITIDGISLTVAHVTSKSFSVSIIPHTIKETILSAKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +YI +L
Sbjct: 176 DKVNLENDILGKYIEKL 192


>gi|241763273|ref|ZP_04761330.1| riboflavin synthase, alpha subunit [Acidovorax delafieldii 2AN]
 gi|241367548|gb|EER61835.1| riboflavin synthase, alpha subunit [Acidovorax delafieldii 2AN]
          Length = 211

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 119/207 (57%), Gaps = 16/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI+T +G+I  + P+      G RL + T  N    + LG SIA  G C+TV  LS 
Sbjct: 1   MFTGIITGMGRIATVLPLGDSAVHGKRLTIETPDNYLDDVALGDSIALNGACMTVTTLSP 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  + V+V AE+ ++   +   G+   +NLE++++  DRL GH+VSGH+DG  ++ 
Sbjct: 61  SS---QQFTVDVSAESLDKTAGLDKPGV---VNLEKALRANDRLGGHMVSGHVDGLGDVT 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S   R+  P +L +++A KGS+ +NGVSLTVN +          + LI HT++
Sbjct: 115 HFAQVGESWELRVLAPRDLGRYLAYKGSITVNGVSLTVNRISDRPDGCEASINLIPHTVQ 174

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARL 197
            T     +VG  +N+EVD + RY+AR+
Sbjct: 175 NTALGELRVGSRVNLEVDLIARYVARM 201


>gi|333028401|ref|ZP_08456465.1| putative riboflavin synthase, alpha subunit [Streptomyces sp.
           Tu6071]
 gi|332748253|gb|EGJ78694.1| putative riboflavin synthase, alpha subunit [Streptomyces sp.
           Tu6071]
          Length = 206

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV    EH   
Sbjct: 1   MFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVV----EHE-G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GH+V GH+DGT  IL  +   
Sbjct: 56  AEFTADVMAETLKRSSLGALAPGSRVNLERPTPVGGRLGGHVVQGHVDGTGTILRREPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV     + F V LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEATDDTFSVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +N+EVD + +Y+ R+    T+ 
Sbjct: 176 APVNLEVDVLAKYVERMLRYGTAP 199


>gi|291562116|emb|CBL40932.1| riboflavin synthase, alpha subunit [butyrate-producing bacterium
           SS3/4]
          Length = 232

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A++       L V         K+G SIA  G+CLTV  +      +
Sbjct: 1   MFTGIVEELGQVKALSLRGNSGTLTVKAKKVLEGTKIGDSIAVNGVCLTVTNMK-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V AET R +++ +   G+++NLER++    R  GH+VSGHIDGT +I  +    
Sbjct: 56  NEFSADVMAETVRRSSLGALQDGSYVNLERAMAADGRFGGHIVSGHIDGTGQIESMRREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  ++    +   I  KGS+C++G+SLTV  V K  F V +I HT EETT    K G
Sbjct: 116 NAVWVTIACADKILDLIVEKGSICIDGISLTVAAVTKRNFSVSVIPHTGEETTLLKKKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +YI + 
Sbjct: 176 DPVNLENDIVGKYIQKF 192


>gi|283765812|gb|ADB28298.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 87/140 (62%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    +++G SIA +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLVQGVRLNIATRYAVESLEIGASIACSGICLTIVERGSKQANTSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  +I+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTCINLERSLRLGDEVGGHLVLGHIDGLADIIDKKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PTRFTSFIVNKGSIALNGTS 140


>gi|313835936|gb|EFS73650.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL037PA2]
 gi|314927221|gb|EFS91052.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL044PA1]
 gi|314970654|gb|EFT14752.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL037PA3]
          Length = 204

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLT+  L E     
Sbjct: 6   MFTGIIEEIGEVLAIERGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTITELDE----- 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +V AET   T +     G  +NLER V +GDRL GH+V GH+DGT E++      
Sbjct: 61  DFFGCDVMAETLNRTALGHLAAGIRVNLERPVSVGDRLGGHIVQGHVDGTAELVSRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R ++P  L ++I  KGS+ +NG SLTV  V   +F+V LI  T+  T      +G
Sbjct: 121 HWEVFRFTVPTILSRYITEKGSIAINGTSLTVCAVTPEWFEVSLIPATLTGTVLGALTLG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 181 DEVNVEVDVIAKYLEAL 197


>gi|328906121|gb|EGG25896.1| riboflavin synthase, alpha subunit [Propionibacterium sp. P08]
          Length = 199

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLT+  L E     
Sbjct: 1   MFTGIIEEIGEVLAIERGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTITELDE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +V AET   T +     G  +NLER V +GDRL GH+V GH+DGT E++      
Sbjct: 56  DFFGCDVMAETLNRTALGHLAAGIRVNLERPVSVGDRLGGHIVQGHVDGTAELVSRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R ++P  L ++I  KGS+ +NG SLTV  V   +F+V LI  T+  T      +G
Sbjct: 116 HWEVFRFTVPTILSRYITEKGSIAINGTSLTVCAVTPEWFEVSLIPATLTGTVLGALTLG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 176 DEVNVEVDVIAKYLEAL 192


>gi|330445268|ref|ZP_08308920.1| riboflavin synthase, alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489459|dbj|GAA03417.1| riboflavin synthase, alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 218

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 113/200 (56%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT---SYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+   G I A+TP  KG  + V       + + +KLG SIA  G+CLTVV L+   
Sbjct: 1   MFTGIIEATGTITALTP--KGADISVTVDSGKLDLADVKLGDSIATNGVCLTVVALT--- 55

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                Y  ++  ET + T  A +  G  +NLE+++    R  GH+VSGH+D   EI+   
Sbjct: 56  --GKGYVADLSLETIKRTAFADYKAGQVVNLEKAMLPTTRFGGHMVSGHVDAVAEIIERH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   +  P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT    
Sbjct: 114 QTGRAIEFWVKAPAHLAKYISEKGSVAVDGISLTVNEINGDEFKLTIVPHTALETTMDAF 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           K G  IN+EVD + RY+ RL
Sbjct: 174 KPGRKINLEVDVIARYLERL 193


>gi|303245572|ref|ZP_07331855.1| riboflavin synthase, alpha subunit [Desulfovibrio fructosovorans
           JJ]
 gi|302492835|gb|EFL52700.1| riboflavin synthase, alpha subunit [Desulfovibrio fructosovorans
           JJ]
          Length = 217

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G++ AM       R R+   ++   + +G SIA  G CLTV     E + D
Sbjct: 1   MFTGLVMGLGRVAAMDARGDETRFRIQALFDLDNIVIGESIAVNGACLTV-----ETAKD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +     AET   + +     G+ +NLER++ LGDRL GHLVSGH+D    +  +  +G
Sbjct: 56  REFTAYASAETLSKSGLGKLKPGSQVNLERALALGDRLGGHLVSGHVDCLAAVESVTRLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+  +++ P     F+  KGSV L+GVSLTVN  G  F  V +I  T   TT    K G
Sbjct: 116 QSVRYKITFPEEFSPFVVPKGSVALDGVSLTVNDCGDGFLTVNVIPSTQGATTIAAWKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ R+
Sbjct: 176 VSLNMETDMLGKYVLRM 192


>gi|327403718|ref|YP_004344556.1| riboflavin synthase subunit alpha [Fluviicola taffensis DSM 16823]
 gi|327319226|gb|AEA43718.1| riboflavin synthase, alpha subunit [Fluviicola taffensis DSM 16823]
          Length = 195

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 113/197 (57%), Gaps = 8/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G I+A+      +   V ++  T ++K+  S+AH G CLTVV+L       
Sbjct: 1   MFTGIIETLGTIVAIEKDQSNVHFTVESTI-THELKIDQSVAHNGCCLTVVKLD-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET   TN++ W +G+ +NLER + LG RLDGH+V GH+D T     ++ + 
Sbjct: 55  DSYVVTAIQETLDKTNLSDWEVGSKVNLERCMLLGARLDGHIVQGHVDTTATCSAIEDLN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   + +  ++ +Q    KGS+ +NGVSLTV    K  F V +I +T E T +   KVG
Sbjct: 115 GSW--KYTFHYDFDQPTVAKGSITVNGVSLTVVDSEKGLFSVCIIPYTQEHTNFHAFKVG 172

Query: 181 DLINIEVDSMMRYIARL 197
             IN+E D + +Y+ARL
Sbjct: 173 TKINLEFDIIGKYVARL 189


>gi|58696867|ref|ZP_00372383.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536920|gb|EAL60098.1| riboflavin synthase, alpha subunit [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 198

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 101/158 (63%), Gaps = 5/158 (3%)

Query: 40  SIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLD 99
           SIA  G+CLTVV +  + S      V+   E  ++ N+ +W IG  INLE++++L D++D
Sbjct: 40  SIACCGVCLTVVDILSDTST-----VQASQELMKVVNLNTWRIGKKINLEQAMRLSDKID 94

Query: 100 GHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF 159
           GHLV GH+DG V+ L ++   DS   +LS P  L +F+A K SV L+GVSLTVN V    
Sbjct: 95  GHLVQGHVDGIVKFLTINQNLDSHEIKLSCPQELIKFVAKKSSVTLDGVSLTVNSVVNQE 154

Query: 160 FDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           F V +  +T E TT++ +KV D +N+E+D + RY+ +L
Sbjct: 155 FTVNITPYTWENTTFQYNKVNDYLNLEIDMIARYLDQL 192


>gi|319794178|ref|YP_004155818.1| riboflavin synthase, alpha subunit [Variovorax paradoxus EPS]
 gi|315596641|gb|ADU37707.1| riboflavin synthase, alpha subunit [Variovorax paradoxus EPS]
          Length = 221

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 122/208 (58%), Gaps = 17/208 (8%)

Query: 1   MFTGIVTDIGKIIAM----TPIAKGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI+T +G+I A+    T  + G RL +         + LG SIA  G C+TV  L  
Sbjct: 1   MFTGIITGVGRIAAIHDLGTSSSYGKRLSIAVPDGYLDDVGLGDSIALNGACMTVTTLVP 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           E  +   + +++ AE+ ++   +   G  + INLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  EQQL---FTIDISAESLDKTAGLTDEG--SRINLEKALRASDRLGGHIVSGHVDGIGTVS 115

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD-----VLLIRHTI 169
           F + +G+S   R+  P  L +F+A KGS+ +NGVSLTVN V K+  D     + LI HT+
Sbjct: 116 FFEPVGESWELRVVAPPALARFLAYKGSITINGVSLTVNSV-KDIEDGAEISINLIPHTV 174

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARL 197
           + T+    K G  +N+E+D++ RY+ R+
Sbjct: 175 DNTSLGGLKAGSKVNLEIDTVARYVERM 202


>gi|314924236|gb|EFS88067.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL001PA1]
 gi|314964910|gb|EFT09009.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL082PA2]
 gi|314982173|gb|EFT26266.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA3]
 gi|315090404|gb|EFT62380.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA4]
 gi|315093790|gb|EFT65766.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL060PA1]
 gi|315103909|gb|EFT75885.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL050PA2]
 gi|327325609|gb|EGE67408.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL103PA1]
          Length = 204

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++      
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVSRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP +L +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPADLSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 181 DEVNVEVDIIAKYLEAL 197


>gi|15672976|ref|NP_267150.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723938|gb|AAK05092.1|AE006333_9 ribiflavin synthase alpha chain [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406538|gb|ADZ63609.1| riboflavin synthase alpha chain [Lactococcus lactis subsp. lactis
           CV56]
          Length = 216

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 115/199 (57%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++  +    K  ++ +  S     MKLG SI+  G+CLTV   +++    
Sbjct: 1   MFTGIIEELGEVSRLQKREKSFKISIRASLILEDMKLGDSISTNGLCLTVSEFNQKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  E+   +N+ +  +G  +NLER++ L  R  GH+VSGHIDG  +IL +    
Sbjct: 58  --FTADIMPESLNRSNLGTLNVGAKVNLERAMPLNGRFGGHIVSGHIDGVGQILEVKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    NL ++   KGS+ ++G+SLTV  V    F V +I HT++ET     KVG
Sbjct: 116 NAIWFEIKTSLNLMRYTVEKGSITIDGISLTVAQVKSKSFSVSIIPHTLKETIMADKKVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +YI +L+ 
Sbjct: 176 DTVNLENDILGKYIEKLWG 194


>gi|89073131|ref|ZP_01159670.1| riboflavin synthase subunit alpha [Photobacterium sp. SKA34]
 gi|89051084|gb|EAR56541.1| riboflavin synthase subunit alpha [Photobacterium sp. SKA34]
          Length = 218

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 115/200 (57%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS---YNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  IG I A+TP  KG  + V       + S +KLG SIA  G+CLTVV+L+ + 
Sbjct: 1   MFTGIIEAIGTITALTP--KGADISVTVDSGDLDLSDVKLGDSIATNGVCLTVVKLTGK- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                Y  ++  ET + T    +  G   NLE+++    R  GH+VSGH+D   EI+   
Sbjct: 58  ----GYIADLSLETLKRTAFVHYQAGQVANLEKAMLPTTRFGGHMVSGHVDAVAEIIERH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   + +P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT    
Sbjct: 114 HTGRAIEFWVKVPAHLAKYISEKGSVSVDGISLTVNEINGDEFKLTIVPHTALETTMDAF 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
             G +IN+EVD + RY+ RL
Sbjct: 174 TPGRMINLEVDVIARYLERL 193


>gi|189500550|ref|YP_001960020.1| riboflavin synthase subunit alpha [Chlorobium phaeobacteroides BS1]
 gi|189495991|gb|ACE04539.1| riboflavin synthase, alpha subunit [Chlorobium phaeobacteroides
           BS1]
          Length = 218

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 111/204 (54%), Gaps = 11/204 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT----SKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV DIG I A+   ++G  LR+   Y      + + +  S+A  G C TVV L   
Sbjct: 1   MFTGIVKDIGTIAAIR--SQGTSLRITVRYKNRHEFNDLAIDESVAINGACQTVVALG-- 56

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
              D  ++V+   ET + T +  +  G  +NLER+V+  DRL GH V GH+D    +L +
Sbjct: 57  ---DGTFDVDTIGETLKKTTLGYFVPGVSVNLERAVRPSDRLGGHFVQGHVDCVGTVLGV 113

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
             +G S   R+S P     FI   GS+ ++GVSLTV  V  N F V +I +T E TT   
Sbjct: 114 YDLGGSREIRISFPDEFMPFIVPVGSIAIDGVSLTVANVKANSFSVAIIPYTFENTTINN 173

Query: 177 HKVGDLINIEVDSMMRYIARLYAL 200
            K GD +N+E D + +YIAR  +L
Sbjct: 174 LKDGDRLNLEFDILGKYIARQQSL 197


>gi|254392898|ref|ZP_05008066.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|294811514|ref|ZP_06770157.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|326440098|ref|ZP_08214832.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|197706553|gb|EDY52365.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|294324113|gb|EFG05756.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
          Length = 211

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +  +    R R+     T   + G SIA  G+CLTVV    +H  D
Sbjct: 1   MFTGIVEELGQVTGVETLGDSARFRLRGPLVTDGARHGDSIAVNGVCLTVV----DHG-D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G  +NLER   +G RL GH+V GH+DG   I+      
Sbjct: 56  GEFTADVMAETLKRSSLGALAPGDRVNLERPTPVGGRLGGHVVQGHVDGVGTIVERAPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP  L +++  KGS+ ++GVSLTV  VG++ F V LI  T+  TT  +   G
Sbjct: 116 HWELVTVSLPAPLARYVVEKGSITVDGVSLTVVSVGEDRFTVSLIPTTLALTTLGVKGTG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD + +Y+ RL
Sbjct: 176 DPVNIEVDVIAKYVERL 192


>gi|260893813|ref|YP_003239910.1| riboflavin synthase, alpha subunit [Ammonifex degensii KC4]
 gi|260865954|gb|ACX53060.1| riboflavin synthase, alpha subunit [Ammonifex degensii KC4]
          Length = 216

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  +T      ++ +        +++G S+A  G CLTV RL       
Sbjct: 1   MFTGLVEEVGRVRRITRGPASAQIEIEARRVLEDLRVGDSVAVNGACLTVTRLGP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +  AET R TN+   G G  +NLER+++L DRL GHLV+GH+DG  +IL  +   
Sbjct: 56  GGFWADAMAETLRRTNLGELGPGDKVNLERALRLSDRLGGHLVTGHVDGVGKILRKEKED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    ++ P  +  ++  KGSV ++GVSLTV  V  + F V LI HT E TT  +   G
Sbjct: 116 VAWVLSIAAPPQVTPYLIEKGSVAVDGVSLTVVEVKGDVFKVSLIPHTAEHTTLGLKGPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +Y+ R 
Sbjct: 176 DKVNLEADLIGKYVRRF 192


>gi|56963576|ref|YP_175307.1| riboflavin synthase subunit alpha [Bacillus clausii KSM-K16]
 gi|56909819|dbj|BAD64346.1| riboflavin synthase alpha subunit RibB [Bacillus clausii KSM-K16]
          Length = 214

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 111/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+ +++   K M L V      +   +G SIA  G+CLTV  +SE     
Sbjct: 1   MFTGIIEEMGKVASVSKKGKAMTLAVNCKTVLADAAIGDSIAVNGVCLTVTAISE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +V  ET   T I     G F+NLER++ +G R  GH++SGH+DG   I     + 
Sbjct: 56  SQFQADVMPETYEATTIKQLVPGQFVNLERAMAVGSRFGGHIISGHVDGVGTIQKRQPVE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +     L ++I  KGS+ ++G SLTV  V    F + +I HT+E T     K G
Sbjct: 116 NAVLFEVEADRELVRYIVQKGSIAVDGTSLTVFAVTDTSFTISIIPHTLEMTIMGTKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ +L A   S
Sbjct: 176 DHVNLECDIIGKYVEKLLAPKES 198


>gi|212638857|ref|YP_002315377.1| riboflavin synthase subunit alpha [Anoxybacillus flavithermus WK1]
 gi|212560337|gb|ACJ33392.1| Riboflavin synthase alpha chain [Anoxybacillus flavithermus WK1]
          Length = 215

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  M    + +   +        ++LG SIA  G+CLTV   +     D
Sbjct: 4   MFTGIIEEIGTIQQMKQTGEAIVFTIGAQKVLQDVQLGDSIAVNGVCLTVTSFT-----D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R T++ +  +G  +NLER++    R  GH VSGH+DG   I+    + 
Sbjct: 59  RLFTVDVMPETVRATSLRTLTVGAKVNLERAMAANGRFGGHFVSGHVDGIGRIVRKQPVA 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P +L +++ +KGSV ++G SLT+  +    F + LI HT E T     KVG
Sbjct: 119 NAVYYDIEVPSHLRKYMILKGSVAVDGTSLTIFGLTDRTFTISLIPHTREATILGAKKVG 178

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIE D + +Y+ + 
Sbjct: 179 DIVNIECDIIGKYVEQF 195


>gi|282855093|ref|ZP_06264425.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J139]
 gi|282581681|gb|EFB87066.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J139]
          Length = 199

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 1   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++      
Sbjct: 58  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVSRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP +L +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 116 HWEVFRFALPADLSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 176 DEVNVEVDIIAKYLEAL 192


>gi|237796323|ref|YP_002863875.1| riboflavin synthase, alpha subunit [Clostridium botulinum Ba4 str.
           657]
 gi|229262803|gb|ACQ53836.1| riboflavin synthase, alpha subunit [Clostridium botulinum Ba4 str.
           657]
          Length = 228

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + +G S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHISIEGSKVLNPLNIGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLT-VNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +    +    NL +++  KGSV L+GVSLT V++ GK+ F V LI HTIEET      +
Sbjct: 128 IATLLEIKAKQNLLKYMIPKGSVALDGVSLTLVDIKGKS-FTVSLIPHTIEETILVNKNI 186

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD+INIE D + +YI +   L   +
Sbjct: 187 GDIINIECDVLGKYIYKFMYLKKEE 211


>gi|156946250|gb|ABU98313.1| RibE [Photobacterium leiognathi subsp. mandapamensis]
          Length = 219

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+      + + + T+  + S +KLG SIA  G+CLTV +L+     
Sbjct: 1   MFTGIIEAVGNISAIIRNNDDISMVINTNRLDISDVKLGDSIASNGVCLTVSKLTP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + T   S+ +G  INLE+++    R  GH+VSGH+DG  +I+ L   
Sbjct: 57  -TGFVADLSTETLKRTAFHSYHVGQKINLEKAMLPTTRFGGHIVSGHVDGIGDIIELKRK 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L++F++ KGSVC++G SLTVN V +N   + +I HT+  TT     +
Sbjct: 116 GRTLDMWITVPIHLKKFVSEKGSVCIDGTSLTVNAVYQNVIKLTIIPHTLANTTLANATI 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
              +NIE D M RY+ RL +++  +
Sbjct: 176 DQKVNIEADMMARYLERLISIDKQE 200


>gi|19552808|ref|NP_600810.1| riboflavin synthase subunit alpha [Corynebacterium glutamicum ATCC
           13032]
 gi|62390478|ref|YP_225880.1| riboflavin synthase subunit alpha [Corynebacterium glutamicum ATCC
           13032]
 gi|21324365|dbj|BAB98989.1| Riboflavin synthase alpha chain [Corynebacterium glutamicum ATCC
           13032]
 gi|41325815|emb|CAF21604.1| PUTATIVE RIBOFLAVIN SYNTHASE [Corynebacterium glutamicum ATCC
           13032]
          Length = 211

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +  +   +R+++  S     + LG SI+  G+CLTV    E H   
Sbjct: 1   MFTGIVEELGSVAGVEHLGDSIRMQISASTVLEGVHLGDSISVNGVCLTVASFGEGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  ET   +++ +   G+ +NLER++    RL GH++ GH+D T  ++      
Sbjct: 58  --FTADLMQETLDRSSLGALSTGSKVNLERAMAADGRLGGHIMQGHVDATTSLIKRTSSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R  LP +L +++  KGS+ LNG SLTV+ +G ++F+V LI  T+ +TT     VG
Sbjct: 116 NWDVLRFELPADLARYVVEKGSIALNGTSLTVSSLGDDWFEVSLIPTTLRDTTHGELAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIEVD + +Y+ R+
Sbjct: 176 DIVNIEVDVIAKYVERM 192


>gi|302517923|ref|ZP_07270265.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB78]
 gi|302426818|gb|EFK98633.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB78]
          Length = 230

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV    EH   
Sbjct: 25  VFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVV----EHE-G 79

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GHLV GH+DGT  IL  +   
Sbjct: 80  AEFTADVMAETLKRSSLGALAAGSRVNLERPTPVGGRLGGHLVQGHVDGTGTILRREPSE 139

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV     + F V LI  T+  TT    + G
Sbjct: 140 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEATDDTFSVSLIPTTLALTTLGHKQPG 199

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +N+EVD + +Y+ R+    T+ 
Sbjct: 200 APVNLEVDVLAKYVERMLRYGTAP 223


>gi|158522089|ref|YP_001529959.1| riboflavin synthase, alpha subunit [Desulfococcus oleovorans Hxd3]
 gi|158510915|gb|ABW67882.1| riboflavin synthase, alpha subunit [Desulfococcus oleovorans Hxd3]
          Length = 216

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 109/195 (55%), Gaps = 6/195 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIA-KGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   G+I  + P A +G R+ V   +     K+G SIA  G CLTVV +      
Sbjct: 1   MFTGIVEGFGQIKDLRPSADRGRRICVEAGFAVDDTKVGDSIAVNGACLTVVTIEGRR-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E +V  ET   T + +   G  +NLER+++  DRL GHLV+GHIDGT  I      
Sbjct: 59  ---FEADVAPETLSKTTLGNLRAGEKVNLERALRFSDRLGGHLVTGHIDGTGVIQSKKNT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+++   + LP +L +++  KGSV ++G+SLT+N        + +I HT+  TT  +   
Sbjct: 116 GNAVLVTIGLPRDLGRYMVKKGSVAVDGISLTINDCSPTHVALSIIPHTVSITTIGLRNS 175

Query: 180 GDLINIEVDSMMRYI 194
           GD +NIE D + +Y+
Sbjct: 176 GDAVNIETDIIGKYV 190


>gi|237654562|ref|YP_002890876.1| riboflavin synthase subunit alpha [Thauera sp. MZ1T]
 gi|237625809|gb|ACR02499.1| riboflavin synthase, alpha subunit [Thauera sp. MZ1T]
          Length = 202

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 116/198 (58%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV  +G+I  +  +A G+R+ V T+  + S + +G S+AH+G+CLTVV +      
Sbjct: 1   MFSGIVAAVGRIEHVEALADGVRITVDTNGLDLSDVIVGDSVAHSGVCLTVVEMDGPR-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +V  ET   T +    +G  +NLE+S++L DRL GHLV+GH+D   E++    I
Sbjct: 59  ---LRYDVSRETLNCT-VGLDAVGGEVNLEKSLRLADRLGGHLVTGHVDSVGEVVKFAPI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  +  +IA KGSV +NGVSLTVN V    F + LI HT+  T  K    
Sbjct: 115 GESHELVIRAPAAIAGYIAKKGSVTVNGVSLTVNRVEGRDFWINLIPHTVAVTNLKHLAP 174

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ R+
Sbjct: 175 GSKVNLEIDLIARYVERM 192


>gi|145295717|ref|YP_001138538.1| riboflavin synthase subunit alpha [Corynebacterium glutamicum R]
 gi|140845637|dbj|BAF54636.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 211

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +  +   +R+++  S     + LG SI+  G+CLTV    E H   
Sbjct: 1   MFTGIVEELGSVAGVEHLGDSIRMQISASTVLEGVHLGDSISVNGVCLTVASFDEGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  ET   +++ +   G+ +NLER++    RL GH++ GH+D T  ++      
Sbjct: 58  --FTADLMQETLDRSSLGALSTGSKVNLERAMAADGRLGGHIMQGHVDATTTLIKRTSSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R  LP +L +++  KGS+ LNG SLTV+ +G ++F+V LI  T+ +TT     VG
Sbjct: 116 NWDVLRFELPADLARYVVEKGSIALNGTSLTVSSLGDDWFEVSLIPTTLRDTTHGELAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIEVD + +Y+ R+
Sbjct: 176 DIVNIEVDVIAKYVERM 192


>gi|16125139|ref|NP_419703.1| riboflavin synthase subunit alpha [Caulobacter crescentus CB15]
 gi|221233867|ref|YP_002516303.1| riboflavin synthase subunit alpha [Caulobacter crescentus NA1000]
 gi|13422149|gb|AAK22871.1| riboflavin synthase, alpha subunit [Caulobacter crescentus CB15]
 gi|220963039|gb|ACL94395.1| riboflavin synthase alpha chain [Caulobacter crescentus NA1000]
          Length = 205

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 112/204 (54%), Gaps = 13/204 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GI+  +G++ A+TP A G +RL + T Y    ++LG S+A  G+CLTVVR    H  
Sbjct: 1   MFSGIIERVGRVEAVTPEAGGALRLSLATGY--PDLELGESVAVNGVCLTVVR----HDP 54

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
               +  V  ET   TN+     G  +NLER+V L  RL GHLV GH+DG   ++     
Sbjct: 55  GGEADFFVSPETLDRTNLGGARAGHSVNLERAVTLSTRLSGHLVQGHVDGLARLIERHDD 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD------VLLIRHTIEETT 173
           G +     SLP  L +F   KGS+ LNGVSLT+N VG    D      + LI HT   T 
Sbjct: 115 GGAWRVVFSLPAGLHRFCVEKGSIALNGVSLTLNTVGACAPDGRFAVGLTLIPHTWTHTN 174

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
            +   + D +N+EVD + +Y+ +L
Sbjct: 175 LQHLALNDPVNVEVDVLAKYVEQL 198


>gi|257067229|ref|YP_003153484.1| riboflavin synthase, alpha subunit [Brachybacterium faecium DSM
           4810]
 gi|256558047|gb|ACU83894.1| riboflavin synthase, alpha subunit [Brachybacterium faecium DSM
           4810]
          Length = 204

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 110/199 (55%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G + ++T  A   RLR+ +      + LG SIA +G CLTV      H   
Sbjct: 1   MFTGIIEELGTVESLTLGADPARLRIRSPQVLEGIALGDSIAVSGCCLTVT----AHEGG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W   +V + T   T++     G  +NLER V+   RLDGH+V GH+DG   +   +   
Sbjct: 57  SWT-ADVISTTLAATSLGDLAAGDRVNLERCVRADGRLDGHIVQGHVDGVGTVTGREEAD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   RL+LP  L +++  KGS+ ++GVSLTV  +      + LI  T+  TT  +  VG
Sbjct: 116 GTTLLRLALPAGLSRYVVAKGSLAVDGVSLTVAAIDGEEVTLGLIPETLSRTTLGVRAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ +L A
Sbjct: 176 DRVNLEVDVLAKYVEKLTA 194


>gi|168181551|ref|ZP_02616215.1| riboflavin synthase, alpha subunit [Clostridium botulinum Bf]
 gi|182675175|gb|EDT87136.1| riboflavin synthase, alpha subunit [Clostridium botulinum Bf]
          Length = 228

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + +G S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHISIEGSKVLNPLNIGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLT-VNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +    +    NL +++  KGSV L+GVSLT V++ GK+ F V LI HTIEET      +
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKGKS-FTVSLIPHTIEETILVNKNI 186

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD+INIE D + +YI +   L   +
Sbjct: 187 GDIINIECDVLGKYIYKFMYLKKEE 211


>gi|227503569|ref|ZP_03933618.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49725]
 gi|227075605|gb|EEI13568.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49725]
          Length = 200

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + A+   A  +RL +      S  +LG SIA  G+CLT+  L       
Sbjct: 1   MFTGLVQELGTVAALEQQADALRLSIRAPQTVSDARLGDSIAINGVCLTIAELD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  E+   T +     G  +N+E ++    RL GH++ GH+DGT  ++  +   
Sbjct: 56  DIFCADVMQESLDRTGLGQLKEGARVNVEPALLPTTRLGGHMMQGHVDGTARLVSREHSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SL  +L +++  KGS+ +NG SLTV+ VG+++F+V LI  T+ ETT    +VG
Sbjct: 116 HWDVLRFSLSRDLARYVVEKGSIAVNGTSLTVSAVGEDWFEVSLIPTTLRETTHGESQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+EVD + +Y+ ++
Sbjct: 176 DIVNLEVDVLAKYVEKM 192


>gi|167563754|ref|ZP_02356670.1| riboflavin synthase subunit alpha [Burkholderia oklahomensis EO147]
 gi|167574217|ref|ZP_02367091.1| riboflavin synthase subunit alpha [Burkholderia oklahomensis C6786]
          Length = 209

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 120/209 (57%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + PIA     G+RL +     + + + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIETIEPIASSPDAGVRLELRAGGLDLADVALGDSIAIQGACMTVVAKTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                + ++VEV  E+ N+   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----DTFDVEVSRESLNKTVGLAEPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRVLAPRELGRYLAYKGSITVNGVSLTVNSVEDRDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +  K G  +N+E+D + RY  R+ +
Sbjct: 173 VTTLRHLKAGAKVNLEIDMIARYTERILS 201


>gi|309780820|ref|ZP_07675561.1| riboflavin synthase, alpha subunit [Ralstonia sp. 5_7_47FAA]
 gi|308920502|gb|EFP66158.1| riboflavin synthase, alpha subunit [Ralstonia sp. 5_7_47FAA]
          Length = 217

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 117/206 (56%), Gaps = 16/206 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  ++P+      G+RL +       + + LG SIA  G C+TVV    
Sbjct: 1   MFTGIVAAVGRIETVSPLGDNADAGVRLSIDAGGLPLADVALGDSIAIQGACMTVVA--- 57

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               DN +EV+V  E+   T +   G G  +NLE++++L D + GHLVSGH+DG   +  
Sbjct: 58  --KADNRFEVDVSRESLSKT-VGLEGPGE-VNLEKALRLADHIGGHLVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIEE 171
              + +S   R+  P  L +++A KGSV +NGVSLTVN V  +     F + LI HT+  
Sbjct: 114 FAPVNESHELRVRAPAELGKYLAYKGSVVVNGVSLTVNTVRDDADGCEFSINLIPHTVAV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           TT K  K G  +N+E+D + RY+ R+
Sbjct: 174 TTLKHLKAGSQVNLEIDLIARYVERM 199


>gi|170783176|ref|YP_001711510.1| riboflavin synthase subunit alpha [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169157746|emb|CAQ02948.1| riboflavin synthase alpha chain [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 224

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 115/211 (54%), Gaps = 12/211 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G+++A+       R+ V      S  + G SI+  G+CLTVV  + E    
Sbjct: 2   MFTGIIEERGRVLALDAEGDSARITVEAPLAVSDARHGDSISVDGVCLTVVAQTPE---- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  +T  ++++   G+G  +NLER+ ++GDRL GH+V GH+DGT  +L      
Sbjct: 58  -GFTADVMRQTLVMSSLGRLGVGDRVNLERAARVGDRLGGHIVQGHVDGTGRLLATTPGE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-------FFDVLLIRHTIEETT 173
                R SLP  L   +  +GS+ + GVSLTV+ V          +F+V LI  T+  TT
Sbjct: 117 AWRILRFSLPAELSPLVVDRGSITVQGVSLTVSAVSPTDTPDADAWFEVSLIPETLAATT 176

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
               ++GD +N+E D + R++ R+ AL+  +
Sbjct: 177 LGALELGDEVNLETDVLARHVQRMLALDARR 207


>gi|46199006|ref|YP_004673.1| riboflavin synthase subunit alpha [Thermus thermophilus HB27]
 gi|46196630|gb|AAS81046.1| riboflavin synthase alpha chain [Thermus thermophilus HB27]
          Length = 194

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 112/199 (56%), Gaps = 11/199 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT--SKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTG+V + G+I+    + +G  LRV  +       +K+G S+A  G CLT V + E   
Sbjct: 1   MFTGLVEETGEILK---VEEGPFLRVYIAARKVLEDLKVGDSVAVDGACLTAVAVEE--- 54

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG   +  +  
Sbjct: 55  --GGFWVELAQETLRRTA-PTWRVGHRPNLERALKVGDRLGGHFVTGHVDGVARLWEVRE 111

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
              +       P  L  +IA KGSV LNGVSLTV  +    F V LI HT+E T     +
Sbjct: 112 APGAKDFYFLPPKALAPYIAEKGSVALNGVSLTVAGLAGEAFWVTLIPHTLEVTNLGRLR 171

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD + RY+ARL
Sbjct: 172 VGDGVNLEVDLIARYVARL 190


>gi|331270608|ref|YP_004397100.1| riboflavin synthase subunit alpha [Clostridium botulinum BKT015925]
 gi|329127158|gb|AEB77103.1| riboflavin synthase, alpha subunit [Clostridium botulinum
           BKT015925]
          Length = 216

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  +T      R+ +        + LG SI+  G+CLTV   S      
Sbjct: 1   MFTGIVEEIGTINTITSTKDAARITIDAKKILKDVSLGDSISTNGVCLTVTEYSR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +N+ S   G  +NLER++ LG R  GH+VSGHIDG   I       
Sbjct: 56  NNFTVDVMGETIRRSNLDSLKRGDKVNLERALALGGRFGGHIVSGHIDGVGTIKNFQHEA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + + I  KGS+ ++GVSLTV  +    F V +I HT  ETT    K G
Sbjct: 116 NAIWITIEASEEILKNIVFKGSIAIDGVSLTVADIDNEIFKVCIIPHTQSETTLTSKKSG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L  +  ++
Sbjct: 176 DKVNLECDVIAKYVEKLLQVKNNE 199


>gi|89894409|ref|YP_517896.1| riboflavin synthase subunit alpha [Desulfitobacterium hafniense
           Y51]
 gi|89333857|dbj|BAE83452.1| riboflavin synthase alpha chain [Desulfitobacterium hafniense Y51]
          Length = 214

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +  +    +L +  +      ++G SIA  GICLTVV++       
Sbjct: 1   MFTGIIEELGKVADLKVLPDSAQLTLEGTKVLEGTQIGDSIAVNGICLTVVKMQ-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V AET   TN+      T +NLER+++L  RL GHLVSGH+DG   I  +  +G
Sbjct: 56  NLFTVDVMAETLNKTNLKECSRETRVNLERALQLSTRLGGHLVSGHVDGVGTIQKITPVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     L  ++  KGS+ ++G+SLTV  +    F + LI HT +ETT     VG
Sbjct: 116 IARVFTIKAAPELLTYVLPKGSIAIDGISLTVVDLLPQAFTISLIPHTRQETTLGFKGVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E D + +Y+AR 
Sbjct: 176 DMVNLETDLIGKYVARF 192


>gi|28867919|ref|NP_790538.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851155|gb|AAO54233.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 220

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    +  
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYLP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|213969283|ref|ZP_03397421.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|301381787|ref|ZP_07230205.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061013|ref|ZP_07252554.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           K40]
 gi|302130535|ref|ZP_07256525.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213925961|gb|EEB59518.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|330964922|gb|EGH65182.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331018227|gb|EGH98283.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 220

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    +  
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYLP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|15077683|gb|AAK83292.1|AF364106_1 riboflavin synthetase [Photobacterium leiognathi subsp.
           mandapamensis]
 gi|156946241|gb|ABU98307.1| RibE [Photobacterium leiognathi subsp. mandapamensis]
          Length = 219

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+      + + + T+  + S +KLG SIA  G+CLTV +L+     
Sbjct: 1   MFTGIIEAVGNISAIIRNNDDISMVINTNRLDISDVKLGDSIASNGVCLTVSKLTP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + T   S+ +G  INLE+++    R  GH+VSGH+DG  +I+ L   
Sbjct: 57  -TGFVADLSTETLKRTAFHSYHVGQKINLEKAMLPTTRFGGHIVSGHVDGIGDIIELKRK 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L++F++ KGSVC++G SLT+N V +N   + +I HT+  TT     +
Sbjct: 116 GRTLDMWITVPIHLKKFVSEKGSVCIDGTSLTINAVYQNVIKLTIIPHTLANTTLANATI 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
              +NIE D M RY+ RL +++  +
Sbjct: 176 DQKVNIEADMMARYLERLISIDKQE 200


>gi|118617423|ref|YP_905755.1| riboflavin synthase subunit alpha [Mycobacterium ulcerans Agy99]
 gi|183982234|ref|YP_001850525.1| riboflavin synthase alpha chain RibC [Mycobacterium marinum M]
 gi|118569533|gb|ABL04284.1| riboflavin synthase alpha chain RibC [Mycobacterium ulcerans Agy99]
 gi|183175560|gb|ACC40670.1| riboflavin synthase alpha chain RibC [Mycobacterium marinum M]
          Length = 207

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 114/200 (57%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I   + +    RL +     T+    G SIA  G+CLTVV    E   D
Sbjct: 1   MFTGIVEELGEITDRSTLTDAARLTIRGPIVTADAGHGDSIAVNGVCLTVV----EVLAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +N+    +G+ +NLER+  +  RL GH+V GH+DGT EI+      
Sbjct: 57  GQFTADVMAETLNRSNLGELQVGSQVNLERAAAVNSRLGGHIVQGHVDGTGEIIARSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIQVPATVARYVVEKGSITVDGISLTVSDLGAQPRDWFEVSLIPTTRELTTLGQA 176

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  +N+EVD + +Y+ RL
Sbjct: 177 PVGTQVNLEVDVIAKYVERL 196


>gi|145588459|ref|YP_001155056.1| riboflavin synthase subunit alpha [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046865|gb|ABP33492.1| riboflavin synthase, alpha subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 205

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 115/208 (55%), Gaps = 20/208 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRL--RVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+T +G+I +  P   G+ L   V   Y    + LG SIA  G C+T         
Sbjct: 1   MFTGIITAVGQIKSTQPKGDGLHLVVEVPDGY-LDDVALGDSIAIQGACMTATNFE---- 55

Query: 59  VDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             N + +++  E+ N+   +   G    +NLE++++L DRL GHLVSGH+DG  ++    
Sbjct: 56  -GNTFALDISRESLNKTIGLDKTGP---VNLEKALRLNDRLGGHLVSGHVDGVGKVTHFS 111

Query: 118 FIGDSMY----CRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTI 169
            + +  Y     R+  P +L  F+A KGS+ +NGVSLTVN    +      D+ LI HT+
Sbjct: 112 QVANDAYGSWLLRIEAPKSLAGFLAYKGSIVVNGVSLTVNKTADSASACVVDINLIPHTL 171

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARL 197
           + TT  M + GD +N+EVD + RY+AR+
Sbjct: 172 QSTTLGMLRQGDAVNLEVDLIARYVARM 199


>gi|222478638|ref|YP_002564875.1| riboflavin synthase, alpha subunit [Halorubrum lacusprofundi ATCC
           49239]
 gi|222451540|gb|ACM55805.1| riboflavin synthase, alpha subunit [Halorubrum lacusprofundi ATCC
           49239]
          Length = 203

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 109/200 (54%), Gaps = 4/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRL---SEEH 57
           MFTGIV D G +   T    G+RLR+        +  G SI+ +G+CLTV      ++  
Sbjct: 1   MFTGIVEDTGTVRDRTETEDGLRLRIAVD-GFDDLHHGQSISVSGVCLTVEEYDTGTDNA 59

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D+W+EV + +ET   T +   G G  +N+ER++    R DGH+V GH+D   E+  ++
Sbjct: 60  DGDDWFEVFLASETVAKTYLGEIGAGDAVNVERAMPADGRFDGHVVQGHVDTVAEVTAIE 119

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +G+      S+P     ++  KGSV L+G+SLTV     + FDV +I  T E TT    
Sbjct: 120 RVGEDWRFTFSIPEGHGDYLVDKGSVTLDGISLTVAEKRTDEFDVAIIPTTYELTTLSEK 179

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VGD I++EVD + +Y+  +
Sbjct: 180 SVGDPIHLEVDVIAKYVENM 199


>gi|145224303|ref|YP_001134981.1| riboflavin synthase subunit alpha [Mycobacterium gilvum PYR-GCK]
 gi|315444636|ref|YP_004077515.1| riboflavin synthase, subunit alpha [Mycobacterium sp. Spyr1]
 gi|145216789|gb|ABP46193.1| riboflavin synthase, alpha subunit [Mycobacterium gilvum PYR-GCK]
 gi|315262939|gb|ADT99680.1| riboflavin synthase, alpha subunit [Mycobacterium sp. Spyr1]
          Length = 203

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 114/197 (57%), Gaps = 4/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+++ +  +    RL +     TS    G SIA  G+CLTVV +      D
Sbjct: 2   VFTGIVEELGEVVGVEDLGDSARLVIRGPIVTSDAGHGDSIAVNGVCLTVVDVL----AD 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++    +G  +NLER+  +  RL GH+V GH+DGT  I+      
Sbjct: 58  GSFSADVMAETLNRSSLRGVDVGARVNLERAAAINSRLGGHIVQGHVDGTGHIVSRTPSE 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R++LP  L +++  KGS+ ++GVSLTV+ +G ++F+V LI  T++ TT     VG
Sbjct: 118 HWTVVRIALPETLARYVVQKGSITVDGVSLTVSGLGPDWFEVSLIPTTLDMTTLGRAAVG 177

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + +Y+ RL
Sbjct: 178 APVNLEVDVIAKYVERL 194


>gi|314925875|gb|EFS89706.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL036PA3]
          Length = 204

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R + P  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFAPPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 181 DEVNVEVDIIAKYLEAL 197


>gi|325286181|ref|YP_004261971.1| riboflavin synthase subunit alpha [Cellulophaga lytica DSM 7489]
 gi|324321635|gb|ADY29100.1| riboflavin synthase, alpha subunit [Cellulophaga lytica DSM 7489]
          Length = 194

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 114/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ A+      + + + ++  T ++K+  S+AH G+CLTV+ +      D
Sbjct: 1   MFTGIIETLGKVTALRKEESNLHITIKSTL-TPELKIDQSVAHNGVCLTVIAIE-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET + T+I +  + +++NLER++ LG RLDGH+V GH+D T     ++   
Sbjct: 55  DTYTVTAIDETLQKTSIGALKVNSYVNLERAMILGTRLDGHIVQGHVDQTGVCTAIEEKD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +       KGS+ ++G SLTV   GKN F V +I +T E T +  +K+G
Sbjct: 115 GSAVFSFEYNADYNNVTIEKGSITIDGTSLTVFNSGKNTFSVAIIPYTFENTVFNTYKIG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
            ++N+E D + +Y+A+L A
Sbjct: 175 TVVNLEFDVIGKYVAKLIA 193


>gi|329766029|ref|ZP_08257590.1| riboflavin synthase, alpha subunit [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329137484|gb|EGG41759.1| riboflavin synthase, alpha subunit [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 194

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 114/199 (57%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +GKI  ++   K    +++ V    +   +K+G S+A  G+CLT  ++++ +
Sbjct: 1   MFTGIIEGVGKIQKISKNTKNRSAIQMTVNLGKHAKGLKIGQSVALNGVCLTATKITKSN 60

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
            +      E+  ET + T++ +   G  +N+ERS+K GDRL+GH V GH+DG   I  + 
Sbjct: 61  CI-----FEMIEETTKKTDLGNLNPGDIVNIERSLKTGDRLEGHFVLGHVDGVGIIKKIL 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                +     +P  L +++  KGS+ ++G+SLTV  V KN   V LI HT+E T +K  
Sbjct: 116 KRPKEVQVWFEIPKKLSKYVVKKGSIAIDGISLTVVDVKKNLASVCLIPHTMELTNFKTK 175

Query: 178 KVGDLINIEVDSMMRYIAR 196
            +GD INIE D + +YI +
Sbjct: 176 HIGDKINIETDILGKYILK 194


>gi|327314403|ref|YP_004329840.1| riboflavin synthase subunit alpha [Prevotella denticola F0289]
 gi|326944805|gb|AEA20690.1| riboflavin synthase, alpha subunit [Prevotella denticola F0289]
          Length = 205

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 116/208 (55%), Gaps = 11/208 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  +  +    + +   +  S+ T ++K+  SIAH G+CLTVVR+      D
Sbjct: 1   MFSGIVEEMAILTGIEQEQENIHFTLRCSF-TDELKIDQSIAHNGVCLTVVRIK-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET + +N+    +G  +N+ERS+ +  RLDGH+V GH+D T + + ++   
Sbjct: 55  DTYTVTAMKETLKRSNLGLLQVGDRVNIERSMLMNGRLDGHIVQGHVDQTAKCINMEDAD 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y     P+N E      F   KGSV +NGVSLTV     N F V +I +T   T + 
Sbjct: 115 GSTYFTFEYPYNREMMQRGYFTVDKGSVTVNGVSLTVCEPTANSFKVAIIPYTRTNTNFA 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
              +G ++N+E D + +YIARL +L+T 
Sbjct: 175 YITIGTVVNLEFDILGKYIARLNSLSTQ 202


>gi|239978359|ref|ZP_04700883.1| riboflavin synthase subunit alpha [Streptomyces albus J1074]
 gi|291450255|ref|ZP_06589645.1| riboflavin synthase subunit alpha [Streptomyces albus J1074]
 gi|291353204|gb|EFE80106.1| riboflavin synthase subunit alpha [Streptomyces albus J1074]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV    +H  D
Sbjct: 1   MFTGIVEELGEVTAVEDLGDAARFRLRGPVVTEGARHGDSIAVNGVCLTVV----DHDGD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   +++ +   G+ +NLER   +G RL GHLV GH+DG   +   +   
Sbjct: 57  S-FTADVMAETLTRSSLGALAPGSRVNLERPTAVGGRLGGHLVQGHVDGVGTLTAREPSA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++GVSLTV   G+  F + LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPAHLARYVVEKGSITVDGVSLTVVEAGEEHFTISLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+ R+
Sbjct: 176 DPVNLEVDVIAKYVERM 192


>gi|152976520|ref|YP_001376037.1| riboflavin synthase subunit alpha [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025272|gb|ABS23042.1| riboflavin synthase, alpha subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 214

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  M      M+L +   +  S +K+G SIA  GICLT    +E H   
Sbjct: 1   MFTGIVEELGTVSTMKQSGDAMKLTIQARFILSDIKIGDSIAVNGICLTATSFTESH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T++      + +NLER++    R  GH V+GHIDGT  I+      
Sbjct: 58  --FTVDVMPETMKSTSLRMLKQHSQVNLERAMAANGRFGGHFVTGHIDGTGTIVSKKQHY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++ +P++L ++   KGS+ ++G SLT+  V  N   + LI HT+ E+     + G
Sbjct: 116 NAIYYKIKMPNHLLRYCLQKGSIAIDGTSLTIFDVDDNSITISLIPHTVSESIIGTKEAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI +  +  T +
Sbjct: 176 DIVNIECDMIGKYIEQFMSQPTKR 199


>gi|256545036|ref|ZP_05472404.1| riboflavin synthase, alpha subunit [Anaerococcus vaginalis ATCC
           51170]
 gi|256399332|gb|EEU12941.1| riboflavin synthase, alpha subunit [Anaerococcus vaginalis ATCC
           51170]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 113/199 (56%), Gaps = 9/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI  ++GK+I+   I   +++ V  S      KLG SI   G+CLTV  ++     D
Sbjct: 1   MFTGISEEMGKVISFKKINDHVQIEVQASIVLEDTKLGDSIMTDGVCLTVTEIT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+ ++  E+ ++T      +   +NLER+++L DRLDGH+V GH+DG  +I     I 
Sbjct: 56  KTYKADLMNESLKMTKFDRSIVNKNVNLERALRLSDRLDGHIVQGHVDGVGKI---KNIN 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++Y   + P  +   I  KGSV L+G+SLTV+      F+V LI  TIE T +K  K+G
Sbjct: 113 KNVYTISASPE-ICSLIVKKGSVALDGISLTVSDDKITSFEVSLIPETIEGTNFKYKKIG 171

Query: 181 DLINIEVDSMMRYIARLYA 199
           D INIE D + R+I +  A
Sbjct: 172 DEINIETDIINRFIQKSMA 190


>gi|325859577|ref|ZP_08172710.1| riboflavin synthase, alpha subunit [Prevotella denticola CRIS
           18C-A]
 gi|325482857|gb|EGC85857.1| riboflavin synthase, alpha subunit [Prevotella denticola CRIS
           18C-A]
          Length = 205

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 116/208 (55%), Gaps = 11/208 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  +  +    + +   +  S+ T ++K+  SIAH G+CLTVVR+      D
Sbjct: 1   MFSGIVEEMAILTGIEQEQENIHFTLRCSF-TDELKIDQSIAHNGVCLTVVRIK-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET + +N+    +G  +N+ERS+ +  RLDGH+V GH+D T + + ++   
Sbjct: 55  DTYTVTAMKETLKRSNLGLLQVGDRVNIERSMLMNGRLDGHIVQGHVDQTAKCINMEDAD 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y     P+N E      F   KGSV +NGVSLTV     N F V +I +T   T + 
Sbjct: 115 GSTYFTFEYPYNREMMQRGYFTVDKGSVTVNGVSLTVCEPTANSFKVAIIPYTRTNTNFA 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
              +G ++N+E D + +YIARL +L+T 
Sbjct: 175 YITIGTVVNLEFDILGKYIARLNSLSTQ 202


>gi|114332462|ref|YP_748684.1| riboflavin synthase subunit alpha [Nitrosomonas eutropha C91]
 gi|114309476|gb|ABI60719.1| riboflavin synthase, alpha subunit [Nitrosomonas eutropha C91]
          Length = 201

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 111/198 (56%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  + P    +R+ +     + + + +G SIA  G CLT+    E    
Sbjct: 1   MFTGIIKAVGRIRHVYPKEDAVRIHIDPGKLDLTDVAIGDSIAVNGACLTLTAFEE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T+      G  +NLE++++  DRLDGHLVSGH++G  E++     
Sbjct: 57  -GCFTVDVSGETLSCTHGLDIP-GNPVNLEKALRFSDRLDGHLVSGHVEGVGEVVQFTQA 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD     +  P  L ++I  KGS+ ++GVSLTVN V     ++ LI HT+  TT+K  + 
Sbjct: 115 GDRCLLAIQPPPQLFKYIIPKGSITIDGVSLTVNQVASERVEINLIPHTLANTTFKQFEP 174

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E D + +Y+ARL
Sbjct: 175 GKKVNLETDMIAKYVARL 192


>gi|224372116|ref|YP_002606488.1| riboflavin synthase subunit alpha [Nautilia profundicola AmH]
 gi|223589406|gb|ACM93142.1| riboflavin synthase, alpha subunit [Nautilia profundicola AmH]
          Length = 201

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 110/194 (56%), Gaps = 12/194 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF G++ +  KI +        +LRV   Y   K ++G SIA  G+CLT  ++       
Sbjct: 1   MFNGLIRETAKIRSFA----NNKLRVTAKY---KPEIGDSIAINGVCLTATKI-----YP 48

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EVE+  ET RI  + ++  G  +++E ++K GDR+DGHL+ GH+D   EIL +    
Sbjct: 49  DGFEVELSPETQRIVPLENYQAGKEVHIEPALKFGDRIDGHLIQGHVDAIGEILEIKKNA 108

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S    +     + ++IA KGS+ ++GVSLTVN V  + F + +I HT E T +K +K+ 
Sbjct: 109 NSYDVIIKTDPKIMKYIAPKGSIAIDGVSLTVNEVFSDRFRLTIIPHTFENTLFKTYKLH 168

Query: 181 DLINIEVDSMMRYI 194
             +NIE D   RYI
Sbjct: 169 QKVNIETDMFARYI 182


>gi|124268130|ref|YP_001022134.1| riboflavin synthase subunit alpha [Methylibium petroleiphilum PM1]
 gi|124260905|gb|ABM95899.1| riboflavin synthase alpha chain [Methylibium petroleiphilum PM1]
          Length = 205

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 119/207 (57%), Gaps = 16/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI++ +G++  + P+      G RL + T     + ++LG SIA  G C+TV     
Sbjct: 1   MFTGIISGLGRLSKVAPLGADPSHGKRLTIATPPGYLADVQLGDSIALNGACMTVTAFDA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           E    +W+ V++ AE+ ++   +A  G    +NLE++++  DRL GHLVSGH+DG   + 
Sbjct: 61  EA---DWFTVDISAESLDKTAGLADPGP---LNLEKALRASDRLGGHLVSGHVDGVGTVT 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIE 170
               +G+S    ++ P  L +++A KGS+ +NGVSLTVN V  +       + LI HT+E
Sbjct: 115 KFAPVGESWELCIAAPQALGRYLAYKGSITVNGVSLTVNRVTDHAETTELGINLIPHTLE 174

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARL 197
            TT     VG  +N+E+D + RY+ R+
Sbjct: 175 HTTLGTLSVGARVNLEIDLIARYVERM 201


>gi|163789729|ref|ZP_02184166.1| riboflavin synthase subunit alpha [Carnobacterium sp. AT7]
 gi|159874951|gb|EDP69018.1| riboflavin synthase subunit alpha [Carnobacterium sp. AT7]
          Length = 217

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 118/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I A+        L++         ++G SI+  GICLTV ++      +
Sbjct: 1   MFTGIIEEMGTIQAIRRGENSSILKIKGQKVLQGTRIGDSISTNGICLTVTKIE-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +V +E+ + TNI     G+++NLER++ L  RL GH+VSGHIDGT +I  +    
Sbjct: 56  DSFDADVMSESLKRTNIGELAPGSYVNLERALSLETRLGGHMVSGHIDGTGKIREMKRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGS+ ++GVSLTV  V    F V +I HT EET     ++G
Sbjct: 116 NAVWITVETSPKLLRYIIEKGSIAIDGVSLTVVTVDNQSFKVSVIPHTGEETVLLRKQLG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ +L  L++
Sbjct: 176 DAVNLECDMIGKYVEKLLGLDS 197


>gi|323527044|ref|YP_004229197.1| riboflavin synthase subunit alpha [Burkholderia sp. CCGE1001]
 gi|323384046|gb|ADX56137.1| riboflavin synthase, alpha subunit [Burkholderia sp. CCGE1001]
          Length = 204

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 119/207 (57%), Gaps = 18/207 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + ++LG SI   G C+TVV    
Sbjct: 1   MFTGIVAAVGRIESVKPLGTNGDAGVRLNVEAGGLDLADVQLGDSITIQGACMTVVA--- 57

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D+ +EV+V  E+ NR   ++  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 58  --KTDHSFEVDVSRESLNRTAGLSEVG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  + +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 HFAPVGESHELRVLAPREIGRYLAYKGSITVNGVSLTVNSVKDRDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARL 197
            T  K  + G  +N+E+D + RY+ R+
Sbjct: 173 VTALKHLRAGTPVNLEIDLIARYVERM 199


>gi|118580018|ref|YP_901268.1| riboflavin synthase subunit alpha [Pelobacter propionicus DSM 2379]
 gi|118502728|gb|ABK99210.1| riboflavin synthase, alpha subunit [Pelobacter propionicus DSM
           2379]
          Length = 213

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D G++ A     K   LRV +S    ++ +G S+A  G CLTV    E     
Sbjct: 1   MFTGLIEDTGRVTAFERRGKAGLLRVASSLPLDEIAIGDSVAVNGACLTVTEKRE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  E+   T + S   G+ +NLER+++LGDR+ GH+V+GH+D    +   +   
Sbjct: 56  GTLTFDVSPESLTATTLGSLASGSLVNLERALRLGDRMGGHIVTGHVDCVGRLARTENSS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  SLP    +++  KGSV ++G+SLTVN V ++ F V +I HT+E T+    + G
Sbjct: 116 HHHVLEFSLPAGNARYLVTKGSVTIDGISLTVNRVSQDGFTVNIIPHTLERTSLHSLRPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +NIE D + +Y+ RL
Sbjct: 176 NEVNIETDIIGKYVERL 192


>gi|54307993|ref|YP_129013.1| riboflavin synthase subunit alpha [Photobacterium profundum SS9]
 gi|90410897|ref|ZP_01218911.1| riboflavin synthase subunit alpha [Photobacterium profundum 3TCK]
 gi|46912419|emb|CAG19211.1| Putative riboflavin synthase [Photobacterium profundum SS9]
 gi|90328110|gb|EAS44421.1| riboflavin synthase subunit alpha [Photobacterium profundum 3TCK]
          Length = 218

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 117/200 (58%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT---SYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  IG I A+TP  KG  + V     + + S +KLG SIA  G+CLTVV L+   
Sbjct: 1   MFTGIIEAIGTISALTP--KGADISVTVDSGNLDLSDVKLGDSIATNGVCLTVVALT--- 55

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+D   +I+   
Sbjct: 56  --GKGYVADLSLETLKRTAFTDYKSGQKVNLEKAMLPTTRFGGHMVSGHVDEVGKIIERT 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             G ++   +  P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT +  
Sbjct: 114 HTGRAIEFWVKAPAHLAKYISEKGSVSIDGISLTVNAIRGDEFKLTIVPHTASETTMESF 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           +VG ++N+EVD + RY+ RL
Sbjct: 174 QVGRVVNLEVDVIARYLERL 193


>gi|212696302|ref|ZP_03304430.1| hypothetical protein ANHYDRO_00839 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676931|gb|EEB36538.1| hypothetical protein ANHYDRO_00839 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 207

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 115/199 (57%), Gaps = 9/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI  ++GKI++   I   +++ +  S      KLG SI   G+CLTV  ++     D
Sbjct: 1   MFTGISEEMGKILSFKKINDHVQIEIEASLVLEDTKLGDSIMTDGVCLTVTEIT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+ ++  E+ ++T   +  +   +NLER+++L DRLDGH+V GH+DG  +I     I 
Sbjct: 56  KTYKADLMNESLKMTKFDNSYVNKKVNLERALRLSDRLDGHIVQGHVDGVGKI---KNIR 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++   + P  +   I  KGSV L+G+SLTV+      F+V LI  T+E T +K  K+G
Sbjct: 113 ENVFSISASPE-ICSLIVKKGSVTLDGISLTVSDDKNTSFEVALIPETLERTNFKYKKIG 171

Query: 181 DLINIEVDSMMRYIARLYA 199
           D INIE D + R+I +  A
Sbjct: 172 DEINIETDIINRFIQKSMA 190


>gi|330959947|gb|EGH60207.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 220

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRAEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT  ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTWSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|315109262|gb|EFT81238.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL030PA2]
          Length = 204

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL G +V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGQIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + +Y+  L
Sbjct: 181 DEVNVEVDIIAKYLEAL 197


>gi|325294791|ref|YP_004281305.1| riboflavin synthase, alpha subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065239|gb|ADY73246.1| riboflavin synthase, alpha subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 201

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++++   ++   L++     T  +K+G SI+  G+CLTVV   E+ SV 
Sbjct: 1   MFTGLVEEVGRVLSLKKSSQSAVLKIGCQKITEDIKIGDSISVNGVCLTVVSF-EKDSV- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V AET R +NI       F+NLER+++  DRL GH++ GH+D   +++ +   G
Sbjct: 59  ---TFDVSAETLRRSNIGILKTNDFVNLERALRFSDRLGGHILQGHVDTITKVVGIKREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                   LP      +  KGS+ ++G+SLT+  +  + F V +I HT + TT K  K G
Sbjct: 116 TGFLFSFKLPPAYRHLVVEKGSIGIDGISLTIATLFADTFSVAVIPHTYKNTTLKFRKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E D + +Y+ ++
Sbjct: 176 DIVNLEFDIIGKYVEKM 192


>gi|303237255|ref|ZP_07323825.1| riboflavin synthase, alpha subunit [Prevotella disiens FB035-09AN]
 gi|302482642|gb|EFL45667.1| riboflavin synthase, alpha subunit [Prevotella disiens FB035-09AN]
          Length = 201

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 116/202 (57%), Gaps = 11/202 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++ +++A+    + +   +  +Y  +++K+  SIAH G+CLTVVRL+     D
Sbjct: 1   MFSGIVEEMAQVVAIERYQENIDFTLKCTY-VNELKIDQSIAHNGVCLTVVRLT-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET   +N+    +G  +N+ERS+ +  RLDGH+V GH+D T + + ++   
Sbjct: 55  DTYTVTAMKETLDRSNLGLLKVGDRVNIERSMLMNGRLDGHIVQGHVDETAKCVAMENAD 114

Query: 121 DSMYCRLSLPHNLE-----QFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y       ++E      F   KGSV +NGVSLTV     N F V +I +T E T + 
Sbjct: 115 GSTYFTFEYEQDIELAKRGYFTVDKGSVTVNGVSLTVCEPTNNTFKVAIIPYTRENTNFA 174

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
             ++G ++N+E D + +YIARL
Sbjct: 175 DIQIGTIVNLEFDILGKYIARL 196


>gi|148380823|ref|YP_001255364.1| riboflavin synthase, alpha subunit [Clostridium botulinum A str.
           ATCC 3502]
 gi|148290307|emb|CAL84431.1| riboflavin synthase alpha chain [Clostridium botulinum A str. ATCC
           3502]
          Length = 216

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 1   MFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFN-----S 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 56  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 116 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 176 DIINIECDVLGKYIYKF 192


>gi|325846664|ref|ZP_08169579.1| riboflavin synthase, alpha subunit [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481422|gb|EGC84463.1| riboflavin synthase, alpha subunit [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 207

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 116/199 (58%), Gaps = 9/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI  ++GKI++   I   +++ +  S     +KLG SI   G+CLTV  ++     D
Sbjct: 1   MFTGISEEMGKILSFKKINDHVQIEIEASLVLEYIKLGDSIMTDGVCLTVTEIT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+ ++  E+ ++T   +  +   +NLER+++L DRLDGH+V GH+DG  +I     I 
Sbjct: 56  KTYKADLMNESLKMTKFDNSYVNKKVNLERALRLSDRLDGHIVQGHVDGVGKI---KNIR 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++   + P  +   I  KGSV L+G+SLTV+      F+V LI  T+E T +K  K+G
Sbjct: 113 ENIFTISASPE-ICSLIVKKGSVTLDGISLTVSDDKNTSFEVALIPETLERTNFKYKKIG 171

Query: 181 DLINIEVDSMMRYIARLYA 199
           D INIE D + R+I +  A
Sbjct: 172 DEINIETDIINRFIKKSMA 190


>gi|237797513|ref|ZP_04585974.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331020363|gb|EGI00420.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 220

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT  ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTWSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|55981032|ref|YP_144329.1| riboflavin synthase subunit alpha [Thermus thermophilus HB8]
 gi|55772445|dbj|BAD70886.1| riboflavin synthase alpha chain [Thermus thermophilus HB8]
          Length = 194

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 114/200 (57%), Gaps = 13/200 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT--SKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTG+V + G+I+    + +G  LRV          +K+G S+A  G CLT V + E   
Sbjct: 1   MFTGLVEETGEILK---VEEGPFLRVYIGARKVLEDLKVGDSVAVDGACLTAVAVEE--- 54

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG   +  +  
Sbjct: 55  --GGFWVELAQETLRRTA-PTWRVGHRPNLERALKVGDRLGGHFVTGHVDGVARLWEVRE 111

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-NLVGKNFFDVLLIRHTIEETTWKMH 177
              +       P  L  +IA KGSV LNGVSLTV  L G+ F+ V LI HT+E T     
Sbjct: 112 APGAKDFYFLPPKALAPYIAEKGSVALNGVSLTVAGLTGEAFW-VTLIPHTLEVTNLGRL 170

Query: 178 KVGDLINIEVDSMMRYIARL 197
           +VGD +N+EVD + RY+ARL
Sbjct: 171 RVGDGVNLEVDLIARYVARL 190


>gi|226950299|ref|YP_002805390.1| riboflavin synthase, alpha subunit [Clostridium botulinum A2 str.
           Kyoto]
 gi|226841512|gb|ACO84178.1| riboflavin synthase, alpha subunit [Clostridium botulinum A2 str.
           Kyoto]
          Length = 228

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V AET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMAETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKSKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 187

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 188 DIINIECDVLGKYIYKF 204


>gi|260366282|ref|ZP_05778738.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus K5030]
 gi|308112727|gb|EFO50267.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus K5030]
          Length = 171

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 110/174 (63%), Gaps = 6/174 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V +   + S +KLG SIA  G+CLTV+        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVIDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -NYYSADLSLETLKKTGFANYQVGEKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETT 169


>gi|187778553|ref|ZP_02995026.1| hypothetical protein CLOSPO_02148 [Clostridium sporogenes ATCC
           15579]
 gi|187772178|gb|EDU35980.1| hypothetical protein CLOSPO_02148 [Clostridium sporogenes ATCC
           15579]
          Length = 217

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++GKI  +      + + +  S   + + LG S+A  G+CLTV   +     +
Sbjct: 1   MFTGIVEEVGKISKIEEGKDFLHITIEGSKVLNPLNLGDSVAVNGVCLTVTNFN-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET + +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 56  SSFTADVMAETLKKSSLKTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINIKKEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     L +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 116 IATLLEVKTKETLLKYMVPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILMNKNIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D+INIE D + +YI +   L   +
Sbjct: 176 DIINIECDILGKYIYKFMHLKKEE 199


>gi|300712065|ref|YP_003737879.1| riboflavin synthase subunit alpha [Halalkalicoccus jeotgali B3]
 gi|299125748|gb|ADJ16087.1| riboflavin synthase subunit alpha [Halalkalicoccus jeotgali B3]
          Length = 200

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 114/197 (57%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G+++A T    G+RLR+   +  S+++ G S++  G CLTV    E+H  +
Sbjct: 1   MFTGIVEATGEVLARTETDDGLRLRIGCPF-ASELEGGQSVSVNGACLTV----EDHD-E 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V + AET   T +     G  +NLER++    R DGH+V GH+DG  E++ ++ +G
Sbjct: 55  AGFSVFLAAETVSRTYLGELREGERVNLERAMPADGRFDGHVVQGHVDGVGEVVGIEAVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SLP +L  ++  KGS+ ++G+SLTV  +    F V +I  T  ETT    +VG
Sbjct: 115 EDWRFTFSLPDDLANYVVEKGSITVDGISLTVASLSAGEFTVAIIPTTYGETTLSGKEVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +++E D + +Y+ R+
Sbjct: 175 DPVHLEADVIAKYVERV 191


>gi|148272142|ref|YP_001221703.1| riboflavin synthase subunit alpha [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830072|emb|CAN01001.1| ribC [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
          Length = 218

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 113/208 (54%), Gaps = 12/208 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G+++A+       R+ V      S  + G SI+  G+CLTVV         
Sbjct: 1   MFTGIIEERGRVLALDAEGDSARITVEAPLAVSDARHGDSISVDGVCLTVV-----AQTP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  +T  ++++   G+G  +NLER+ ++GDRL GH+V GH+DGT  +L      
Sbjct: 56  DGFTADVMRQTLVMSSLGRLGVGDRVNLERAARVGDRLGGHIVQGHVDGTGRLLATTPGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-------FFDVLLIRHTIEETT 173
                R SLP  L   +  +GS+ + GVSLTV+ V          +F+V LI  T+  TT
Sbjct: 116 AWRILRFSLPAELSPLVVDRGSITVQGVSLTVSAVSPTDTADSDAWFEVSLIPETLTATT 175

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALN 201
               ++GD +N+E D + R++ R+ AL+
Sbjct: 176 LGALELGDEVNLETDVLARHVQRMLALD 203


>gi|320352892|ref|YP_004194231.1| riboflavin synthase subunit alpha [Desulfobulbus propionicus DSM
           2032]
 gi|320121394|gb|ADW16940.1| riboflavin synthase, alpha subunit [Desulfobulbus propionicus DSM
           2032]
          Length = 217

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G +    P   GM   +   +  +  + G SIA  G CLT   +       
Sbjct: 1   MFTGIIQGLGTLFEKRPSGGGMIFGLEADFALTDPEEGESIAVNGACLTARNIK-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  E+   T +     G+ +NLER+++L DRL GHLVSGH+D   ++     +G
Sbjct: 56  NRFYVDVSPESLARTGLGRLQTGSRVNLERALRLSDRLGGHLVSGHVDAQAQVKDRRRVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SL   L +++  KGS+ +NGVSLTVN   +  F V +I HT+  TT  M K G
Sbjct: 116 EFTLFAFSLDPALGKYVIEKGSITINGVSLTVNSCDREGFSVSIIPHTLAVTTLGMLKEG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD + +Y+ +L
Sbjct: 176 DHVNIEVDMIGKYVEKL 192


>gi|291279487|ref|YP_003496322.1| riboflavin synthase subunit alpha [Deferribacter desulfuricans
           SSM1]
 gi|290754189|dbj|BAI80566.1| riboflavin synthase, alpha subunit [Deferribacter desulfuricans
           SSM1]
          Length = 216

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK++     +   ++++       K ++G SIA  G+CLTVV L E     
Sbjct: 1   MFTGIVEETGKVVFFQKKSDFAKIKIKCDTVLEKTQVGDSIAVNGVCLTVVDLDE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  ++  E+   +       G  +NLER++ L  RL GHLV GH+DG  +I+ +    
Sbjct: 56  NSFSADISYESIERSTFKYCTTGWAVNLERALTLEKRLGGHLVQGHVDGIGKIVKIMEYK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-NLVGKNFFDVLLIRHTIEETTWKMHKV 179
           D+   ++  P  L+++IAVKGS+ ++G+SLTV + +  N  +V +I HT   T  K  K 
Sbjct: 116 DAYKLQILYPSELDKYIAVKGSITIDGISLTVASEIAANTIEVAVIPHTFMVTNLKDKKS 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +NIEVD + RY+ +L
Sbjct: 176 GDYVNIEVDVIARYLEKL 193


>gi|169830808|ref|YP_001716790.1| riboflavin synthase subunit alpha [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637652|gb|ACA59158.1| riboflavin synthase, alpha subunit [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 215

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 108/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +          RL +         +LG SIA  G+CLTV          
Sbjct: 1   MFTGIIEELGTLRRAERGPASARLHIEARTVLEDARLGESIAVNGVCLTVADFG-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+  +V AET + TN+     G  +NLER+++LG+RL GHLVSGH+DG   ++  +  G
Sbjct: 56  GWFTADVMAETLKRTNLGEVRPGERVNLERAMRLGERLGGHLVSGHVDGVGTVVGCEPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++  R+  P  + +++  KGSV ++G+SLTV    +  F V +I HT + TT    + G
Sbjct: 116 IALVFRIQAPEGVMRYVIEKGSVAVDGISLTVVDHDRETFRVSIIPHTAQMTTLGFKRAG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ R+
Sbjct: 176 ARVNLEADMIAKYVERM 192


>gi|323357081|ref|YP_004223477.1| riboflavin synthase alpha chain [Microbacterium testaceum StLB037]
 gi|323273452|dbj|BAJ73597.1| riboflavin synthase alpha chain [Microbacterium testaceum StLB037]
          Length = 218

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 113/209 (54%), Gaps = 10/209 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I A+ P   G+R+ V    + S    G SI+ +G+CLTVV   E     
Sbjct: 1   MFTGIVEEMGAITAVEPSGDGVRVTVRAPLSVSDAGHGDSISVSGVCLTVVDQGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+  +V  +T  ++ +A    G  +NLER+     RL GH+V GHIDGT  +  +    
Sbjct: 56  DWFTADVMKQTLDMSTLADVAPGRAVNLERATAAHGRLGGHIVQGHIDGTGVVREVRPGA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG-----KNFFDVLLIRHTIEETTWK 175
                R+ +P++L   +  KGS+ ++GVSLTV+ V      + + +V LI  T+  TT  
Sbjct: 116 QWSVVRIGIPNHLAPLVVDKGSIAIDGVSLTVSAVSDPAETEQWLEVSLIPETLAATTLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTSQ 204
             + G  +N+E D + R++ R+ A   S+
Sbjct: 176 GAEAGTPVNLETDILARHVQRMLAFRVSE 204


>gi|169629881|ref|YP_001703530.1| riboflavin synthase subunit alpha [Mycobacterium abscessus ATCC
           19977]
 gi|169241848|emb|CAM62876.1| Putative riboflavin synthase alpha chain [Mycobacterium abscessus]
          Length = 197

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 112/197 (56%), Gaps = 4/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+    +    RL V+        K G SIA  G+CLTVV + E     
Sbjct: 1   MFTGIVEELGEILGREDLGDSARLTVLGPLVVEDAKHGDSIAVNGVCLTVVDVRE----G 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++     G  +NLER+  +  RL GH+V GH+DGT  +L      
Sbjct: 57  GVFTTDVMGETLARSSLDKIEAGAKVNLERAAAVNSRLGGHIVQGHVDGTGNVLSRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R+SLP  + +++  KGS+ ++GVSLTV+ +G ++F+V LI  T++ TT     VG
Sbjct: 117 NWEVVRVSLPSAVARYVVEKGSITVDGVSLTVSGLGPDWFEVSLIPTTLDLTTLGAAAVG 176

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + +Y+ RL
Sbjct: 177 TTVNLEVDVIAKYVERL 193


>gi|84496638|ref|ZP_00995492.1| putative riboflavin synthase alpha subunit [Janibacter sp.
           HTCC2649]
 gi|84383406|gb|EAP99287.1| putative riboflavin synthase alpha subunit [Janibacter sp.
           HTCC2649]
          Length = 202

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 112/199 (56%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +    +  RL +     TS    G SIA  G+CLTVV    EH VD
Sbjct: 1   MFTGIVEELGQVDRIDLGDESARLTLRGPLVTSDAVHGASIAVNGVCLTVV----EHDVD 56

Query: 61  -NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W+ V+V AET   + +     G  +NLER++    R  GH+V GH+DGT  ++     
Sbjct: 57  AGWFTVDVMAETLSRSGLGELVAGAPVNLERAMAASSRFGGHIVQGHVDGTA-VVLERVP 115

Query: 120 GDS-MYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           GD       +LP +L +++  KGS+ ++GVSLTV+ +  + F V LI  T+  TT     
Sbjct: 116 GDRWEVVTFTLPADLARYVVEKGSITVDGVSLTVSAITDDTFSVSLIPTTLALTTLGHRV 175

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD + +Y+ RL
Sbjct: 176 VGDTVNLEVDVLAKYVERL 194


>gi|167630210|ref|YP_001680709.1| riboflavin synthase, alpha subunit [Heliobacterium modesticaldum
           Ice1]
 gi|167592950|gb|ABZ84698.1| riboflavin synthase, alpha subunit [Heliobacterium modesticaldum
           Ice1]
          Length = 219

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A++  A+  ++ +        +KLG SIA  G+CLTVVR        
Sbjct: 1   MFTGIVEELGVVRAISRGARSAKIEINAKTVVEDVKLGDSIAVNGVCLTVVRYD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   T ++    G  +NLER+V++GDRL GH+VSGHID    I   + + 
Sbjct: 56  SSFTADVMAETLDRTALSELQPGHRVNLERAVRVGDRLGGHIVSGHIDAVGVIRGQERVD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   ++ P  L +++  KGS+ ++G+SLTV  V +  F V LI HT   TT  + K G
Sbjct: 116 IAVVTEIAAPPELLRYVIPKGSIAIDGISLTVVDVFEAAFTVSLIPHTAGMTTLGLKKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ RL
Sbjct: 176 HKVNLEADVIGKYVERL 192


>gi|227499805|ref|ZP_03929900.1| riboflavin synthase [Anaerococcus tetradius ATCC 35098]
 gi|227218109|gb|EEI83377.1| riboflavin synthase [Anaerococcus tetradius ATCC 35098]
          Length = 204

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 112/198 (56%), Gaps = 9/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI  ++G +      +  + +++       + KLG SI   G+CLTV  ++     D
Sbjct: 1   MFTGIAEELGLVKEFKQKSDTVEIKIACKKVLEETKLGDSIMTDGVCLTVTEIT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           ++Y+ ++  E+ + T      +G  +NLER+++  DRLDGH+V GH+DG   ++    I 
Sbjct: 56  SYYKADIMNESLKKTKFDRSLLGKEVNLERALRFSDRLDGHIVQGHVDGVGRLIS---IN 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++Y R      + +FI  KGS+ ++G+SLTV+    + F+V LI  T+  T  K  +VG
Sbjct: 113 KNVY-RFKTNREIGRFIVNKGSIAIDGISLTVSFENDDIFEVSLIPETLSRTNLKNKRVG 171

Query: 181 DLINIEVDSMMRYIARLY 198
           DL+N+E D + R + +LY
Sbjct: 172 DLVNLETDILSRIVEKLY 189


>gi|222055765|ref|YP_002538127.1| riboflavin synthase, alpha subunit [Geobacter sp. FRC-32]
 gi|221565054|gb|ACM21026.1| riboflavin synthase, alpha subunit [Geobacter sp. FRC-32]
          Length = 215

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG +  M   +    L V  ++ + ++ +G SIA  G CLTVV         
Sbjct: 1   MFTGLIEEIGTVAGMEMKSNAGILSVSAAFPSDRIAIGDSIAVNGACLTVVGKGA----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   T++     GT +NLER++ +  RLDGHLVSGH+D    +     + 
Sbjct: 56  GTFSFDVSPETVNRTSLKELKKGTPVNLERALAVSGRLDGHLVSGHVDCLAVVRDRRTVS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      +P    +++A KGS+ ++GVSLTVN V  + F V +I HT+ +TT    K G
Sbjct: 116 GNTVFFFRMPAEYLRYVAAKGSIAIDGVSLTVNTVDDDGFSVNIIPHTLAKTTLAGKKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIE D + +Y+ RL
Sbjct: 176 DVVNIETDILAKYVERL 192


>gi|168179300|ref|ZP_02613964.1| riboflavin synthase, alpha subunit [Clostridium botulinum NCTC
           2916]
 gi|182669633|gb|EDT81609.1| riboflavin synthase, alpha subunit [Clostridium botulinum NCTC
           2916]
          Length = 228

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++GKI+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGKILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFAVSLIPHTKEETILINKNIG 187

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 188 DIINIECDVLGKYIYKF 204


>gi|317484773|ref|ZP_07943672.1| riboflavin synthase [Bilophila wadsworthia 3_1_6]
 gi|316923980|gb|EFV45167.1| riboflavin synthase [Bilophila wadsworthia 3_1_6]
          Length = 220

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GK++A+       R R+   Y+ + + LG SIA  G CLTV     E S  
Sbjct: 1   MFTGIINGQGKVLAVESRGHETRFRIQALYDLADIILGESIAVNGTCLTV-----ETSGP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +     AET + T +     G  +NLER++ +GDRL GH+VSGH+D   EIL +   G
Sbjct: 56  SLFSAYASAETMQRTALGLLKPGAKVNLERALAVGDRLGGHIVSGHVDCVAEILSVRREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   R+  P +    +  KGSV L+G+SLTVN  G +F +V +I  T   TT      G
Sbjct: 116 ESRRIRIGFPASFGAEVIGKGSVALDGISLTVNDCGPDFLEVNVIPETWRATTVAEWAPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             IN+E D + +Y+  + A
Sbjct: 176 TRINMETDVIGKYVRHMVA 194


>gi|256420740|ref|YP_003121393.1| riboflavin synthase, alpha subunit [Chitinophaga pinensis DSM 2588]
 gi|256035648|gb|ACU59192.1| riboflavin synthase, alpha subunit [Chitinophaga pinensis DSM 2588]
          Length = 196

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 109/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G++IA       M + + +S    ++K+  S+AH G+CLTV R+  E    
Sbjct: 1   MFTGIIESLGEVIATRQEGSNMVITIRSSL-APELKIDQSVAHNGVCLTVTRVDNES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y++   AET   +NI     G  +NLER++    R+DGHLV GH+D T E + +    
Sbjct: 57  --YDIVAVAETLIKSNIGQLTPGQKVNLERAMIFNGRIDGHLVQGHVDSTGECVSVTPQN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R   P      I  KGS+CLNG+SLT+  V    F + +I +T E T     + G
Sbjct: 115 GSWEFRFRYPEQFAGLIVEKGSICLNGISLTIYNVTNTEFTIAVIPYTYEHTNISAVQPG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           + IN+E D + +++AR  A+ +
Sbjct: 175 NTINLEFDILGKFVARQLAVRS 196


>gi|317503372|ref|ZP_07961417.1| riboflavin synthase subunit alpha [Prevotella salivae DSM 15606]
 gi|315665507|gb|EFV05129.1| riboflavin synthase subunit alpha [Prevotella salivae DSM 15606]
          Length = 199

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 114/205 (55%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  ++A+T   + +   +  S+   ++K+  SIAH G+CLTVV L      +
Sbjct: 1   MFSGIVEEMATLVAITKDKENIDFTLKCSF-VDELKIDQSIAHNGVCLTVVSLE-----N 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y V    ET   +N++   +G  +N+ERS+ +  RLDGH+V GH+D T + + +    
Sbjct: 55  GTYTVTAMKETLDRSNLSLLKVGDHVNIERSMLMNGRLDGHIVQGHVDETAKCIGMRDAD 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y     PHN        F   KGSV +NGVSLTV     N F V +I +T   T +K
Sbjct: 115 GSTYFTFEYPHNEAMAKKGYFTVDKGSVTINGVSLTVCEPTDNTFTVAIIPYTRANTNFK 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
             ++G ++N+E D + +YIARL AL
Sbjct: 175 DIEIGSVVNLEFDILGKYIARLQAL 199


>gi|296269351|ref|YP_003651983.1| riboflavin synthase subunit alpha [Thermobispora bispora DSM 43833]
 gi|296092138|gb|ADG88090.1| riboflavin synthase, alpha subunit [Thermobispora bispora DSM
           43833]
          Length = 199

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 111/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMT-PIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++A+        RL V     T+    G SIA  G+CLTV  LS     
Sbjct: 1   MFTGIVEELGEVVALERGGGASARLAVRGPVVTAGAAAGDSIAVNGVCLTVTGLS----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   +++ +   G+ +NLER+V  G RL GH+V GH+DG   +L  +  
Sbjct: 56  GDVFTADVMKETLDRSSLGALEPGSPVNLERAVPAGGRLGGHIVQGHVDGVGTVLSREPG 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +    R SLP  L +++  KGS+ ++GVSLTV     + F V LI  T+E TT    + 
Sbjct: 116 DNWEIVRFSLPPALSRYVVEKGSIAVDGVSLTVVEAAGDSFTVSLIPTTLELTTLGRKRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + +Y+ RL
Sbjct: 176 GDPVNLEVDVIAKYVERL 193


>gi|237749272|ref|ZP_04579752.1| riboflavin synthase [Oxalobacter formigenes OXCC13]
 gi|229380634|gb|EEO30725.1| riboflavin synthase [Oxalobacter formigenes OXCC13]
          Length = 204

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 122/211 (57%), Gaps = 18/211 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI+  +GKI ++TP  K    G+RL++   +     +K G SIA  G C+TVV  +E
Sbjct: 1   MFTGIIQAVGKIESVTPQGKDENAGVRLQIDAGTLPMDDVKTGDSIALNGACMTVVEKTE 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                N ++++V  E+ ++ T +        +NLE+++ LGD L GHLVSGH+DG   + 
Sbjct: 61  -----NGFKIDVSHESLDKTTGLDGT---NEVNLEKAMALGDMLGGHLVSGHVDGVGIVR 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIE 170
               + +S    +  P +L +F+A KGSV +NGVSLT+N V        F + LI HTIE
Sbjct: 113 QFSPVAESWELVIEAPLHLAKFLAYKGSVAVNGVSLTINNVTDIETGCLFSINLIPHTIE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
            TT K  K G  +N+E+D + RY+ R+  ++
Sbjct: 173 VTTLKNLKAGSRVNLEIDLIARYVERMLTVS 203


>gi|296160059|ref|ZP_06842879.1| riboflavin synthase, alpha subunit [Burkholderia sp. Ch1-1]
 gi|295889805|gb|EFG69603.1| riboflavin synthase, alpha subunit [Burkholderia sp. Ch1-1]
          Length = 211

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 123/213 (57%), Gaps = 18/213 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + S ++LG SI   G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIESVKPLGANGDAGVRLNVEAGGLDLSDVQLGDSITIQGACMTVVART- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D+ +EV+V  E+   T  A  G    +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DHSFEVDVSRESLNCT--AGLGEIGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S   R+  P  + +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRVLAPREIGRYLAYKGSITVNGVSLTVNSVKDRDDGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           T  K  + G  +N+E+D + RY+ R+  L+TSQ
Sbjct: 174 TALKHLREGTRVNLEIDLIARYVERM--LSTSQ 204


>gi|312195562|ref|YP_004015623.1| riboflavin synthase, subunit alpha [Frankia sp. EuI1c]
 gi|311226898|gb|ADP79753.1| riboflavin synthase, alpha subunit [Frankia sp. EuI1c]
          Length = 265

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 115/212 (54%), Gaps = 15/212 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+T  A    L + ++     ++ G SIA  G+CLTV   +    VD
Sbjct: 1   MFTGIVEELGTVAAVTEHATAAELTIGSTAVLEDVRHGASIAVNGVCLTVTSFTPPGEVD 60

Query: 61  NW-----YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  +  +V  ET R + + +   G  +NLER V+L DRL GHLV GH+DG   I  
Sbjct: 61  PRTGTRVFTADVMLETLRRSALGALTAGDRVNLERPVRLADRLGGHLVQGHVDGVGTI-- 118

Query: 116 LDFIGDSMY--CRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF------FDVLLIRH 167
            D   D  +   R++LP  L++++  KGS+ ++GVSLTV  V          F V LI  
Sbjct: 119 ADRAPDEHWEVVRIALPAGLDRYLVEKGSITVDGVSLTVVDVTPATADLPASFTVSLIPT 178

Query: 168 TIEETTWKMHKVGDLINIEVDSMMRYIARLYA 199
           T+ +TT     VG L+N+EVD + +Y+ +L A
Sbjct: 179 TLADTTLGARNVGALVNLEVDVVAKYVEKLAA 210


>gi|83648597|ref|YP_437032.1| riboflavin synthase subunit alpha [Hahella chejuensis KCTC 2396]
 gi|83636640|gb|ABC32607.1| riboflavin synthase, alpha subunit [Hahella chejuensis KCTC 2396]
          Length = 222

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V ++G + A+   +    L +  T      ++LG SIA  G+CLTV  +S +   
Sbjct: 1   MFTGLVEEVGVVNAIRQQSGDWVLEIGATGSFMEGVRLGDSIAVNGVCLTVTAMSGKS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET+  T+IA+W  G  +NLE++++L  RL GH VSGH+DG  E+L     
Sbjct: 59  ---FRADVSRETSAHTSIAAWRAGVRVNLEKALQLSARLGGHFVSGHVDGVGELLSKQED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P  L ++IA KGS+ ++GVSLTVN V  +   + ++ HT   TT    KV
Sbjct: 116 ARSLRLAIRAPEELLRYIAAKGSITVDGVSLTVNDVAGSEMSLNIVPHTAYATTLGGLKV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G L+++EVD + RY  RL
Sbjct: 176 GSLVHLEVDLLARYTERL 193


>gi|302866840|ref|YP_003835477.1| riboflavin synthase subunit alpha [Micromonospora aurantiaca ATCC
           27029]
 gi|315503255|ref|YP_004082142.1| riboflavin synthase, alpha subunit [Micromonospora sp. L5]
 gi|302569699|gb|ADL45901.1| riboflavin synthase, alpha subunit [Micromonospora aurantiaca ATCC
           27029]
 gi|315409874|gb|ADU07991.1| riboflavin synthase, alpha subunit [Micromonospora sp. L5]
          Length = 203

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 109/199 (54%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRL-RVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+I+  T       L  +     TS  + G SIA  G+CLTVV       V
Sbjct: 1   MFTGIVEELGEIVRSTETGDDSALVAIRGPLVTSDARHGDSIAVNGVCLTVV------DV 54

Query: 60  DNW-YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           D   +  +V  ET R T + +   G  +NLER+  L  RL GHLV GH+DG  EI+  + 
Sbjct: 55  DGGVFTADVMGETLRRTALGALRPGDPVNLERAAALNSRLGGHLVQGHVDGVGEIVAREP 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                  R  LP  L +++  KGS+ ++GVSLTV   G ++F V LI  T++ T     +
Sbjct: 115 AAQWETVRFRLPAGLARYVVEKGSITVDGVSLTVAEAGDDWFSVGLIPTTLKLTVLGTKR 174

Query: 179 VGDLINIEVDSMMRYIARL 197
           +GD +N+EVD + +Y+ RL
Sbjct: 175 IGDPVNLEVDVLAKYVERL 193


>gi|229916730|ref|YP_002885376.1| riboflavin synthase, subunit alpha [Exiguobacterium sp. AT1b]
 gi|229468159|gb|ACQ69931.1| riboflavin synthase, alpha subunit [Exiguobacterium sp. AT1b]
          Length = 213

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG + A+      +RL +        +KLG SIA  GICLTV         D
Sbjct: 1   MFTGIVEEIGSVKAVKRNGPSLRLVLSAVKVLDDVKLGDSIAVNGICLTVTTFD-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + +++     GT +NLER++    R  GH VSGH+DG   I     + 
Sbjct: 56  ATFSVDVMPETLKASSLDGVKPGTQVNLERAMPANGRFGGHFVSGHVDGVGRITKKRPLA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  +     L  +I  KGS+C++G SLTV  V +  F + LI HT  ET   M + G
Sbjct: 116 NAVYIDIQCDRALLSYIVPKGSICVDGTSLTVFDVSERGFTLSLIPHTYSETVLGMKQTG 175

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+E D + +Y+ ++
Sbjct: 176 DLVNLECDLLAKYMEKV 192


>gi|225164209|ref|ZP_03726484.1| riboflavin synthase, alpha subunit [Opitutaceae bacterium TAV2]
 gi|224801183|gb|EEG19504.1| riboflavin synthase, alpha subunit [Opitutaceae bacterium TAV2]
          Length = 203

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 110/199 (55%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G + + T      +L++        + LG SIA  G CLTV     E    
Sbjct: 1   MFTGIIEETGSVASFTKGRNAWKLQIAARLALEAVSLGDSIAINGCCLTVTAFDHEFI-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+++    ET+R+TNI     G+ +NLERS++ G ++ GH V+GHIDG   I  L+  G
Sbjct: 59  -WFDL--LEETHRLTNIGKLAPGSAVNLERSLRFGGKMGGHFVTGHIDGMGVIEVLEQRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +  Y R+  P    + +  KGS+ ++G+SLTV  V  + F V LI  T++ T  +   VG
Sbjct: 116 NDYYLRVHTPPGNGRHLIHKGSIAIDGISLTVAEVEGDHFAVWLIPTTMQVTNLRTRSVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +Y+ +L A
Sbjct: 176 DHVNLEFDMLGKYVEKLLA 194


>gi|85858028|ref|YP_460230.1| riboflavin synthase subunit alpha [Syntrophus aciditrophicus SB]
 gi|85721119|gb|ABC76062.1| riboflavin synthase alpha chain [Syntrophus aciditrophicus SB]
          Length = 215

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 112/204 (54%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  IG ++ ++   +   L + T  N   +++G SIA  G CLT    S      
Sbjct: 1   MFTGLVQGIGTVLRLSRRGEDALLEIETDMNLEDVRIGDSIAVNGACLTATSYSRRS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T++     G  +NLE+S++L D + GH+V GH+DG  +I+      
Sbjct: 58  --FTADVSAETLSRTDLGFLQPGQRVNLEKSLRLTDFMGGHIVLGHVDGLGKIVERSVKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+  R+ +   L ++I  KGSV ++GVSLTVN   +N F V +I HT E TT    K G
Sbjct: 116 GSIIFRIEVEPELSRYIVSKGSVAVDGVSLTVNRCEENVFYVNMISHTAERTTLGFKKKG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIE D + +Y+ RL  LN  Q
Sbjct: 176 DWVNIETDILGKYVDRL--LNPEQ 197


>gi|257063445|ref|YP_003143117.1| riboflavin synthase, alpha subunit [Slackia heliotrinireducens DSM
           20476]
 gi|256791098|gb|ACV21768.1| riboflavin synthase, alpha subunit [Slackia heliotrinireducens DSM
           20476]
          Length = 223

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  + P A+  ++ +  S      ++G SIA  G+CLTVV +  +    
Sbjct: 1   MFTGIVEEMGTVRRVLPGARAGKITIGASKVLGGTQIGDSIAVNGVCLTVVEMGADS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +     G  +NLER++    R  GH+VSGHIDGT  I  +    
Sbjct: 58  --FVADVMPETLSKSGLGQLKTGDKVNLERAMAADGRFGGHIVSGHIDGTGRIAEMRPDQ 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+S P  +   I  KGS+ ++G+SLTV  V    F V LI HT EETT    + G
Sbjct: 116 NAVRVRISAPAGILALIVEKGSIAIDGISLTVASVSATDFQVSLIPHTGEETTLLKKRAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E D + +Y+ +L
Sbjct: 176 DIVNLENDVVGKYVQKL 192


>gi|296332261|ref|ZP_06874723.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674963|ref|YP_003866635.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296150575|gb|EFG91462.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413207|gb|ADM38326.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 215

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I +M      M L +  S     + LG SIA  GICLTV   ++     
Sbjct: 1   MFTGIIEETGTIESMKKAGHSMALTIKCSKILEDVHLGDSIAVNGICLTVTDFTK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNDLSKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEERS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L + + +KGS+ ++GVSLT+  + ++   + LI HTI ETT+    +G
Sbjct: 116 NAVYYDVKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHTISETTFSEKTIG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + +Y+ R 
Sbjct: 176 SKVNIECDMIGKYMYRF 192


>gi|319651134|ref|ZP_08005267.1| riboflavin synthase [Bacillus sp. 2_A_57_CT2]
 gi|317397188|gb|EFV77893.1| riboflavin synthase [Bacillus sp. 2_A_57_CT2]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 111/194 (57%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  +    K M+L +  S   + ++LG SI+  G+CLTV   ++     
Sbjct: 1   MFTGIIEELGTVKKVVQQGKAMKLTIQASTVLTDVQLGDSISVNGVCLTVTEFAK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET + T++++    T +NLER++    R  GH V+GHIDGT +IL      
Sbjct: 56  NEFSADVMPETFKSTSLSAIKERTKVNLERAMSANGRFGGHFVTGHIDGTGQILKKTASE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++S+P  L   + +KGS+ ++G+SLTV     N   V +I HT  ET       G
Sbjct: 116 NAIYIQISVPPALSHLLIMKGSIAVDGISLTVFGNEDNTVTVSIIPHTASETVLGFKAAG 175

Query: 181 DLINIEVDSMMRYI 194
           D++N+E D + +Y+
Sbjct: 176 DIVNLEFDMLAKYL 189


>gi|269837994|ref|YP_003320222.1| riboflavin synthase, alpha subunit [Sphaerobacter thermophilus DSM
           20745]
 gi|269787257|gb|ACZ39400.1| riboflavin synthase, alpha subunit [Sphaerobacter thermophilus DSM
           20745]
          Length = 212

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G + A+  +   + L +         +LG SIA  G+CLTV  L   H V 
Sbjct: 1   MFSGIVEEVGTVAALGRVGGDVALTIRGRTVLEGTRLGDSIAVNGVCLTVADLDAGHFVA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N   V     T R+TN+     G+ +NLERSV +G R+ GH V GHIDGT  ++     G
Sbjct: 61  NLQPV-----TLRLTNLGDLSPGSPVNLERSVMVGGRIGGHYVQGHIDGTGRVVSQTPDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++  R++ P  + +++  +G + ++G SLT+  V  + F V L+ HT   TT    + G
Sbjct: 116 AAVVVRIATPPEIHRYLVPRGFIAVDGASLTIVEVLPDGFTVSLVTHTQHHTTLAHKRPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+EVD + +Y+ RL
Sbjct: 176 ERVNLEVDIIAKYVERL 192


>gi|255658130|ref|ZP_05403539.1| riboflavin synthase, alpha subunit [Mitsuokella multacida DSM
           20544]
 gi|260849437|gb|EEX69444.1| riboflavin synthase, alpha subunit [Mitsuokella multacida DSM
           20544]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 112/197 (56%), Gaps = 9/197 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  +     G  L +      + + LG SIA  GICLTV      H   
Sbjct: 1   MFTGIIEEVGTVQRI----GGGSLAIAAETVLTDVHLGDSIAVNGICLTVTSFDRHH--- 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R T++A    G+ +NLER++ L  RL GH+VSGHIDGT  I  L+  G
Sbjct: 54  --FTADVMPETVRRTSLAELKKGSPVNLERALSLSSRLGGHIVSGHIDGTGSIRSLEREG 111

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  ++++   + + I  KGSV L+G+SLTV  V +  F V LI HT E T  +  K G
Sbjct: 112 NALLLKVAVEPAILRGIVEKGSVALDGISLTVAAVTEEDFTVSLIPHTREVTNLREKKAG 171

Query: 181 DLINIEVDSMMRYIARL 197
            ++NIE D + +Y+ ++
Sbjct: 172 SILNIETDVIGKYVEKM 188


>gi|283765796|gb|ADB28290.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 85/140 (60%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ +G+RL + T Y    ++ G S+A +GICLT+V    + +  +W+ VE W 
Sbjct: 1   GCVEDVQPLKQGVRLNITTRYAIESLEFGASMACSGICLTIVERGSKQADSSWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+A W  GT INL+R ++LGD + GHLV GHIDG  EI+     GD++   L +
Sbjct: 61  EALRLTNLAQWTKGTSINLQRPLRLGDEVGGHLVFGHIDGLAEIIDHKNEGDAVRFFLQI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PRRFMSFIVNKGSIALNGTS 140


>gi|78357478|ref|YP_388927.1| riboflavin synthase subunit alpha [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78219883|gb|ABB39232.1| riboflavin synthase, alpha subunit [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 224

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 105/197 (53%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G+I++        R R+   +  +    G SIA  G+CLTV     E   D
Sbjct: 1   MFTGIINGQGEILSADNRGSETRFRIRPRFALTDYVTGESIAVNGVCLTV-----ETYAD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+     AET   +N+ +   G  +NLER++ +GDRL GH+VSGH+D    +  +   G
Sbjct: 56  SWFSAYASAETLSCSNLGALHTGAAVNLERALAVGDRLGGHIVSGHVDCLATVQSVQPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   RL  P      +  KGSV L+G+SLTVN  G +F +V +I  T + TT    K G
Sbjct: 116 LSRVYRLGFPQEFGIQVVDKGSVTLDGISLTVNHCGPDFLEVNIIPETQKVTTIAHWKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ R+
Sbjct: 176 TRVNMETDIIGKYVQRM 192


>gi|296140261|ref|YP_003647504.1| riboflavin synthase, subunit alpha [Tsukamurella paurometabola DSM
           20162]
 gi|296028395|gb|ADG79165.1| riboflavin synthase, alpha subunit [Tsukamurella paurometabola DSM
           20162]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 116/212 (54%), Gaps = 13/212 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I A   +    R  V     TS  K G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEELGVITARDDLPDAARFTVRGDLVTSDAKHGDSIAVNGVCLTVVTVE-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ R ++++  G G  +NLER+  +  RL GH+V GH+DGT  ++ L    
Sbjct: 56  GAFTADVMEESLRRSSLSKLGPGDRVNLERAAAVNSRLGGHIVQGHVDGTGHVISLSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK--------NFFDVLLIRHTIEET 172
                RL+LP  L +++  KGS+ ++GVSLTV+ +G+        ++F+V LI  T+E T
Sbjct: 116 HWTVVRLALPTALARYVVEKGSITIDGVSLTVSALGRGVPGDDAQHWFEVSLIPTTLELT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
                + G ++N+EVD + +Y+ RL  L   +
Sbjct: 176 NLGGAEPGTIVNLEVDIVAKYVERLVTLKEEK 207


>gi|317154510|ref|YP_004122558.1| riboflavin synthase subunit alpha [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944761|gb|ADU63812.1| riboflavin synthase, alpha subunit [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 225

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 111/199 (55%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G++ A        RLR+   +  S ++ G SIA  G CLTV     E   +
Sbjct: 1   MFTGLIMGMGRVEAADARGAETRLRIRALFPLSDIEAGESIAVNGTCLTV-----ETFGN 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+      ET  +T++ +  +G+ +NLER++ +GDR  GH+V+GH+D   E+  +   G
Sbjct: 56  GWFTAYASRETLSVTSLGALKVGSQVNLERAMAMGDRFGGHIVAGHVDCLAEVAGVRPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   RL+ P    + +  KGSV L+G+SLTVN  G ++ +V +I  T E TT      G
Sbjct: 116 ESRIYRLTFPLAQGRHVIPKGSVALDGISLTVNDCGPDWLEVNIIPKTQEATTIAGWTPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R+ A
Sbjct: 176 RRVNMETDIIGKYVERMVA 194


>gi|218296565|ref|ZP_03497293.1| riboflavin synthase, alpha subunit [Thermus aquaticus Y51MC23]
 gi|218243107|gb|EED09639.1| riboflavin synthase, alpha subunit [Thermus aquaticus Y51MC23]
          Length = 194

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 113/198 (57%), Gaps = 9/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G ++ +      +R+R+        +K+G SIA  G CLT V +  E    
Sbjct: 1   MFTGLVEETGVVLEVQE-GPFLRVRIGARKVLEDLKVGDSIAVDGACLTAVAVDGEG--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG  E++ +    
Sbjct: 57  --FWVELAQETLRRTA-PTWRVGHRPNLERALKVGDRLGGHFVTGHVDGVAELVEVREAP 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-NLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +       P    ++IA KGSV LNGVSLTV  L G+ FF V LI HT+  T     +V
Sbjct: 114 GAKDYFFRPPAEYARYIAEKGSVALNGVSLTVAGLAGEAFF-VTLIPHTLAVTNLGGLRV 172

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+EVD + RY+ RL
Sbjct: 173 GDGVNLEVDLIARYLERL 190


>gi|118595160|ref|ZP_01552507.1| riboflavin synthase subunit alpha [Methylophilales bacterium
           HTCC2181]
 gi|118440938|gb|EAV47565.1| riboflavin synthase subunit alpha [Methylophilales bacterium
           HTCC2181]
          Length = 194

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 112/200 (56%), Gaps = 12/200 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+   G I ++  + KG  + V   ++      ++LG SIA  G+CLTV  L+   
Sbjct: 1   MFTGIIESEGTINSL--VKKGADISVKVLFDNGMLDDIQLGDSIAVNGVCLTVEALTNN- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                 E+  +     I+ IA   +   +NLERS+K+  R+ GH V GH+DG  +I  + 
Sbjct: 58  ------ELSFYLSVESISKIADLKLNQKVNLERSLKMNGRISGHFVFGHVDGVCDIKEIK 111

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +       +  P+NL ++IA KGSV L+GVSLTVN V +N F V L+  T+  TT K +
Sbjct: 112 KLDGCEQWFIEAPNNLIKYIAQKGSVSLSGVSLTVNSVDENVFSVNLVPFTLSHTTLKYN 171

Query: 178 KVGDLINIEVDSMMRYIARL 197
           K GD +NIE+D + RY+  +
Sbjct: 172 KTGDKLNIEIDMLARYVESI 191


>gi|322370160|ref|ZP_08044722.1| riboflavin synthase subunit alpha [Haladaptatus paucihalophilus
           DX253]
 gi|320550496|gb|EFW92148.1| riboflavin synthase subunit alpha [Haladaptatus paucihalophilus
           DX253]
          Length = 197

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 107/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I  +     G RL +      S +  G SIA  G CLTV     E   D
Sbjct: 1   MFTGIVAEVGEIRRVEETEGGRRLTIAADEVLSDVADGASIAVNGACLTV-----EEFDD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EV + AET   T +     G  +NLER+++   RLDGH V GH+D T E++ +  +G
Sbjct: 56  DSFEVFLAAETVAKTYLGEIEEGDVVNLERALRADARLDGHFVQGHVDTTTEVVDVREVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      ++P    Q+I  KGSV L+G+SLTV   G++ F V +I  T   T     + G
Sbjct: 116 EDWEYEFAVPEAFGQYIVDKGSVALDGISLTVAEKGEDTFTVAIIPTTRRVTNLSEKEPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +++EVD + +Y   L A
Sbjct: 176 DPVHLEVDVLAKYADELLA 194


>gi|66047688|ref|YP_237529.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           syringae B728a]
 gi|302189351|ref|ZP_07266024.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           syringae 642]
 gi|63258395|gb|AAY39491.1| Lumazine-binding protein [Pseudomonas syringae pv. syringae B728a]
 gi|330899665|gb|EGH31084.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330944973|gb|EGH46765.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330953125|gb|EGH53385.1| riboflavin synthase subunit alpha [Pseudomonas syringae Cit 7]
 gi|330969740|gb|EGH69806.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330976722|gb|EGH76763.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 220

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + + +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLTDVKLGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT  ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTWSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GRKVNLEVDLLARYLERL 193


>gi|74318207|ref|YP_315947.1| riboflavin synthase subunit alpha [Thiobacillus denitrificans ATCC
           25259]
 gi|74057702|gb|AAZ98142.1| Lumazine-binding protein [Thiobacillus denitrificans ATCC 25259]
          Length = 201

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 113/200 (56%), Gaps = 12/200 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS---YNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  IG+I      A+G   R++      + S +  G SIA  G+CLT V L+   
Sbjct: 1   MFTGIIQAIGRIHEYE--ARGADARMVIEGGGLDFSDVAPGDSIAVNGVCLTAVSLAA-- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                + V+V AET   T    +  G  +NLE++++L DRL GHLVSGH+DG   +   +
Sbjct: 57  ---GSFTVDVSAETLSCTE--GFTPGAEVNLEKALRLADRLGGHLVSGHVDGVGTVHRFE 111

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +G+S    +  P  L ++I  KGS+ +NGVSLTVN +    F + LI HT++ T  K  
Sbjct: 112 RVGESQLLEIDAPAALARYIIRKGSIAVNGVSLTVNHIDGARFALNLIPHTVDVTALKHL 171

Query: 178 KVGDLINIEVDSMMRYIARL 197
           + G  +N+EVD + RY+ R+
Sbjct: 172 RPGSRVNLEVDMIARYVERM 191


>gi|221135085|ref|ZP_03561388.1| riboflavin synthase subunit alpha [Glaciecola sp. HTCC2999]
          Length = 223

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 114/200 (57%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +      +RL V     + + + LG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGEISQLHNNGSDIRLTVQCHDLDMTDVALGDSIATNGVCLTVVEFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           DN+Y  +V  ET + T  + +  G  +NLE+++    R  GH+VSGH+DG   +  +  I
Sbjct: 56  DNYYCADVSQETIKYTGFSDYCTGAKVNLEKAMLPTSRFGGHIVSGHVDGVGHVTKI--I 113

Query: 120 GDSMYCRL--SLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               Y  +   +P  +  +IA KGS+ ++GVSLTVN + ++ F + LI HT+E+T    +
Sbjct: 114 DQQKYIEVWVHMPPEIRHYIAHKGSITVDGVSLTVNEITEDEFMLWLIPHTLEKTVISTY 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           KVG  +N+EVD + RY+ RL
Sbjct: 174 KVGTRVNLEVDVIARYLERL 193


>gi|326773584|ref|ZP_08232867.1| riboflavin synthase, alpha subunit [Actinomyces viscosus C505]
 gi|326636814|gb|EGE37717.1| riboflavin synthase, alpha subunit [Actinomyces viscosus C505]
          Length = 216

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 112/216 (51%), Gaps = 18/216 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++I +  I    RL V     T  + LG S++  G CLTV  +       
Sbjct: 1   MFTGIVEELGRVIRLETIEDSARLTVEAPTVTQDVSLGDSVSVNGCCLTVTAVH-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++ AET   T + S   G  +NLER+++ GDRL GH+V GH+D T E+L      
Sbjct: 56  STFTADLMAETLTRTTLGSQAPGDPVNLERALRAGDRLGGHIVQGHVDATAEVLDHHRGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLT------------VNLVGKNFFDVLLIRHT 168
                R+ LP  + +++A+KGSV L+GVSLT            V   G +   V LI  T
Sbjct: 116 HWDLLRIGLPQEIARYVAIKGSVALDGVSLTVVDVVDASDVTPVPGAGAS-LSVGLIPET 174

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           +  TT    + G+ +N+EVD + +Y  RL     SQ
Sbjct: 175 LRRTTLGSRRPGERVNLEVDVLAKYAERLLGARPSQ 210


>gi|196233898|ref|ZP_03132736.1| riboflavin synthase, alpha subunit [Chthoniobacter flavus Ellin428]
 gi|196222092|gb|EDY16624.1| riboflavin synthase, alpha subunit [Chthoniobacter flavus Ellin428]
          Length = 196

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G+++A+   A+G RL V     T  + LG S+A  G CLTV     +    
Sbjct: 1   MFTGLVEETGELLALARSAEGARLTVRAPLVTGDVHLGDSVAVNGCCLTVTAHEGQTLAF 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +  E     ET   TN+ +   G  +NLER++    RL GH V GH+D T  +L  + + 
Sbjct: 61  DLLE-----ETLARTNLGALTPGAPVNLERALAAHARLGGHFVQGHVDTTSRVLAFEQVK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 ++LP    +++A KGS+ ++G+SLTV  V    F V +I HT+  T  +  K G
Sbjct: 116 ADYRLEIALPAEFARYVAFKGSIAIDGISLTVAEVRDPSFVVWIIPHTLSVTNLRAKKAG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           +L+N+E D + +Y+ R+ A
Sbjct: 176 ELVNLEFDLLAKYVERIVA 194


>gi|322807185|emb|CBZ04759.1| riboflavin synthase alpha chain [Clostridium botulinum H04402 065]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 187

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 188 DIINIECDVLGKYIYKF 204


>gi|212702195|ref|ZP_03310323.1| hypothetical protein DESPIG_00206 [Desulfovibrio piger ATCC 29098]
 gi|212674400|gb|EEB34883.1| hypothetical protein DESPIG_00206 [Desulfovibrio piger ATCC 29098]
          Length = 220

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G+I+ +    +  R+ V   +    +  G SIAH G CL+V    E HS  
Sbjct: 1   MFTGIIQGQGEIVGLRRSGQECRMEVRPLFPLENIVDGESIAHNGACLSV----ERHS-G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V    E+   T +     G  +NLER++ LGDRL GHLVSGH+D    +  ++  G
Sbjct: 56  STFTVYASGESLSRTTLGDLRKGDLVNLERALALGDRLGGHLVSGHVDCVATVRSVEQAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+ C L+ P      +  KGSV L+G+SLT+N  GK+F  V +I  T + TT    + G
Sbjct: 116 SSLRCTLAFPPAFAAEVIEKGSVTLDGISLTINACGKDFLTVNVIPDTQKRTTMLHWRPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+ R+
Sbjct: 176 SRVNMETDLIGKYVRRI 192


>gi|162455548|ref|YP_001617915.1| riboflavin synthase [Sorangium cellulosum 'So ce 56']
 gi|161166130|emb|CAN97435.1| Riboflavin synthase [Sorangium cellulosum 'So ce 56']
          Length = 247

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 112/201 (55%), Gaps = 13/201 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  IG +   +    G   R +   +   + LG S++  G CLTV R++      
Sbjct: 1   MFTGLVETIGVLRRRS---GGAVARALVEASLGPLTLGESVSVNGACLTVDRIAP----- 52

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +E ++ AET   T + +  +G  ++LER+  LG R+ GH+V GH+DG   ++     G
Sbjct: 53  GGFECDMSAETLGRTTLGALPVGARVHLERATPLGARMGGHVVLGHVDGLGRVVEHARAG 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHTIEETTWK 175
           D++  R+S PH L  ++A KGS+ ++G SLT+N V        +F+V+L+ HTI  T   
Sbjct: 113 DAIRLRVSAPHELAPYLAPKGSIAVDGASLTLNAVSTPGAAEIWFEVMLVPHTIGRTLLG 172

Query: 176 MHKVGDLINIEVDSMMRYIAR 196
             + G  +N+EVD + RY+AR
Sbjct: 173 ELRPGAAVNLEVDVLARYVAR 193


>gi|153931182|ref|YP_001385130.1| riboflavin synthase subunit alpha [Clostridium botulinum A str.
           ATCC 19397]
 gi|153934504|ref|YP_001388599.1| riboflavin synthase subunit alpha [Clostridium botulinum A str.
           Hall]
 gi|152927226|gb|ABS32726.1| riboflavin synthase, alpha subunit [Clostridium botulinum A str.
           ATCC 19397]
 gi|152930418|gb|ABS35917.1| riboflavin synthase, alpha subunit [Clostridium botulinum A str.
           Hall]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 187

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 188 DIINIECDVLGKYIYKF 204


>gi|126662571|ref|ZP_01733570.1| riboflavin synthase, alpha subunit [Flavobacteria bacterium BAL38]
 gi|126625950|gb|EAZ96639.1| riboflavin synthase, alpha subunit [Flavobacteria bacterium BAL38]
          Length = 240

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 111/200 (55%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G I  +    + + L V +   T ++K+  S+AH GICLTV+++  ++   
Sbjct: 45  MFTGIIETLGIIKEIEKDQENLHLTVESEI-THELKIDQSVAHNGICLTVIKIENKN--- 100

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y V    ET   T+I +W +G  +N+ER++KLGDRLDGHLV GH+D T     +    
Sbjct: 101 --YTVTAIKETIDKTSIGTWNVGDIVNIERAMKLGDRLDGHLVQGHVDQTGTCTNIKEAN 158

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +L      KGS+ +NG SLTV     N F V +I +T + T +   K+G
Sbjct: 159 GSWVFTFDYDASLNNITIEKGSITINGTSLTVVNSKLNEFSVAIIPYTYDHTNFNTFKIG 218

Query: 181 DLINIEVDSMMRYIARLYAL 200
            ++N+E D + +Y++RL  L
Sbjct: 219 TIVNLEFDVIGKYVSRLNEL 238


>gi|302036979|ref|YP_003797301.1| riboflavin synthase subunit alpha [Candidatus Nitrospira defluvii]
 gi|300605043|emb|CBK41376.1| Riboflavin synthase, alpha subunit [Candidatus Nitrospira defluvii]
          Length = 218

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G +  +     G RL ++ S   S + +G S++  G CLT V  +     D
Sbjct: 1   MFSGIVEEMGAVSILNKGLAGTRLTIIASTIMSDLTIGASVSVNGTCLTAVART-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET  +T +     G+ +NLER++KL +R+ GH+VSGH+DG   I      G
Sbjct: 56  HDFSVDVSPETLAVTTLGGLTSGSPVNLERAMKLNERIGGHMVSGHVDGIGAIRSRHQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +  P  + +    KGS+ ++G+SLT+N V +  F V +I HT   TT  + +VG
Sbjct: 116 NALILEIEAPKEIVRLCVPKGSITVDGISLTINEVTERSFVVSIIPHTATVTTLGLKQVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +Y+ RL
Sbjct: 176 DKLNLESDLIGKYVERL 192


>gi|126651229|ref|ZP_01723439.1| riboflavin synthase subunit alpha [Bacillus sp. B14905]
 gi|126592067|gb|EAZ86133.1| riboflavin synthase subunit alpha [Bacillus sp. B14905]
          Length = 218

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 104/194 (53%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG V DIG I A+      M++ V +S     + LG SIA  G+CLTV      H  +
Sbjct: 7   MFTGFVEDIGTIKALQINKNSMKITVQSSKVAEDVGLGDSIAVNGVCLTVT-----HFTN 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
               ++V  ET + TN+    IG  +NLER++    R  GH V+GH+DG  +IL    + 
Sbjct: 62  RELTMDVMPETVKATNLHQLTIGDPVNLERAMPANGRFGGHFVAGHVDGVGKILRKRPVA 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + L   L  F   KGSV ++G SLT+  V      + LI HT +ET   M KVG
Sbjct: 122 NAVYIDIELSEELTSFCIPKGSVTIDGTSLTIFHVETKQVTISLIPHTYKETILGMKKVG 181

Query: 181 DLINIEVDSMMRYI 194
             +NIE D + +YI
Sbjct: 182 AFVNIETDLVGKYI 195


>gi|311068844|ref|YP_003973767.1| riboflavin synthase subunit alpha [Bacillus atrophaeus 1942]
 gi|310869361|gb|ADP32836.1| riboflavin synthase subunit alpha [Bacillus atrophaeus 1942]
          Length = 215

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I +M      M L +  S+    +KLG SIA  GICLTV   ++     
Sbjct: 1   MFTGIIEETGTIESMKKAGLSMALTIKCSHILDDVKLGDSIAVNGICLTVTAFTK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  TQFTVDVMPETVKSTSLNGLSKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEEKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L +  +L + + +KGS+ ++GVSLT+  + ++   V +I HTI ET +    +G
Sbjct: 116 NAVYYDLKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDQVTVSIIPHTISETIFSTKAIG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + +Y+ R 
Sbjct: 176 STVNIECDMIGKYMYRF 192


>gi|89093484|ref|ZP_01166432.1| riboflavin synthase subunit alpha [Oceanospirillum sp. MED92]
 gi|89082174|gb|EAR61398.1| riboflavin synthase subunit alpha [Oceanospirillum sp. MED92]
          Length = 222

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +   +  MRL V T   + + +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAVGTIAGIEEQSGDMRLYVRTGELDLADVKLGDSIATNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T   +  +G  +NLE+++    RL GH+V+GH+DG  EI+     
Sbjct: 56  GDGFVADVSRETLAHTRFHTLSVGERVNLEKALMPTSRLGGHIVTGHVDGLGEIVERKED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P N+++++A KGSV ++G+SLTVN +    F++ ++ HT +ET    +  
Sbjct: 116 ARSIRFSVKAPANIQRYLAAKGSVTVDGISLTVNAIDGECFELNIVPHTAQETIMTEYVP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G L+++EVD + RY+ RL
Sbjct: 176 GRLVHLEVDIIARYLERL 193


>gi|297567807|ref|YP_003686778.1| hypothetical protein Mesil_3463 [Meiothermus silvanus DSM 9946]
 gi|296852256|gb|ADH65270.1| putative hypothetical protein [Meiothermus silvanus DSM 9946]
          Length = 199

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 111/197 (56%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A     +   + +        +++G S+A +G CLTVV    E    
Sbjct: 1   MFTGIVEEVGQVVAARQAGENRVVTIHARKVVEDLRVGDSVACSGACLTVVACEPE---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET   T    W +G  +NLER+++   RL GH+V+GH+DGT ++  +    
Sbjct: 57  -GFTVELSQETLAKTA-PRWSVGARLNLERALRADGRLGGHVVTGHVDGTGKVRGVRPNP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +M   + +P  L  ++  KGSVC++GVSLTV  V +  F V LI HT+  TT    + G
Sbjct: 115 GAMEVTIQVPQGLRPYLVPKGSVCVDGVSLTVVEVKEEAFSVWLIPHTLAVTTLGQLEPG 174

Query: 181 DLINIEVDSMMRYIARL 197
            ++N+E D + +Y+ R+
Sbjct: 175 AVVNLEADILAKYLERM 191


>gi|119502841|ref|ZP_01624926.1| riboflavin synthase subunit alpha [marine gamma proteobacterium
           HTCC2080]
 gi|119461187|gb|EAW42277.1| riboflavin synthase subunit alpha [marine gamma proteobacterium
           HTCC2080]
          Length = 218

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  M      +RLRV+T   + S ++LG SIA +G+CLTV  L      
Sbjct: 1   MFTGIIQAVGEIATMETRGGDLRLRVLTGKLDLSDVQLGDSIATSGVCLTVTGLP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  E+  +T +     G  +NLE+S+    RL GH+VSGH+DG   ++ +   
Sbjct: 56  GDGYWADVSIESLNLTTLGDRKPGDHVNLEKSLTPTSRLGGHIVSGHVDGVGSVVSVAQE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    +S P  L ++IA KGS+ ++G SLTVN V    FD+ +I  T EET +  ++ 
Sbjct: 116 GRSWRYIISAPPELARYIAHKGSITVDGTSLTVNSVDGAEFDLNIIPQTFEETVFGEYRA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  IN+EVD + RY+ RL
Sbjct: 176 GSRINLEVDVIARYLERL 193


>gi|330721630|gb|EGG99647.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC2047]
          Length = 218

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 115/200 (57%), Gaps = 10/200 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  + P    +RL V T   + S + LG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAVGEIHTIQPRDGDVRLYVKTGKLDLSDVALGDSIAVNGVCLTAVELP----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G  +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GDGFWADVSRETINLTCFEFIKQGARVNLEKALTPQTRLGGHLVSGHVDGLGEVISRH-- 113

Query: 120 GDSMYCRLSL--PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
           GD+   R ++  P  L ++I+ KGS+C++G SLTVN V    F++ ++ HTI+ET    +
Sbjct: 114 GDARSERFTIRAPDELAKYISHKGSICIDGTSLTVNAVNGAEFELNIVPHTIQETIIGGY 173

Query: 178 KVGDLINIEVDSMMRYIARL 197
           K G  +N+EVD + RY+ RL
Sbjct: 174 KQGTKVNLEVDQIARYLERL 193


>gi|170759259|ref|YP_001788191.1| riboflavin synthase subunit alpha [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169406248|gb|ACA54659.1| riboflavin synthase, alpha subunit [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + +G S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNIGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINIKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 187

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D+INIE D + +YI +   L   +
Sbjct: 188 DIINIECDVLGKYIYKFMYLKKEE 211


>gi|91788745|ref|YP_549697.1| riboflavin synthase subunit alpha [Polaromonas sp. JS666]
 gi|91697970|gb|ABE44799.1| riboflavin synthase, alpha subunit [Polaromonas sp. JS666]
          Length = 214

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 118/210 (56%), Gaps = 19/210 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI+T +G+I+A+  +      G RL + T       + LG SIA +G C+T   L  
Sbjct: 1   MFTGIITGVGRIVAIHSLGSSSDHGKRLTIETPAGYLDDVGLGDSIALSGACMTAASLD- 59

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
             S +N + V+V AE+ ++ + +   GI   INLE++++  DRL GH+V+GH+DG   + 
Sbjct: 60  --SANNRFCVDVSAESLSKTSGLTQTGI---INLEKALRANDRLGGHIVAGHVDGIGRVT 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-------GKNFFDVLLIRH 167
               +G+S   R+  P  L +++A KGS+ +NG SLTVN V       G +   + LI H
Sbjct: 115 HFAQMGESWELRIRAPRELSKYLAYKGSITVNGASLTVNRVVDLTENTGGSEISINLIPH 174

Query: 168 TIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           T++ T       G  +N+E+D + RY+ R+
Sbjct: 175 TVQNTALGQLAAGSEVNLEIDLIARYVERM 204


>gi|294101990|ref|YP_003553848.1| riboflavin synthase, alpha subunit [Aminobacterium colombiense DSM
           12261]
 gi|293616970|gb|ADE57124.1| riboflavin synthase, alpha subunit [Aminobacterium colombiense DSM
           12261]
          Length = 219

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 115/198 (58%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  IGK++++TP    +RL++      S++ LG S+A +G C+TV       S D
Sbjct: 1   MFTGLIECIGKLVSITPADDVVRLKIEAPMIASELVLGQSVAVSGACVTVT------SHD 54

Query: 61  NW-YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           N  +  ++  ET + T       G+ +NLER++  G R DGH+VSGHIDGT  +  +  +
Sbjct: 55  NRSFTADIMPETQKRTKFRLLKTGSSVNLERALMAGGRFDGHIVSGHIDGTGAVAEIISM 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G +   R+    ++   I VKGSV L+GVSLTV  V +N+F V LI  T+   T    + 
Sbjct: 115 GTTRIMRIEAEKDIIDMIVVKGSVTLDGVSLTVIDVTQNWFSVGLIPVTLAGCTLGTVRE 174

Query: 180 GDLINIEVDSMMRYIARL 197
           G++INIE D + +Y+ + 
Sbjct: 175 GEIINIETDILGKYVLKF 192


>gi|213965609|ref|ZP_03393803.1| riboflavin synthase, alpha subunit [Corynebacterium amycolatum
           SK46]
 gi|213951768|gb|EEB63156.1| riboflavin synthase, alpha subunit [Corynebacterium amycolatum
           SK46]
          Length = 195

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I  +   A  + L +  S     +  G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEIREIHREADSITLTIRASTVLDDVHHGDSIAVNGVCLTVVEFG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  ++  ET   +++    +G+ +NLER+  +G RL GH+V GH+DGT +++      
Sbjct: 56  DFFNADLMQETLDRSSLGQVEVGSKVNLERATAVGQRLGGHIVQGHVDGTGKVISRTPGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R+SLP  L +++  KGS+ ++G SLTV+ VG+ FF+V LI  T+ ++      VG
Sbjct: 116 RWEVVRISLPEQLSKYVVEKGSIAVDGTSLTVSAVGEGFFEVSLIPTTLTDSVIGSIAVG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + +Y+ ++
Sbjct: 176 AKVNLEVDVLAKYVEKM 192


>gi|283765828|gb|ADB28306.1| riboflavin synthase [uncultured Bartonella sp.]
          Length = 140

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 86/140 (61%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  +  + +G+RL + T Y+   +++G SIA +GICLT+V    + +  NW+ VE W 
Sbjct: 1   GCVEDVQSLKQGVRLNISTHYDLESLEIGASIACSGICLTLVERGSKCANLNWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           E  R+TN+  W  GT INLERS+KLGD + GHLV GHIDG  E++     GD++   L +
Sbjct: 61  EALRLTNLTEWKKGTRINLERSLKLGDEIGGHLVFGHIDGLAEVIDQKNEGDAIRFFLKI 120

Query: 130 PHNLEQFIAVKGSVCLNGVS 149
           P     FI  KGS+ LNG S
Sbjct: 121 PKQFTPFIVNKGSIALNGTS 140


>gi|254775812|ref|ZP_05217328.1| riboflavin synthase subunit alpha [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 199

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A   +A   RL +  +  T+    G SIA  G+CLTV  L      D
Sbjct: 1   MFTGIVEELGEVTARDVLADAARLTIRGAVVTADAGHGDSIAVNGVCLTVAELLP----D 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  L  RL GH+V GH+DGT  I+      
Sbjct: 57  GRFTADVMGETLNRSNLGALQVGSRVNLERAAALNSRLGGHIVQGHVDGTGRIVARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEVPPEVARYVVEKGSITVDGISLTVSGLGGEPRDWFEVSLIPTTRELTTLGGA 176

Query: 178 KVGDLINIEVDSMMRYIARLYA 199
            VG  +N+EVD + +Y+ RL +
Sbjct: 177 PVGTQVNLEVDVIAKYVERLMS 198


>gi|118467379|ref|YP_887387.1| riboflavin synthase subunit alpha [Mycobacterium smegmatis str. MC2
           155]
 gi|118168666|gb|ABK69562.1| riboflavin synthase, alpha subunit [Mycobacterium smegmatis str.
           MC2 155]
          Length = 199

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 112/199 (56%), Gaps = 4/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G ++    +    RL +     T+    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGVLVDKAELDDSARLTIRGPVVTADAGHGDSIAVNGVCLTVVDVLP----D 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++A   +G  +NLER+  +  RL GH+V GH+DGT  ++      
Sbjct: 57  GAFTADVMGETLNRSSLAGVAVGDRVNLERAAAVNSRLGGHIVQGHVDGTGSVISRTPHE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R++LP  L +++  KGS+ ++GVSLTV+ +G ++F++ LI  T E TT     VG
Sbjct: 117 HWEVVRIALPPALSRYVVEKGSITVDGVSLTVSAIGDDWFEISLIPTTRELTTLGTAPVG 176

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ RL +
Sbjct: 177 TTVNLEVDVIAKYVERLMS 195


>gi|294010278|ref|YP_003543738.1| riboflavin synthase alpha-chain [Sphingobium japonicum UT26S]
 gi|292673608|dbj|BAI95126.1| riboflavin synthase alpha-chain [Sphingobium japonicum UT26S]
          Length = 204

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 119/210 (56%), Gaps = 13/210 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+TDIG I   T   +G +RL +  +Y+   + +G SIA +G CLTVV    E   
Sbjct: 1   MFTGIITDIGTI--RTHEQRGDLRLVIGCAYDMETVAIGASIACSGACLTVV----EKGA 54

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D W+ V++ AET   T    W +G  +NLER++K+GD L GH+V+GH+DG   ++     
Sbjct: 55  D-WFAVDLSAETVARTAPGLWELGGRLNLERALKVGDELGGHIVTGHVDGIGTLVSAAHE 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTW 174
           GDS    +S P  L   +A KGS+ ++G+SLTVN V     G   F + +I HT   TT 
Sbjct: 114 GDSTRLIISAPAALAPALAAKGSITVDGISLTVNTVEDQADGSVHFGLNIIPHTAAATTL 173

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
                G   N+E+D + RY+ R+ +L  + 
Sbjct: 174 DRLTPGRAFNLEIDVLARYLDRMQSLRAAS 203


>gi|304383109|ref|ZP_07365584.1| riboflavin synthase subunit alpha [Prevotella marshii DSM 16973]
 gi|304335795|gb|EFM02050.1| riboflavin synthase subunit alpha [Prevotella marshii DSM 16973]
          Length = 200

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 110/205 (53%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV     +I++    + +   +   + T ++K+  SIAH G+CLTVVRL      D
Sbjct: 1   MFSGIVESFATVISIEKDKENIDFTLSCPF-TDELKIDQSIAHNGVCLTVVRLE-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET R TN+    +G  +N+ERS+ +  RLDGH+V GH+D T +   +    
Sbjct: 55  NTYTVTAMLETLRRTNLGLLKVGDKVNIERSMLMNGRLDGHIVQGHVDLTAQCTAIQDAD 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y   +   + E      F   KGSV +NGVSLTV     N F V +I +T E T + 
Sbjct: 115 GSTYFTFTYHEDPEMTQRGYFTVDKGSVTVNGVSLTVCRPTANSFQVAIIPYTKEHTNFC 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
              +G  +NIE D + +YIARL+ L
Sbjct: 175 DIAIGSTVNIEFDILGKYIARLHEL 199


>gi|15837554|ref|NP_298242.1| riboflavin synthase subunit alpha [Xylella fastidiosa 9a5c]
 gi|9105880|gb|AAF83762.1|AE003934_4 riboflavin synthase alpha chain [Xylella fastidiosa 9a5c]
          Length = 200

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 113/207 (54%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G++ A   + +G  +R      T   S++  G SIA  G+CLTV       
Sbjct: 1   MFTGIIGGVGRLAAR--VRQGGDVRFTFEVGTLPFSEVSYGESIAVNGVCLTVTAFDAL- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                ++ +   ET  +T +     G  +NLER++   DRL GHLVSGH+DG   +L + 
Sbjct: 58  ----CFQADASTETLALTTLGQLPEGATLNLERAMCPTDRLGGHLVSGHVDGIGRVLSVH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               +     ++P  L +++A KGS+C++GVSLTVN V    F+V LI HT+  T +   
Sbjct: 114 EDARAQRWSFAVPVPLLKYVAKKGSICVDGVSLTVNAVNAEGFEVALIPHTVAHTRFSRT 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
            +G+ +N+E+D + RY+ RL  +   Q
Sbjct: 174 VIGEAVNLEIDLIARYVERLLVMGNKQ 200


>gi|54025571|ref|YP_119813.1| riboflavin synthase subunit alpha [Nocardia farcinica IFM 10152]
 gi|54017079|dbj|BAD58449.1| putative riboflavin synthase alpha subunit [Nocardia farcinica IFM
           10152]
          Length = 207

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 116/208 (55%), Gaps = 14/208 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +A   RL +     TS    G SIA  G+CLTVV + +  S  
Sbjct: 1   MFTGIVEELGEIVAVARLADAARLTIRGKLVTSDAGHGDSIAVNGVCLTVVDVLDGDS-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   ++I     G  +NLER+  L  RL GHLV GH+DGT  +L      
Sbjct: 59  --FTVDVMQETLDRSSIGGLEAGARVNLERAAALNSRLGGHLVQGHVDGTGTVLARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----------KNFFDVLLIRHTIE 170
           +    R+SLP  + +++  KGS+ ++G+SLTV+ +G          +++F+V LI  T+ 
Sbjct: 117 NWEVVRISLPDAIARYVVEKGSITVDGISLTVSGLGRSEQPATDGNRDWFEVSLIPTTLS 176

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLY 198
            T      VG  +N+EVD + +Y+ RL 
Sbjct: 177 LTNLGSAAVGTRVNLEVDVIAKYVERLQ 204


>gi|237747122|ref|ZP_04577602.1| riboflavin synthase [Oxalobacter formigenes HOxBLS]
 gi|229378473|gb|EEO28564.1| riboflavin synthase [Oxalobacter formigenes HOxBLS]
          Length = 207

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 116/209 (55%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +GKI+++TP       G+RL +   S    K+ +G SIA  G C+TVV    
Sbjct: 1   MFTGIVEAVGKIMSVTPQGADENAGVRLEIDAGSLAMDKVGIGDSIAINGACMTVV---- 56

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
               D  ++V+V  E+ N+   +   G    +NLE+++  GD L GHLVSGH+DG   + 
Sbjct: 57  -EKTDRSFKVDVSRESLNKTAGLDRTG---EVNLEKALAFGDALGGHLVSGHVDGIGTVR 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIE 170
               + +S    +  P  L +F+A KGSV ++GVSLTVN V        F V LI HT++
Sbjct: 113 EFTPVAESRKLVVEAPAELGKFLAYKGSVAVDGVSLTVNKVNDVGTGCLFSVNLIPHTVD 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            T  K   VG  +N+E+D + RY+ R+ +
Sbjct: 173 VTALKNLSVGSKVNLEIDLIARYVERMLS 201


>gi|169237115|ref|YP_001690315.1| riboflavin synthase subunit alpha [Halobacterium salinarum R1]
 gi|167728181|emb|CAP14969.1| riboflavin synthase alpha subunit [Halobacterium salinarum R1]
          Length = 211

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +     G RLR+  +        G SI+  G+CLTV    E     
Sbjct: 1   MFTGIIEETGTVERVVDDDDGRRLRIAVT-GFGAFSHGESISVGGVCLTVEDWGE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V   AET   T +++   G  +NLER++    RLDGH+V GH+D T E++ ++ +G
Sbjct: 55  DWFSVFTAAETLSKTTLSAVSSGDRVNLERALPADGRLDGHVVQGHVDTTTEVVDIEQVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF--FDVLLIRHTIEETTWKMHK 178
           +      +LP    Q++A KGS+ L+G+SLTV  +      F V +I  T E T+     
Sbjct: 115 EDWTFTFALPDGHAQYVAPKGSIALDGISLTVADIDDEAGTFSVAVIPTTYELTSLSERS 174

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
            GD +N+EVD + +Y+ R+ + ++S
Sbjct: 175 PGDRVNVEVDVLAKYVERMASYDSS 199


>gi|153855731|ref|ZP_01996745.1| hypothetical protein DORLON_02763 [Dorea longicatena DSM 13814]
 gi|149751954|gb|EDM61885.1| hypothetical protein DORLON_02763 [Dorea longicatena DSM 13814]
          Length = 217

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G +  M    +   L V       + K+G SIA  G+CLTV  L       
Sbjct: 1   MFTGIVEEKGSVRYMQLTGESGVLAVKAKKVLERTKIGDSIAVNGVCLTVTSLQ-----P 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET R +++ S  +G+ +NLER++    R  GH+VSGHIDGT  I  L    
Sbjct: 56  DGFTADVMAETIRRSSLGSCKVGSQVNLERAMAADGRFGGHIVSGHIDGTGVIRSLTREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     +   I  KGS+C++G+SLTV  V +  F V +I HT EETT      G
Sbjct: 116 NAIWVSIGTSPQILHLIVEKGSICIDGISLTVAKVEEEGFQVSVIPHTGEETTLLEKVPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ RL  L  S+
Sbjct: 176 DSVNLENDVIGKYVERLLGLGKSE 199


>gi|291518543|emb|CBK73764.1| riboflavin synthase, alpha subunit [Butyrivibrio fibrisolvens 16/4]
          Length = 210

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +T  +K  RL +        M +G SIA  G+CLTVV  +      
Sbjct: 1   MFTGIIEELGKVQRITRGSKEQRLVINCKKILEDMHIGDSIAVNGVCLTVVEFN-----I 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   + +    +G+ +NLER++    R  GH+VSGHIDGT +I  +   G
Sbjct: 56  NSFSADVMNETFSRSGLGELTLGSVVNLERAMAANGRFGGHIVSGHIDGTGKIKSVRQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +S+   + + I  KGS+ ++G+SLTV  VG++ F V +I HT++ T     +VG
Sbjct: 116 NAVWFEISVDSKILRGIVEKGSIAIDGISLTVAAVGRDSFKVSIIPHTLKVTVLGSKRVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +YI++   
Sbjct: 176 DRVNLENDVIGKYISKFLG 194


>gi|168187452|ref|ZP_02622087.1| riboflavin synthase, alpha subunit [Clostridium botulinum C str.
           Eklund]
 gi|169294653|gb|EDS76786.1| riboflavin synthase, alpha subunit [Clostridium botulinum C str.
           Eklund]
          Length = 216

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I ++    +  R+++  +     + LG SI   G+CLTV     +    
Sbjct: 1   MFTGIVEEIGTINSIFQSGENARIKIDANKVLEDVNLGDSICTNGVCLTVTEYDSK---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R +N+     G  +NLER++ LG R  GH+VSGHIDG   I      G
Sbjct: 57  -GFTVDVMGETLRRSNLGELKKGDKVNLERALALGGRFGGHIVSGHIDGIGVIKEFSNEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +   +N+ + I  KGS+ ++GVSLTV  V  + F V +I HT  ET     K G
Sbjct: 116 NAIWISIEAINNILKSIVFKGSITIDGVSLTVAYVDDDIFKVCIIPHTQSETILTSKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +YI +L  +   +
Sbjct: 176 DKVNLECDVIAKYIEKLLMVQEKE 199


>gi|83721233|ref|YP_442085.1| riboflavin synthase subunit alpha [Burkholderia thailandensis E264]
 gi|167619027|ref|ZP_02387658.1| riboflavin synthase subunit alpha [Burkholderia thailandensis Bt4]
 gi|257138272|ref|ZP_05586534.1| riboflavin synthase subunit alpha [Burkholderia thailandensis E264]
 gi|83655058|gb|ABC39121.1| riboflavin synthase, alpha subunit [Burkholderia thailandensis
           E264]
          Length = 209

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 120/209 (57%), Gaps = 18/209 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + PIA     G+RL +   + + + + +G SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIETIEPIASSPEAGVRLTLRAGALDLADVAIGDSIAIQGACMTVVAKTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                + ++VEV  E+ N+   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----DTFDVEVSRESLNKTVGLAEAG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRVLAPRELGRYLAYKGSITVNGVSLTVNSVEDRDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            TT +    G  +N+E+D + RY  R+ +
Sbjct: 173 VTTLRHLTAGAKVNLEIDMIARYTERMLS 201


>gi|325282060|ref|YP_004254602.1| riboflavin synthase, alpha subunit [Odoribacter splanchnicus DSM
           20712]
 gi|324313869|gb|ADY34422.1| riboflavin synthase, alpha subunit [Odoribacter splanchnicus DSM
           20712]
          Length = 212

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 116/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGKI ++   +K + L V      +  ++G SIA  G+CLTVV        +
Sbjct: 1   MFTGIIEEIGKIKSVKRGSKSVVLEVEARKVLADTRIGDSIATNGVCLTVVGKG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +N+     G  +NLER++ L  RL GHLV+GH+DGT +I+      
Sbjct: 56  DGFSADVMPETMNRSNLGLLKPGDPVNLERALCLNSRLGGHLVAGHVDGTGKIVSKQQDE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGSV ++GVSLT+    +  F V +I HT EETT    ++G
Sbjct: 116 NAIWLTVGAAPEILRYIVEKGSVAIDGVSLTIAYADEQVFKVSVIPHTQEETTLVKKEIG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E D +++Y+ +L
Sbjct: 176 DVVNLENDMIVKYVEKL 192


>gi|291522093|emb|CBK80386.1| riboflavin synthase, alpha subunit [Coprococcus catus GD/7]
          Length = 218

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 112/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  + P     RL V  +      ++G SIA  GICLTV  +       
Sbjct: 1   MFTGIIEEIGIVKQLVPGKVSYRLTVSANKVLEGTQVGDSIATNGICLTVTAIH-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N ++ +V AET R TN +S   G+ +NLER++    RL GH+VSGHIDGT  I  +    
Sbjct: 56  NNFDADVMAETVRRTNFSSLHAGSRVNLERALTPMSRLGGHIVSGHIDGTGTISDMTRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    +L +++  KGS+ ++GVSLT+  V    F V +I HT EET     K G
Sbjct: 116 NAVWVTVQTKPDLLKYMIEKGSIAIDGVSLTIAYVDDGCFKVSVIPHTGEETILLKKKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +Y+ +L
Sbjct: 176 DTVNLECDLIGKYVEKL 192


>gi|153939832|ref|YP_001392146.1| riboflavin synthase subunit alpha [Clostridium botulinum F str.
           Langeland]
 gi|152935728|gb|ABS41226.1| riboflavin synthase, alpha subunit [Clostridium botulinum F str.
           Langeland]
 gi|295320151|gb|ADG00529.1| riboflavin synthase, alpha subunit [Clostridium botulinum F str.
           230613]
          Length = 228

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++GKI+ +      + + +  S     + LG S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGKILKIEEGKDFLHITIEGSKVLKPLNLGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++     G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGILSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 187

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 188 DIINIECDVLGKYIYKF 204


>gi|16079384|ref|NP_390208.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221310244|ref|ZP_03592091.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314568|ref|ZP_03596373.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319490|ref|ZP_03600784.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323766|ref|ZP_03605060.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|132633|sp|P16440|RISA_BACSU RecName: Full=Riboflavin synthase alpha chain
 gi|40086|emb|CAA35879.1| unnamed protein product [Bacillus subtilis]
 gi|410126|gb|AAA67482.1| ribB [Bacillus subtilis subsp. subtilis str. 168]
 gi|2634762|emb|CAB14259.1| riboflavin synthase (alpha subunit) [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 215

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I +M      M L +  S     + LG SIA  GICLTV   ++     
Sbjct: 1   MFTGIIEETGTIESMKKAGHAMALTIKCSKILEDVHLGDSIAVNGICLTVTDFTK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNDLTKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEEKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L +  +L + + +KGS+ ++GVSLT+  + ++   + LI HTI ET +    +G
Sbjct: 116 NAVYYDLKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHTISETIFSEKTIG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + +Y+ R 
Sbjct: 176 SKVNIECDMIGKYMYRF 192


>gi|326382173|ref|ZP_08203865.1| riboflavin synthase subunit alpha [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198903|gb|EGD56085.1| riboflavin synthase subunit alpha [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 214

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 109/202 (53%), Gaps = 10/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G++ A   + +  R R+     TS    G SIA  G+CLTV  L E     
Sbjct: 1   MFTGIVEERGEVTARDDLTEAARFRIRGPLVTSDASFGDSIAVNGVCLTVTELGEGE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET   +++   G G  +NLER++  G R  GH+V GH+DG   I  +    
Sbjct: 58  --FTVDVMAETLERSSLDRLGPGASVNLERAMAAGGRFGGHIVQGHVDGVGVIASVSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK-----NFFDVLLIRHTIEETTWK 175
           +    R+ LP  L +++  KGS+ ++G+SLTV+ +G      ++ +V LI  T+ ET   
Sbjct: 116 NWTVVRVQLPAQLSRYVVEKGSITIDGISLTVSAIGSDREYGDWLEVSLIPTTLAETNLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
               G  +N+EVD + +Y+ RL
Sbjct: 176 DAAAGVRVNLEVDVIAKYVERL 197


>gi|261856454|ref|YP_003263737.1| riboflavin synthase, subunit alpha [Halothiobacillus neapolitanus
           c2]
 gi|261836923|gb|ACX96690.1| riboflavin synthase, alpha subunit [Halothiobacillus neapolitanus
           c2]
          Length = 216

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 112/200 (56%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  + P    ++L +     + +K+ LG SIA  G+CLTV    + HS 
Sbjct: 1   MFTGIIQSVGSMQTLAPKGGDIQLTIDAGKLDMNKIALGDSIAVNGVCLTVTAF-DAHS- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+   ET + T +     G+ +NLE ++ L   L GHLVSGH+DG  E+      
Sbjct: 59  ---FTVDCSRETLKFTTLGHLKPGSPVNLETALTLSTPLGGHLVSGHVDGLAEVESRSED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L  P +L ++IA KGSV ++GVSLTVN V    F + +I HT+E+T    ++ 
Sbjct: 116 ARATSFWLRAPDDLSKYIAKKGSVTIDGVSLTVNDVDGARFRLTIIPHTLEQTIMGRYQA 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+E+D + RY+ RL A
Sbjct: 176 GGSVNLEIDVVARYLERLLA 195


>gi|300775901|ref|ZP_07085761.1| riboflavin synthase subunit alpha [Chryseobacterium gleum ATCC
           35910]
 gi|300505451|gb|EFK36589.1| riboflavin synthase subunit alpha [Chryseobacterium gleum ATCC
           35910]
          Length = 194

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 110/197 (55%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G I  +      +   +   + T+++K+  S+AH G CLTVV +      D
Sbjct: 1   MFTGIIEAVGVIEKIEEKGSNIDFTLTCPF-TNELKIDQSLAHNGCCLTVVEIK-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   TN+  W +GT +NLER +K+  RLDGH+V GH+D T E++ ++   
Sbjct: 55  NHYVVTAINETLEKTNLGKWELGTVVNLERCMKMDGRLDGHIVQGHVDKTGEVVSIENKD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S +  +   ++       +GS+ +NG+SLTV       F V +I +T E T  K  K+G
Sbjct: 115 GSYFITMKYDNDGSFVTVPQGSITVNGISLTVAKSEDAQFSVAIIPYTWEFTNMKHLKIG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +YIARL
Sbjct: 175 DKVNLEFDIIGKYIARL 191


>gi|32448032|emb|CAD77549.1| riboflavin synthase alpha chain [Rhodopirellula baltica SH 1]
          Length = 240

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 16/204 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN------TSKMKLGCSIAHAGICLTVVRLS 54
           MFTG+V  +G++ A+     G RL V+T+ +         +KLG SIA  G CLTVV + 
Sbjct: 17  MFTGLVESVGQLSAVVEQPPGRRL-VITAPSFRDDDPARDVKLGDSIAINGCCLTVVEID 75

Query: 55  EEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
            +         E   ET   TN+      + +NLERS+ +GDR+ GH V+GH+D   +++
Sbjct: 76  GDK-----LSFEAGEETLSRTNLGELTAESTVNLERSLAVGDRMGGHYVTGHVDCVGQLI 130

Query: 115 FLDFIGDSMYCRL--SLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
             + I D  +  L  S+P    + I  KGS+ ++G+SLTV  VG+++F V LI HT++ T
Sbjct: 131 --ERIDDPPWANLKFSVPAPYPRQIVAKGSITVDGISLTVVDVGEDYFTVALIPHTLDAT 188

Query: 173 TWKMHKVGDLINIEVDSMMRYIAR 196
           T    +VGD IN+E D + +Y+ R
Sbjct: 189 TLGRRRVGDHINLETDLLAKYVQR 212


>gi|296170726|ref|ZP_06852299.1| riboflavin synthase subunit alpha [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894609|gb|EFG74345.1| riboflavin synthase subunit alpha [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 201

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 113/200 (56%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++     +A   RL +     TS    G SIA  G+CLTVV L      D
Sbjct: 1   MFTGIVEELGEVTGRDVLADAARLTIRGPVVTSDAGHGDSIAVNGVCLTVVELLP----D 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  +  RL GH+V GH+DGT E++      
Sbjct: 57  GQFTADVMEETLNRSNLGALQVGSPVNLERAAAVNSRLGGHIVQGHVDGTGEVVGRAPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK---NFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G    ++F+V LI  T E TT    
Sbjct: 117 HWEVVRIGIPPAVARYVVEKGSITVDGISLTVSGLGTGPGDWFEVSLIPTTRELTTLGRA 176

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VG  +N+EVD + +Y+ RL
Sbjct: 177 PVGTQVNLEVDVIAKYVERL 196


>gi|41407237|ref|NP_960073.1| riboflavin synthase subunit alpha [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118462391|ref|YP_882548.1| riboflavin synthase subunit alpha [Mycobacterium avium 104]
 gi|41395588|gb|AAS03456.1| RibC [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118163678|gb|ABK64575.1| riboflavin synthase, alpha subunit [Mycobacterium avium 104]
          Length = 199

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A   +A   RL +  +  T+    G SIA  G+CLTV  L      D
Sbjct: 1   MFTGIVEELGEVTARDVLADAARLTIRGAVVTADAGHGDSIAVNGVCLTVAELLP----D 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  +  RL GH+V GH+DGT  I+      
Sbjct: 57  GRFSADVMGETLNRSNLGALQVGSRVNLERAAAVNSRLGGHIVQGHVDGTGRIVARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEVPPEVARYVVEKGSITVDGISLTVSGLGGEPRDWFEVSLIPTTRELTTLGGA 176

Query: 178 KVGDLINIEVDSMMRYIARLYA 199
            VG  +N+EVD + +Y+ RL +
Sbjct: 177 PVGTQVNLEVDVIAKYVERLMS 198


>gi|332827926|gb|EGK00648.1| riboflavin synthase, alpha subunit [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 199

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 117/205 (57%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV +  K++++   A+ + + +  S+ T ++K+  S++H G+CLTVV +      D
Sbjct: 1   MFSGIVEEAAKVVSLRKEAENLHITMECSF-THELKIDQSVSHNGVCLTVVNID-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   +N+    +G  +NLERS+ +  RLDGH+V GH+D T +   +    
Sbjct: 55  NKYTVTAIKETLECSNLGLLKVGDKVNLERSMLMNGRLDGHIVQGHVDQTAKCAEIREAD 114

Query: 121 DSMYCRLSLPHNLEQ----FIAV-KGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y +     + E     ++ V KGSV +NGVSLTV     N F+V +I +T E T + 
Sbjct: 115 GSWYFKFEYEFDREMAKKGYLTVDKGSVTVNGVSLTVVDPTNNTFEVAIIPYTYEHTNFH 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
             KVG ++N+E D + +YI+R+  L
Sbjct: 175 QFKVGSVVNLEFDIIGKYISRITQL 199


>gi|321311799|ref|YP_004204086.1| riboflavin synthase subunit alpha [Bacillus subtilis BSn5]
 gi|291484756|dbj|BAI85831.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018073|gb|ADV93059.1| riboflavin synthase subunit alpha [Bacillus subtilis BSn5]
          Length = 215

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I +M      M L +  S     + LG SIA  GICLTV   ++     
Sbjct: 1   MFTGIIEETGTIESMKKAGHSMALTIKCSKILEDVHLGDSIAVNGICLTVTDFTK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNDLTKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEEKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L +  +L + + +KGS+ ++GVSLT+  + ++   + LI HTI ET +    +G
Sbjct: 116 NAVYYDLKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHTISETIFSEKTIG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +NIE D + +Y+ R 
Sbjct: 176 SKVNIECDMIGKYMYRF 192


>gi|164687267|ref|ZP_02211295.1| hypothetical protein CLOBAR_00908 [Clostridium bartlettii DSM
           16795]
 gi|164603691|gb|EDQ97156.1| hypothetical protein CLOBAR_00908 [Clostridium bartlettii DSM
           16795]
          Length = 218

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 114/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +T   K  ++R+  +     + LG SIA  G+CLTV  + +     
Sbjct: 1   MFTGIVEEVGIVKNITASGKSGKIRICANKVLEDVHLGDSIAVNGVCLTVCEIFQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET R TN+++    + +NLER++ L  R  GH+V+GH+D T  I+      
Sbjct: 56  NEFVADVMMETVRATNLSTLTRNSKVNLERAMSLSSRFGGHIVTGHVDTTGTIVDFKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    +   ++  KGS+ ++GVSLTV  V K    V +I HT E TT    KVG
Sbjct: 116 NAVWISIKADEDFLDYVVYKGSITIDGVSLTVAYVDKKILKVSIIPHTKESTTLLGKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+N+E D + +Y+ R  +L+
Sbjct: 176 DLVNLESDIIGKYVKRFTSLS 196


>gi|116623315|ref|YP_825471.1| riboflavin synthase subunit alpha [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226477|gb|ABJ85186.1| riboflavin synthase, alpha subunit [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 213

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 110/195 (56%), Gaps = 6/195 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I A+   A G RL +  S   S    G SIA  G+CLT V L       
Sbjct: 1   MFTGIIEELGAIEAVQTRAAGARLTIRCSAVLSDAVEGASIAVNGVCLTAVDLRPAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  ET + +N+     G+ +NLER +    RL+GH+V GH+DGT E L L+ +G
Sbjct: 58  --FSADLAPETLQRSNLGDLRAGSRVNLERPLSPTGRLNGHIVQGHVDGTGEFLSLEALG 115

Query: 121 D-SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           D + + R+ +P  L+ ++  KGS+ ++G+SLT+  +  +   V +I HT   TT   ++ 
Sbjct: 116 DDNWWLRIRVPAELDPYLVFKGSIAIDGISLTIASLESDVLAVTIIPHTFRGTTLGSYRP 175

Query: 180 GDLINIEVDSMMRYI 194
           G  +N+E D + +++
Sbjct: 176 GARVNLECDVLAKHV 190


>gi|288927955|ref|ZP_06421802.1| riboflavin synthase, alpha subunit [Prevotella sp. oral taxon 317
           str. F0108]
 gi|288330789|gb|EFC69373.1| riboflavin synthase, alpha subunit [Prevotella sp. oral taxon 317
           str. F0108]
          Length = 202

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 117/206 (56%), Gaps = 11/206 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  ++AM    + +     +++ T+++K+  S+AH G+CLTVV L  ++   
Sbjct: 1   MFSGIVEEMATLVAMKRYEENIDFTFKSTF-TNELKIDQSVAHNGVCLTVVELDGDN--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y V    ET   +N+    +G  +N+ERS+K+  RLDGH+V GH+D T   + ++   
Sbjct: 57  --YTVTAMKETLIKSNLGLLQVGDKVNIERSMKMNGRLDGHIVQGHVDTTATCIAMEDAE 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y       N EQ     F   KGSV +NGVSLTV    +  F V +I +T E T + 
Sbjct: 115 GSTYFTFEYAFNPEQVGRGYFTVDKGSVTVNGVSLTVVSPTECTFKVAIIPYTRENTNFC 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALN 201
             KVG ++N+E D + +YIAR+ +L+
Sbjct: 175 DIKVGAVVNLEFDILGKYIARMQSLS 200


>gi|306820098|ref|ZP_07453746.1| riboflavin synthase subunit alpha [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551876|gb|EFM39819.1| riboflavin synthase subunit alpha [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 222

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 116/194 (59%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK+ ++   +    L +  +     + +G SIA  GICLTV   +++    
Sbjct: 1   MFTGIVEETGKVSSIKRGSHSAILSIAANKILEDIHIGDSIAVNGICLTVTSFNKQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET + ++++  GIG F+NLER++ +G R  GH+VSGH+DGT EI ++    
Sbjct: 57  -GFSADVMHETIKRSSLSDIGIGDFVNLERAMPVGGRFGGHIVSGHVDGTGEITYIQRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +     + ++I  KGS+ ++G+SLTV  V ++ F +  I HT+E +  K  K+G
Sbjct: 116 NAILYTIKADSKIIRYIVEKGSITVDGMSLTVVSVNEDTFIISAIPHTVEVSILKYRKLG 175

Query: 181 DLINIEVDSMMRYI 194
           D +N+EVD + +YI
Sbjct: 176 DKVNLEVDIVGKYI 189


>gi|161579025|ref|NP_870472.2| riboflavin synthase subunit alpha [Rhodopirellula baltica SH 1]
          Length = 224

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 16/204 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN------TSKMKLGCSIAHAGICLTVVRLS 54
           MFTG+V  +G++ A+     G RL V+T+ +         +KLG SIA  G CLTVV + 
Sbjct: 1   MFTGLVESVGQLSAVVEQPPGRRL-VITAPSFRDDDPARDVKLGDSIAINGCCLTVVEID 59

Query: 55  EEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
            +         E   ET   TN+      + +NLERS+ +GDR+ GH V+GH+D   +++
Sbjct: 60  GDK-----LSFEAGEETLSRTNLGELTAESTVNLERSLAVGDRMGGHYVTGHVDCVGQLI 114

Query: 115 FLDFIGDSMYCRL--SLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
             + I D  +  L  S+P    + I  KGS+ ++G+SLTV  VG+++F V LI HT++ T
Sbjct: 115 --ERIDDPPWANLKFSVPAPYPRQIVAKGSITVDGISLTVVDVGEDYFTVALIPHTLDAT 172

Query: 173 TWKMHKVGDLINIEVDSMMRYIAR 196
           T    +VGD IN+E D + +Y+ R
Sbjct: 173 TLGRRRVGDHINLETDLLAKYVQR 196


>gi|288555992|ref|YP_003427927.1| riboflavin synthase subunit alpha [Bacillus pseudofirmus OF4]
 gi|288547152|gb|ADC51035.1| riboflavin synthase subunit alpha [Bacillus pseudofirmus OF4]
          Length = 223

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+I  +    + + + +      S + LG SIA  G+CLTV   +     +
Sbjct: 1   MFTGIIEEIGRIDQVRQSGEAIVMNIAAKKVLSDVALGDSIAVNGVCLTVTSYT-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V++  ET R T++   G G  +NLER++    R  GH VSGH+DG  +I+  +   
Sbjct: 56  HSFTVDLMPETVRATSLNGLGRGAKVNLERAMSAEGRFGGHFVSGHVDGIGKIISKEPKD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L  ++  KGSV ++G SLT+  V +N F + +I HTIEET      VG
Sbjct: 116 NAVYYTIEVSDDLRHYMIHKGSVAVDGTSLTIFGVDENSFTISIIPHTIEETIIGSKGVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIE D + +YI + 
Sbjct: 176 DIVNIECDMIGKYIEQF 192


>gi|228471233|ref|ZP_04056046.1| riboflavin synthase, alpha subunit [Porphyromonas uenonis 60-3]
 gi|228307048|gb|EEK16130.1| riboflavin synthase, alpha subunit [Porphyromonas uenonis 60-3]
          Length = 200

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 118/206 (57%), Gaps = 11/206 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV  + ++  +T     + + +  S+  +++++  SIAH G+CLTVV L E     
Sbjct: 1   MFSGIVEGMAQVRRLTREGSNLHITLACSF-AAELQIDQSIAHNGVCLTVVSLEE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y V    ET   +N+    +G ++N+ERS+ LG RLDGH+V GH+D T     +  + 
Sbjct: 55  GGYTVTAVQETLDRSNLGLLQVGDYVNVERSMMLGGRLDGHIVQGHVDQTARCTAIREMD 114

Query: 121 DSMYCRLSLPHNLEQ----FIAV-KGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y   +   + E     ++ V KGSV +NGVSLTV    +N F+V +I +T+E T +K
Sbjct: 115 GSHYFTFAYEVDREMMRQGYMTVEKGSVTVNGVSLTVCNSQENSFEVAIIPYTLEHTNFK 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALN 201
             K G ++N+E D + +YIARL + +
Sbjct: 175 YFKEGSVVNLEFDILGKYIARLRSFD 200


>gi|282859432|ref|ZP_06268537.1| riboflavin synthase, alpha subunit [Prevotella bivia JCVIHMP010]
 gi|282587660|gb|EFB92860.1| riboflavin synthase, alpha subunit [Prevotella bivia JCVIHMP010]
          Length = 201

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 115/205 (56%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  I+A+    + +   +  S+ TS++ +  SI+H G+CLTVVRL       
Sbjct: 1   MFSGIVEEMATIVAIEHEQENIHFTLTCSF-TSELGIDQSISHNGVCLTVVRLD-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET   +N+    +G  IN+ERS+ +  RLDGH+V GH+D T + + +    
Sbjct: 55  DRYTVTAMRETLVRSNLGLLQVGDHINVERSMIMNGRLDGHIVQGHVDETAKCVGIKDAE 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y     P +        F   KGSV +NGVSLTV    +N F V +I +T   T +K
Sbjct: 115 GSTYYTFEYPFSKAMAARGYFTVDKGSVTVNGVSLTVCEPTENTFTVAIIPYTKANTNFK 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
             KVG ++NIE D + +YIARL+A+
Sbjct: 175 YIKVGTVVNIEFDILGKYIARLHAI 199


>gi|15614118|ref|NP_242421.1| riboflavin synthase subunit alpha [Bacillus halodurans C-125]
 gi|10174172|dbj|BAB05274.1| riboflavin synthase alpha subunit [Bacillus halodurans C-125]
          Length = 215

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 113/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G I A+    + + + + +    S ++LG SIA  G+CLTV   +     D
Sbjct: 1   MFTGIIEDVGTIDAIQQTGEAIVMTITSKKIVSDVQLGDSIAVNGVCLTVTSFT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V++  ET R T++     G+ +NLER++    R  GH+VSGH+DG   I   +   
Sbjct: 56  TQFTVDLMPETVRATSLRLLSKGSRVNLERAMVANGRFGGHIVSGHVDGIGTIRKKERKD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L +++  KGSV ++G SLT+  V    F + +I HT+EET   + K G
Sbjct: 116 NAVYYTIEVSSSLRRYMIHKGSVAVDGTSLTIFDVSDKTFTISIIPHTMEETIIGLKKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D++NIE D + +YI + 
Sbjct: 176 DIVNIECDLIGKYIEQF 192


>gi|239917589|ref|YP_002957147.1| riboflavin synthase, alpha subunit [Micrococcus luteus NCTC 2665]
 gi|281413924|ref|ZP_06245666.1| riboflavin synthase, alpha subunit [Micrococcus luteus NCTC 2665]
 gi|239838796|gb|ACS30593.1| riboflavin synthase, alpha subunit [Micrococcus luteus NCTC 2665]
          Length = 218

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 112/211 (53%), Gaps = 9/211 (4%)

Query: 1   MFTGIVTDIGKIIAMT--PIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVT +G ++A+     A    L +        +  G S+A  G+CLT   L E   
Sbjct: 1   MFTGIVTHLGTVVALEHDAAADTALLTLDAGGALDGLPAGGSLAVDGVCLTA--LDEPTE 58

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               +  ++  +T R+T++     G  +NLER ++  D LDGH+V GH+DGT E+L +  
Sbjct: 59  RPGVFRADLMGQTLRMTSLGDRAPGDRVNLERCLRPTDHLDGHVVQGHVDGTGEVLAVTP 118

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETT 173
            G     R+ LP  L +++  +G++ L GVSLTV  V       ++F+V +I  T+E TT
Sbjct: 119 HGAWTTLRIGLPARLARYVPAQGAIALQGVSLTVTAVSDPGAAAHWFEVGIIPATLEATT 178

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
               + GD +N+E D + RY  RL  + ++ 
Sbjct: 179 LGALRPGDRVNLETDVLARYAERLALIPSAP 209


>gi|269959137|ref|YP_003328926.1| riboflavin synthase subunit alpha [Anaplasma centrale str. Israel]
 gi|269848968|gb|ACZ49612.1| riboflavin synthase subunit alpha [Anaplasma centrale str. Israel]
          Length = 203

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 113/200 (56%), Gaps = 9/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MF+GIV  +G +  + P  +    +RLRV      ++M +G S+A AG+CLTVV      
Sbjct: 1   MFSGIVAAVGVVEEVLPSEEDDMAVRLRVEDENLLARMVVGGSVACAGVCLTVV------ 54

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D  + V V  ET  +TN+  WG GT +NLE  +++GD +DGH+V GH+DG  ++  + 
Sbjct: 55  DKDRDFTVNVSKETLGVTNLKHWGAGTKVNLELPLRMGDPIDGHMVQGHVDGVGKVESIV 114

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            I  S    +S    L ++I+ KGS+ L+GVS+TVN  G   F V +I HT   TT +  
Sbjct: 115 QIAGSHTLMVSCNETLTRYISRKGSIALDGVSMTVNSSGSGLFVVNIIPHTWNHTTLQYI 174

Query: 178 KVGDLINIEVDSMMRYIARL 197
           K    INIE D + RY+  L
Sbjct: 175 KADSEINIETDLVARYLESL 194


>gi|325109186|ref|YP_004270254.1| riboflavin synthase, subunit alpha [Planctomyces brasiliensis DSM
           5305]
 gi|324969454|gb|ADY60232.1| riboflavin synthase, alpha subunit [Planctomyces brasiliensis DSM
           5305]
          Length = 210

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 114/204 (55%), Gaps = 12/204 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-----MTSYNTS--KMKLGCSIAHAGICLTVVRL 53
           MFTG+V   G++  +     G+RL++     M S + S   ++LG S+A  G CLTVV  
Sbjct: 1   MFTGLVEGKGQVAELLQEEAGVRLKITPPESMRSADNSHPAVELGDSVAINGCCLTVVEF 60

Query: 54  SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
           +     D+ ++ +  +ET   TN+     G  +NLERS+    RL GH V GH+DG   +
Sbjct: 61  T-----DDRWDFQAGSETLSRTNLGRLQPGDPVNLERSLTAQARLGGHFVQGHVDGLGTV 115

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
             ++  G+ +     +P  L Q +  KGSV ++G+SLT+  VG  FF + LI HT+E+TT
Sbjct: 116 SRIEPEGEWVKMWFDVPAELAQLMVTKGSVTVDGISLTLVDVGDTFFSIALIPHTLEKTT 175

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
             +   GD +NIE D + +Y+ ++
Sbjct: 176 LSVRGPGDPVNIETDILGKYMQKM 199


>gi|330815803|ref|YP_004359508.1| Riboflavin synthase, alpha subunit [Burkholderia gladioli BSR3]
 gi|327368196|gb|AEA59552.1| Riboflavin synthase, alpha subunit [Burkholderia gladioli BSR3]
          Length = 211

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 119/208 (57%), Gaps = 20/208 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     +   + LG SIA  G C+T +  + 
Sbjct: 1   MFTGIVAAVGRIESIAPLGTEADAGVRLVVRAGGLDLGDVALGDSIAIQGACMTAIETTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           E      + V+V  E+ N+   ++  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  E-----TFTVDVSRESLNKTVGLSEPG---EVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF-----FDVLLIRHTI 169
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V K+      F + LI HT+
Sbjct: 113 HFAPVGESHELRVLAPKALGKYLAYKGSITVNGVSLTVNAV-KDLADGCEFSINLIPHTV 171

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARL 197
           + TT +  K G  +N+E+D + RY+ R+
Sbjct: 172 QVTTLRHLKAGSKVNLEIDMIARYVERM 199


>gi|325918409|ref|ZP_08180537.1| riboflavin synthase, alpha subunit [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535371|gb|EGD07239.1| riboflavin synthase, alpha subunit [Xanthomonas vesicatoria ATCC
           35937]
          Length = 200

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 114/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLR-VMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    + +     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLAARQPQGGDVRFTFAVGNLPFEAVQLGESIAVNGVCLTVIAFDT---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++ +   ET  +T + +   G  INLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 57  -SSFQADASTETLSLTTLGALPEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V +  F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNDVDEAGFEVALIPHTVANTAFAATAV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+E+D + RY+ RL
Sbjct: 176 GAAVNLEIDLVARYVERL 193


>gi|332703474|ref|ZP_08423562.1| riboflavin synthase, alpha subunit [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553623|gb|EGJ50667.1| riboflavin synthase, alpha subunit [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 220

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 107/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+I A+       RLRV   +  + +++G SIA  G CLTV     E    
Sbjct: 1   MFTGLIQGLGRIEAVENRGAESRLRVAPRFALTDVRIGESIAVNGACLTV-----ETWNG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +     AET R TN+     G+ +NLER++  GDRL GHLVSGH+D   E+  +   G
Sbjct: 56  SAFTAYASAETMRRTNLGKLRPGSNVNLERALAFGDRLGGHLVSGHVDCLAEVESVSPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S    L  P      +  KGSV L+G+SLT+N  G +F  V +I  T  +TT      G
Sbjct: 116 ESKKYVLRFPAEYGPTVIEKGSVALDGISLTINECGPDFLSVNIIPETQGQTTILDWAPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R+ A
Sbjct: 176 RAVNMETDLIGKYVQRMIA 194


>gi|116748818|ref|YP_845505.1| riboflavin synthase subunit alpha [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697882|gb|ABK17070.1| riboflavin synthase, alpha subunit [Syntrophobacter fumaroxidans
           MPOB]
          Length = 220

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 110/199 (55%), Gaps = 9/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G ++ +        + +   Y+   + LG SIA  G CLTVV    E    
Sbjct: 1   MFTGLIEGTGILLRLDRHGVDAGMVIKPRYSMGGLSLGESIAVDGACLTVVAFQGE---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T + S   G  +NLER++++GDRL GH+VSGH+DG    +  D + 
Sbjct: 57  -TFTADVSAETLSRTTLGSKQPGRRLNLERALRMGDRLGGHIVSGHVDGIG--ILRDRVR 113

Query: 121 DSMYCRL--SLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +    RL   LP  L +++  KGS+ +NG+SLTVN   +  FDV ++ HT  ETT    +
Sbjct: 114 EGRSWRLFFELPEALSRYVIAKGSIAVNGISLTVNGCSRGRFDVNIVPHTAAETTIDDMQ 173

Query: 179 VGDLINIEVDSMMRYIARL 197
            GD +NIE D + +Y+ R+
Sbjct: 174 KGDEVNIETDLIGKYVERM 192


>gi|307730709|ref|YP_003907933.1| riboflavin synthase subunit alpha [Burkholderia sp. CCGE1003]
 gi|307585244|gb|ADN58642.1| riboflavin synthase, alpha subunit [Burkholderia sp. CCGE1003]
          Length = 204

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 117/206 (56%), Gaps = 16/206 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + ++LG SI   G C+TVV    
Sbjct: 1   MFTGIVAAVGRIESVKPLGTNGDAGVRLNVQAGGLDLADVQLGDSITIQGACMTVVA--- 57

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D+ +EV+V  E+   T  A  G    +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 58  --KTDHSFEVDVSRESLNCT--AGLGEVGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S   R+  P  + +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRVLAPREIGRYLAYKGSITVNGVSLTVNSVKDRDDGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           T  K  + G  +N+E+D + RY+ R+
Sbjct: 174 TALKHLREGTPVNLEIDLIARYVERM 199


>gi|21673586|ref|NP_661651.1| riboflavin synthase subunit alpha [Chlorobium tepidum TLS]
 gi|21646699|gb|AAM71993.1| riboflavin synthase, alpha subunit [Chlorobium tepidum TLS]
          Length = 219

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 109/203 (53%), Gaps = 13/203 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGC-----SIAHAGICLTVVRLSE 55
           MFTGIV D+G I A      GMRL+V     TS+ + G      S++  G C T V +  
Sbjct: 1   MFTGIVKDVGAIAASARQGSGMRLKVR---YTSEAEFGDLAIDESVSINGACQTAVAVGP 57

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                 W+EV+  AET + T + S+  GT +NLER+V+  DRL GH V GH+DG   +L 
Sbjct: 58  -----GWFEVDTVAETLKKTTLGSFRPGTKVNLERAVRPMDRLGGHFVLGHVDGVGRVLR 112

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
           ++ +G S    ++     + +I   GS+ ++GVSLTV  V    F V +I +T   TT  
Sbjct: 113 IEEVGGSRMISVAFDSRFDAWIVSAGSIAIDGVSLTVASVEPGQFTVAIIPYTFGHTTIT 172

Query: 176 MHKVGDLINIEVDSMMRYIARLY 198
               G  +N+E D + +Y+AR +
Sbjct: 173 GLAAGSEVNLEFDILGKYVARQH 195


>gi|76801329|ref|YP_326337.1| riboflavin synthase subunit alpha [Natronomonas pharaonis DSM 2160]
 gi|76557194|emb|CAI48769.1| riboflavin synthase, alpha subunit [Natronomonas pharaonis DSM
           2160]
          Length = 197

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 109/198 (55%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G + A+    +G R+RV   +   +++ G S+A +G CLTV     E   D
Sbjct: 1   MFTGIVEATGDVAAVEDTDEGRRIRVTAPF-CDELEHGQSVAISGACLTV-----EAWDD 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             +E+ +  ET   T +    +G  +NLER++    R DGH V GH+DG  E+  ++   
Sbjct: 55  ESFELFLSEETLEKTYLDEVAVGDPVNLERALPADGRFDGHFVQGHVDGVAEVTAIEGTD 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD      SLP +L  ++  KGS+ ++G+SLTV  +  + F V +I  T E TT     V
Sbjct: 115 GDDWTFGFSLPSSLAPYVVDKGSIAVDGISLTVAELRADDFSVAVIPATYELTTLSSKSV 174

Query: 180 GDLINIEVDSMMRYIARL 197
           GD ++IEVD + +Y+ RL
Sbjct: 175 GDPVHIEVDVVAKYVERL 192


>gi|289577286|ref|YP_003475913.1| riboflavin synthase, subunit alpha [Thermoanaerobacter italicus
           Ab9]
 gi|289526999|gb|ADD01351.1| riboflavin synthase, alpha subunit [Thermoanaerobacter italicus
           Ab9]
          Length = 207

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +T      ++ +  S    + K+G SIA  G+CLTV  +S+E    
Sbjct: 1   MFTGIIEETGTVKNITH-GTFTKIVIKCSKVLEETKIGDSIAVNGVCLTVTNISDES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +N+    IG+ +NLER++++G R+ GH+V+GHID   +I+      
Sbjct: 57  --FAADVMPETMRASNLKDLKIGSIVNLERALQVGRRMGGHIVTGHIDCVGKIIEKRQEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++   ++++     ++IA KGS+ ++G+SLTV   G ++F V +I HT+ +TT     VG
Sbjct: 115 NAFIFKIAINEKFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTMLKTTLGYKGVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD + +Y+ +L
Sbjct: 175 DSVNIEVDILSKYVEKL 191


>gi|15893880|ref|NP_347229.1| riboflavin synthase subunit alpha [Clostridium acetobutylicum ATCC
           824]
 gi|15023460|gb|AAK78569.1|AE007574_7 Riboflavin synthase alpha chain [Clostridium acetobutylicum ATCC
           824]
 gi|325508007|gb|ADZ19643.1| Riboflavin synthase alpha chain [Clostridium acetobutylicum EA
           2018]
          Length = 213

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 115/205 (56%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+I  +      +R+ +  S     +KLG SIA  G+CLT+V      S +
Sbjct: 1   MFTGIIEEIGEIKTIKKYDNSIRIAIKASKVMENIKLGDSIAVNGVCLTIV------SCE 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID--GTVEILFLDF 118
           N  E +V  ET R+TN+     G+ +NLER++ LGDR  GH+V+GHID  GT+E +  D 
Sbjct: 55  NG-EFDVMPETYRVTNLKKLISGSKVNLERALALGDRFGGHIVTGHIDGLGTIESIKKDA 113

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           I  ++  ++     +   +  KGSV ++GVSLT+  V +++F   LI HT E+TT     
Sbjct: 114 I--AIEYKIKTNREITSNLVYKGSVAIDGVSLTLGEVQEDYFKFYLIPHTQEKTTLTQRS 171

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
            G  +NIE D + + I     +  S
Sbjct: 172 KGYSVNIECDVLSKNIRNFVNIQNS 196


>gi|289548410|ref|YP_003473398.1| riboflavin synthase subunit alpha [Thermocrinis albus DSM 14484]
 gi|289182027|gb|ADC89271.1| riboflavin synthase, alpha subunit [Thermocrinis albus DSM 14484]
          Length = 211

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 114/194 (58%), Gaps = 7/194 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV  +G +  ++   +G R+ V   +    +K+G S+A  G+CLTVV + E     
Sbjct: 1   MFTGIVEQVGYVEFISFKPEGRRIGVSCHF--QDVKVGDSVAVNGVCLTVVSVKE----- 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  E +V  ET R +N+ S   G  +NLER++++G RL GH++ GH+D   ++  L  +G
Sbjct: 54  NLLEFDVSYETLRRSNLGSLTRGMSVNLERALQVGGRLGGHILYGHVDFCGKLRHLRKVG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D  +  + +P     +   KGSV ++G+SLTVN V ++   + ++ HT   T  K  KVG
Sbjct: 114 DFWHMEVEIPTEWSLYFVEKGSVGIDGISLTVNEVREDTITITVVPHTYNNTNLKSKKVG 173

Query: 181 DLINIEVDSMMRYI 194
           DL+N+EVD + +YI
Sbjct: 174 DLLNVEVDVIGKYI 187


>gi|77165490|ref|YP_344015.1| riboflavin synthase subunit alpha [Nitrosococcus oceani ATCC 19707]
 gi|254433434|ref|ZP_05046942.1| riboflavin synthase, alpha subunit [Nitrosococcus oceani AFC27]
 gi|76883804|gb|ABA58485.1| Lumazine-binding protein [Nitrosococcus oceani ATCC 19707]
 gi|207089767|gb|EDZ67038.1| riboflavin synthase, alpha subunit [Nitrosococcus oceani AFC27]
          Length = 218

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 110/198 (55%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK++A+  +     LR+       ++  +G SIA  G+CLTV R       
Sbjct: 1   MFTGIIRAVGKVVALQFMGSAAVLRIDGGKLGFAQASIGDSIAVNGVCLTVTRQE----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +N ++ +V  ET   T +     G  +NLE ++ L D L GHL SGH DG   ++    +
Sbjct: 56  NNIFDADVSQETLSRTVLGRLQPGDRVNLEPALTLKDGLGGHLTSGHCDGVGTVVERKPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P NL ++IA KGS+C++GVSLTVN V  + F V +I HT+E TT   +  
Sbjct: 116 AGSIGFSIHAPANLAKYIAEKGSICVDGVSLTVNEVKGSLFMVNIIPHTLEATTLNEYHS 175

Query: 180 GDLINIEVDSMMRYIARL 197
              +N+EVD + RY+  L
Sbjct: 176 EREVNLEVDLLARYLESL 193


>gi|258515513|ref|YP_003191735.1| riboflavin synthase subunit alpha [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779218|gb|ACV63112.1| riboflavin synthase, alpha subunit [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 221

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 113/198 (57%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + ++   A   +L +     T  +K+G SIA  G+CLT ++   +    
Sbjct: 1   MFTGLVEELGVLQSVRHGAASAQLNIAAGKITRGIKIGDSIAVNGVCLTAIKFGGQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   TN+ +   G  +NLER++ LGDRL GHLVSGHIDG V I+    I 
Sbjct: 57  -GFTADVMAETLSKTNLGNLKPGDRVNLERALSLGDRLGGHLVSGHIDG-VGIIANKEIQ 114

Query: 121 D-SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           D ++   +  P  + ++I  KGSV ++G SLT+     + F V LI HT +ETT      
Sbjct: 115 DIAILITIKAPPEVMRYIIKKGSVAIDGTSLTIVDFTDDSFLVSLIPHTAKETTLGFKTP 174

Query: 180 GDLINIEVDSMMRYIARL 197
           GD +N+E D + +YI RL
Sbjct: 175 GDTVNLEGDIIGKYIERL 192


>gi|170756551|ref|YP_001782502.1| riboflavin synthase subunit alpha [Clostridium botulinum B1 str.
           Okra]
 gi|169121763|gb|ACA45599.1| riboflavin synthase, alpha subunit [Clostridium botulinum B1 str.
           Okra]
          Length = 228

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 13  LFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFN-----S 67

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++     G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 68  NSFTADVMTETLNKSSLGILSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 127

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 128 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 187

Query: 181 DLINIEVDSMMRYIARL 197
           D+INIE D + +YI + 
Sbjct: 188 DIINIECDVLGKYIYKF 204


>gi|253681161|ref|ZP_04861964.1| riboflavin synthase, alpha subunit [Clostridium botulinum D str.
           1873]
 gi|253563010|gb|EES92456.1| riboflavin synthase, alpha subunit [Clostridium botulinum D str.
           1873]
          Length = 216

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  ++      ++ +        + LG SI+  G+CLTV   +      
Sbjct: 1   MFTGIVEEIGTINIISMTKDFAKITIDAKEILKDVSLGDSISTNGVCLTVTEYNR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +N++S   G  +NLER++ LG R  GH+VSGHIDG   I       
Sbjct: 56  NNFTVDVMGETIRRSNLSSLKRGDKVNLERALALGGRFGGHIVSGHIDGVGTIKNFKHEA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + + I  KGS+ ++GVSLTV  V +  F V +I HT  ETT    K G
Sbjct: 116 NAIWITIEASEEILKNIVFKGSIAIDGVSLTVAYVDREVFKVCIIPHTQSETTLTSKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L  +  ++
Sbjct: 176 DKVNLECDVIAKYVEKLLQVKNNE 199


>gi|149275950|ref|ZP_01882095.1| riboflavin synthase subunit alpha [Pedobacter sp. BAL39]
 gi|149233378|gb|EDM38752.1| riboflavin synthase subunit alpha [Pedobacter sp. BAL39]
          Length = 194

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 108/197 (54%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G + A+      +   + TS  ++++K+  S+AH G+CLTVV L+     D
Sbjct: 1   MFTGIIEKFGVVSAIAEEGTNLHFTI-TSELSNELKIDQSVAHNGVCLTVVGLT-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V    ET   TN++   +G+ +NLER +++  RLDGH+V GH+D T   +  + + 
Sbjct: 55  NTHTVTAIQETLEKTNLSQLKVGSKVNLERCMQMNGRLDGHIVQGHVDQTAICIKQEALD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R      +      KGSVC+NG+SLTV     + F V +I +T E T       G
Sbjct: 115 GSWEYRFKYDVGMGNITVEKGSVCVNGISLTVVNSADDEFSVFIIPYTFEHTNLSEVSAG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIE D + +Y+ARL
Sbjct: 175 DQVNIEFDIIGKYVARL 191


>gi|167580932|ref|ZP_02373806.1| riboflavin synthase subunit alpha [Burkholderia thailandensis
           TXDOH]
          Length = 204

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 119/207 (57%), Gaps = 18/207 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + PIA     G+RL +     + + + +G SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIETIEPIASSPEAGVRLTLRAGGLDLADVAIGDSIAIQGACMTVVAKTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                + ++VEV  E+ N+   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----DTFDVEVSRESLNKTVGLAEAG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRVLAPRELGRYLAYKGSITVNGVSLTVNSVEDCDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARL 197
            TT +    G  +N+E+D + RY+ R+
Sbjct: 173 VTTLRHLTAGAKVNLEIDMIARYVERM 199


>gi|167837548|ref|ZP_02464431.1| riboflavin synthase subunit alpha [Burkholderia thailandensis
           MSMB43]
          Length = 204

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 118/207 (57%), Gaps = 18/207 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + PIA     G+RL +     + + + +G SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIETIEPIASAPDAGVRLTLRAGGLDLADVAIGDSIAIQGACMTVVAKTA 60

Query: 56  EHSVDNWYEVEVWAET-NRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
                  ++VEV  E+ N+   +A  G    +NLE++++  DRL GH+VSGH+DG   + 
Sbjct: 61  -----GTFDVEVSRESLNKTVGLAEPG---DVNLEKALRAHDRLGGHIVSGHVDGLGTVT 112

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIE 170
               +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E
Sbjct: 113 RFAPVGESHELRVLAPRALGRYLAYKGSITVNGVSLTVNSVEDRDDGCEFSINLIPHTVE 172

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARL 197
            TT +    G  +N+E+D + RY+ R+
Sbjct: 173 VTTLRHLTTGAKVNLEIDMIARYVERM 199


>gi|86134879|ref|ZP_01053461.1| Riboflavin synthase alpha chain [Polaribacter sp. MED152]
 gi|85821742|gb|EAQ42889.1| Riboflavin synthase alpha chain [Polaribacter sp. MED152]
          Length = 195

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 115/201 (57%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G +  +    + + L + +S  T+++K+  S+AH G+CLTVV ++ +    
Sbjct: 1   MFTGIIETLGTVKNVVKEQENVHLTIESSI-TNELKIDQSVAHNGVCLTVVGINNDE--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGT-VEILFLDFI 119
             Y V    ET   TNI +      +NLER++KLGDRLDGH+V GH+D T +     D  
Sbjct: 57  --YTVTAIKETLDKTNIGNLKPTDIVNLERAMKLGDRLDGHIVQGHVDETGICKNIKDEN 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++Y       N       KGS+ +NGVSLTV     + F V +I +T E TT+K  ++
Sbjct: 115 GSTVYT-FEYNSNKNNVTIEKGSITINGVSLTVVNSTNSGFSVAIIPYTWENTTFKTLQI 173

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           GD +N+E D + +Y+ARL  L
Sbjct: 174 GDTVNLEFDVIGKYVARLTNL 194


>gi|311030746|ref|ZP_07708836.1| riboflavin synthase subunit alpha [Bacillus sp. m3-13]
          Length = 217

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  +    + + L +        +KLG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEIGTIKQIIRGDQAIILEIEAEKVLEDVKLGDSIAVNGVCLTVTTFT-----S 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R T++ +   G+ +NLER++    R  GH VSGH+DG   I     +G
Sbjct: 56  NRFTVDVMPETIRATSLKTLNAGSKVNLERAMIANGRFGGHFVSGHVDGIGTIQDKKRMG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  ++    + ++  +KGSV ++G SLT+  V +N F + LI HT+ ET       G
Sbjct: 116 NAVYYTITAEDTISRYFMLKGSVTVDGTSLTIFGVSENNFTISLIPHTLNETILGGKGKG 175

Query: 181 DLINIEVDSMMRYIARL 197
           DL+NIEVD + +Y+  L
Sbjct: 176 DLVNIEVDMLAKYMEHL 192


>gi|300812785|ref|ZP_07093183.1| riboflavin synthase, alpha subunit [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300496237|gb|EFK31361.1| riboflavin synthase, alpha subunit [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 204

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+G+V+   +I  +    K + L V T   N + +K+G SIA  G CLTV   S++   
Sbjct: 1   MFSGLVSGKARIQRLEQEGKTIVLTVKTFPENLAGVKIGDSIAVNGCCLTVEAFSKDS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V +  +T   T   +   G  +N+ERSV +G R +GH+VSGH+D TVE++ L   
Sbjct: 59  ---FTVTMMPQTFAKTTFKNLQAGDQVNMERSVPVGGRFEGHIVSGHVDETVEVVDLKQN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +++  R  LP  L++ +  +GSV +NG SLTV   G ++F V LI HT +ET     +V
Sbjct: 116 ENALELRFFLPDRLKKQVVPQGSVAINGTSLTVMNTGDDWFSVGLIPHTQDETNLSGLQV 175

Query: 180 GDLINIEVDSMMRYI-ARLYAL 200
           GD +N+E D + +Y+ A L A 
Sbjct: 176 GDQVNLETDVLGKYVEANLAAF 197


>gi|325068551|ref|ZP_08127224.1| riboflavin synthase subunit alpha [Actinomyces oris K20]
          Length = 219

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 112/218 (51%), Gaps = 19/218 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++ +  +    RL V     T  + LG S++  G CLTV  +       
Sbjct: 1   MFTGIVEELGRVVRLETVEDSARLTVEAPTVTQDVNLGDSVSVNGCCLTVTAVH-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++ AET   T + S   G  +NLER+++  DRL GH+V GH+D T E+L      
Sbjct: 56  STFTADLMAETLTRTTLGSQAPGDPVNLERALRASDRLGGHIVQGHVDATAEVLDHHHGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV--GKNFFDVL------------LIR 166
                R+ LP  + +++AVKGSV L+GVSLTV  V    +  DV             LI 
Sbjct: 116 HWDLLRIGLPQEIARYVAVKGSVALDGVSLTVVDVVDASSTLDVAPVPGAGASLSVGLIP 175

Query: 167 HTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            T+  TT    + G+ +N+EVD + +Y  RL     SQ
Sbjct: 176 ETLRRTTLGSRRPGERVNLEVDVLAKYAERLLGARPSQ 213


>gi|242278130|ref|YP_002990259.1| riboflavin synthase subunit alpha [Desulfovibrio salexigens DSM
           2638]
 gi|242121024|gb|ACS78720.1| riboflavin synthase, alpha subunit [Desulfovibrio salexigens DSM
           2638]
          Length = 218

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 113/201 (56%), Gaps = 10/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G+I          R +V ++      + G SIA  G+CLTV   S     D
Sbjct: 1   MFTGLIQGKGRIENAENRGNETRFKV-SAPKIKDYEKGESIAINGVCLTVETYS-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID--GTVEILFLDF 118
           +W+      E+  +TN+ +   G+ +N ER++ +GDRL GH+VSGH+D  G+VE +  + 
Sbjct: 55  SWFTCYASKESMSVTNLGNLKRGSMVNYERALAMGDRLGGHIVSGHVDCLGSVESVRPE- 113

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            G+S   R+  P    +++  KGSV L+G+SLTVN  G ++ +V +I  T EETT  +  
Sbjct: 114 -GESKIYRIKFPIEHGKYVVPKGSVALDGISLTVNDCGPDYLEVNIIPETQEETTISLWT 172

Query: 179 VGDLINIEVDSMMRYIARLYA 199
            G  +NIE D + +Y+ R+ A
Sbjct: 173 PGYAVNIETDVIGKYVERMVA 193


>gi|28199618|ref|NP_779932.1| riboflavin synthase subunit alpha [Xylella fastidiosa Temecula1]
 gi|71898909|ref|ZP_00681076.1| Lumazine-binding protein [Xylella fastidiosa Ann-1]
 gi|182682362|ref|YP_001830522.1| riboflavin synthase subunit alpha [Xylella fastidiosa M23]
 gi|28057733|gb|AAO29581.1| riboflavin synthase alpha chain [Xylella fastidiosa Temecula1]
 gi|71731321|gb|EAO33385.1| Lumazine-binding protein [Xylella fastidiosa Ann-1]
 gi|182632472|gb|ACB93248.1| riboflavin synthase, alpha subunit [Xylella fastidiosa M23]
 gi|307578644|gb|ADN62613.1| riboflavin synthase subunit alpha [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 200

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G++ A   + +G  +R      T   S++  G SIA  G+CLTV       
Sbjct: 1   MFTGIIGGVGRLAAR--VRQGGDVRFTFEVGTLPFSEVSYGESIAVNGVCLTVTAFDAL- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                ++ +   ET  +T +     G  +NLER++   DRL GHLVSGH+DG   +L + 
Sbjct: 58  ----CFQADASTETLALTTLGQLPEGATLNLERAMCPTDRLGGHLVSGHVDGIGRVLSVH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               +     + P  L +++A KGS+C++GVSLTVN V    F+V LI HT+  T +   
Sbjct: 114 EDARAQRWSFAAPVPLLKYVAKKGSICVDGVSLTVNAVNAKGFEVALIPHTVAHTRFSRT 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
            +G+ +N+E+D + RY+ RL      Q
Sbjct: 174 VIGEAVNLEIDLIARYVERLLVTGNKQ 200


>gi|257386621|ref|YP_003176394.1| riboflavin synthase subunit alpha [Halomicrobium mukohataei DSM
           12286]
 gi|257168928|gb|ACV46687.1| riboflavin synthase, alpha subunit [Halomicrobium mukohataei DSM
           12286]
          Length = 192

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 109/197 (55%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G++ A+   A G RLR+ + +   ++  G SI+ +G CLTV    EE    
Sbjct: 1   MFTGIVEATGEVRAVEDTADGRRLRIGSPFE--ELSHGQSISVSGACLTV----EEFEPG 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V +  ET   T       G  +NLER++    R DGH+V GH+D T  +  ++ +G
Sbjct: 55  EWFSVFLAEETIDRTFFDEIAEGDELNLERAMPADGRFDGHIVQGHVDATATVEEIERVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SLP ++E+++  KGS+ ++G+SLTV    ++ F V +I  T + TT      G
Sbjct: 115 EDWRFTFSLPADIERYVVEKGSITVDGISLTVADRREDSFSVAIIPTTYDVTTLSEKSPG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D  ++EVD + +Y+ R+
Sbjct: 175 DAAHLEVDVVAKYVERM 191


>gi|78222834|ref|YP_384581.1| riboflavin synthase subunit alpha [Geobacter metallireducens GS-15]
 gi|78194089|gb|ABB31856.1| Lumazine-binding protein [Geobacter metallireducens GS-15]
          Length = 216

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 108/204 (52%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVV-RLSEEHSV 59
           MFTG++ D+G +  +       RL   T      + LG S+A  G CLTVV +   E + 
Sbjct: 1   MFTGLIEDVGSVRRLERAGGAARLTTATKIPLDSIALGDSVAVNGACLTVVAKGGGELTF 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D         ET   T + + G G  +NLER+++LGDRL GH+V+GH+D   ++     +
Sbjct: 61  D------ASPETLERTTLGTLGTGAPVNLERALRLGDRLGGHIVTGHVDFIADVSERREV 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++     +P    +++  KGSV ++G+SLTVN V  + F V +I HT   TT    K 
Sbjct: 115 AGNIVFGFRIPGQFARYLVAKGSVTIDGISLTVNTVTDSGFSVNIIPHTAAMTTLNGMKP 174

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +NIE D + +Y+ RL A  ++
Sbjct: 175 GGRVNIETDILGKYVERLLAFGST 198


>gi|296117960|ref|ZP_06836543.1| riboflavin synthase, alpha subunit [Corynebacterium ammoniagenes
           DSM 20306]
 gi|295969191|gb|EFG82433.1| riboflavin synthase, alpha subunit [Corynebacterium ammoniagenes
           DSM 20306]
          Length = 204

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 115/197 (58%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + GKI+ +  +   +R+ +     TS   LG SI+  G+CLTV  L  E SV 
Sbjct: 1   MFTGLVEEKGKIVRLEELGDSIRMSIEAPVVTSDATLGDSISVNGVCLTVAEL--EGSV- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  E+   + +      + +NLER++    RL GH+V GH+DGT +++      
Sbjct: 58  --FVADIMQESLNRSALGQLDQDSAVNLERALLPTTRLGGHIVQGHVDGTSKLISRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R  LP +L++++  KGS+ ++G SLT++ +G ++F+V LI  T++ET      VG
Sbjct: 116 HWEVLRFELPQDLDRYVVGKGSIAISGTSLTISALGSDWFEVSLIPVTLQETILGDLSVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+EVD + +Y+ ++
Sbjct: 176 DLVNLEVDVLAKYVEKM 192


>gi|284045159|ref|YP_003395499.1| riboflavin synthase, subunit alpha [Conexibacter woesei DSM 14684]
 gi|283949380|gb|ADB52124.1| riboflavin synthase, alpha subunit [Conexibacter woesei DSM 14684]
          Length = 196

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 108/197 (54%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G + A+ P A G+RL V T     ++  G S+A  G+CLT V  S     +
Sbjct: 1   MFTGLVQGLGTVAAVQPTADGVRLTVATELG-RELSPGDSVAVNGVCLTAVDPS-----N 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +++A    G  +NLE  ++  DRL GH+V GH+DG   I  L   G
Sbjct: 55  GTFAADVMNETLRRSSLAEIAPGAEVNLELPLRAHDRLGGHIVQGHVDGLGTIAELTDDG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   R++    L +++  KGS+ ++GVSLTV+ V      V LI  T+E T      VG
Sbjct: 115 FARIVRIAADPELLRYVVEKGSIAIDGVSLTVSAVDDESLSVSLIPETLERTILGSAAVG 174

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + +Y+ +L
Sbjct: 175 RPVNLEVDVLAKYVEKL 191


>gi|332974206|gb|EGK11139.1| riboflavin synthase subunit alpha [Kingella kingae ATCC 23330]
          Length = 204

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 110/199 (55%), Gaps = 13/199 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLR--VMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIV  +GK++A+   A   R    V+       ++ G S+AH G CLT+      H 
Sbjct: 1   MFTGIVQGMGKLVAIKQPAPDFRTHTVVLPDEMRGALQQGASVAHNGCCLTIT-----HI 55

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
             N  + ++ AET  +TN+    +G ++NLER+ + GD + GH++SGHI    EI  +D 
Sbjct: 56  RGNEVDFDLMAETLSLTNLGDLAVGDWVNLERAARFGDEIGGHVMSGHIITQTEITRID- 114

Query: 119 IGDSMYCR---LSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
             DS + R     LP  ++ +I  KG V L+G SLT+  V    F+V LI  T++ T + 
Sbjct: 115 --DSEHNRTVWFVLPDAIKPYILSKGFVGLDGCSLTIGTVTDTEFNVHLIPETLQRTLFG 172

Query: 176 MHKVGDLINIEVDSMMRYI 194
             KVGD IN+E+D+  + I
Sbjct: 173 SRKVGDKINVEIDAQTQAI 191


>gi|15791355|ref|NP_281179.1| riboflavin synthase subunit alpha [Halobacterium sp. NRC-1]
 gi|10582004|gb|AAG20659.1| riboflavin synthase alpha subunit [Halobacterium sp. NRC-1]
          Length = 218

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           +FTGI+ + G +  +     G RLR+  +        G SI+  G+CLTV    E     
Sbjct: 8   VFTGIIEETGTVERVVDDDDGRRLRIAVT-GFGAFSHGESISVGGVCLTVEDWGE----- 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V   AET   T +++   G  +NLER++    RLDGH+V GH+D T E++ ++ +G
Sbjct: 62  DWFSVFTAAETLSKTTLSAVSSGDRVNLERALPADGRLDGHVVQGHVDTTTEVVDIEQVG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF--FDVLLIRHTIEETTWKMHK 178
           +      +LP    Q++A KGS+ L+G+SLTV  +      F V +I  T E T+     
Sbjct: 122 EDWTFTFALPDGHAQYVAPKGSIALDGISLTVADIDDEAGTFSVAVIPTTYELTSLSERS 181

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
            GD +N+EVD + +Y+ R+ + ++S
Sbjct: 182 PGDRVNVEVDVLAKYVERMASYDSS 206


>gi|329946975|ref|ZP_08294387.1| riboflavin synthase, alpha subunit [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328526786|gb|EGF53799.1| riboflavin synthase, alpha subunit [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 224

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 109/223 (48%), Gaps = 24/223 (10%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +  +    RL V     T  + LG S++  G CLTV  +       
Sbjct: 1   MFTGIVEELGRVAQLETVEDSARLTVEAPTVTQDVSLGDSVSVNGCCLTVAAVHR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  ++ AET   T + S   G  +NLER+++  DRL GH+V GH+D T E+L      
Sbjct: 56  NTFTADLMAETLTRTTLGSQAPGDPVNLERALRATDRLGGHIVQGHVDATAEVLGRHHGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-------------------NLVGKNFFD 161
                R+ LP  + +++AVKGSV L+GVSLTV                    L       
Sbjct: 116 HWDLLRIGLPQEIARYVAVKGSVTLDGVSLTVVDVDDANEARHDAAPDVSPTLGAGASLS 175

Query: 162 VLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           V LI  T+  TT    + G+ +N+EVD M +Y  RL     S+
Sbjct: 176 VGLIPETLRRTTLGTRRPGERVNLEVDVMAKYAERLLGARLSE 218


>gi|288918237|ref|ZP_06412592.1| riboflavin synthase, alpha subunit [Frankia sp. EUN1f]
 gi|288350407|gb|EFC84629.1| riboflavin synthase, alpha subunit [Frankia sp. EUN1f]
          Length = 223

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 116/223 (52%), Gaps = 19/223 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+ P      L +      S +  G S+A  G+CLTV   +     D
Sbjct: 1   MFTGIVEELGVVTAIEPRQDAASLTIECRNVLSDVAHGASVAVNGVCLTVTSYAHPPDAD 60

Query: 61  NW------------YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID 108
                         +  +V  ET R +++ +  +G  +NLER V+L DRL GHLV GH+D
Sbjct: 61  GAGTAEPAADPAGVFTADVMLETLRRSSLGALSVGDRVNLERPVRLSDRLGGHLVQGHVD 120

Query: 109 GTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF------FDV 162
           G   +L           R++LP  L++++  KGSV ++GVSLTV  V          F V
Sbjct: 121 GVGVVLERAPAEHWDVVRIALPPRLDRYLVEKGSVTVDGVSLTVVDVRPAAGDEPASFTV 180

Query: 163 LLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYA-LNTSQ 204
            LI  T+ +TT  +  VG+ +NIEVD + +Y+ +L+A LN S 
Sbjct: 181 SLIPTTLADTTLGVRAVGEKVNIEVDVLAKYVEKLHADLNGSH 223


>gi|238063935|ref|ZP_04608644.1| riboflavin synthase, alpha subunit [Micromonospora sp. ATCC 39149]
 gi|237885746|gb|EEP74574.1| riboflavin synthase, alpha subunit [Micromonospora sp. ATCC 39149]
          Length = 227

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 108/197 (54%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRL-RVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++ M        L  +     TS  + G SIA  G+CLTVV +      
Sbjct: 1   MFTGIVEELGEVVRMAETGGDYALVAIRGPLVTSDARHGDSIAVNGVCLTVVDVD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET R + + +   G  +NLER+  L  RL GHLV GH+DG  E+L  +  
Sbjct: 56  GDVFTADVMGETLRRSALGALRPGAPVNLERAAALNSRLGGHLVQGHVDGVGEVLSREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP  L +++  KGS+ ++GVSLTV  VG ++F V LI  T++ TT      
Sbjct: 116 EQWETVRFRLPAALSRYVVEKGSITVDGVSLTVAGVGPDWFTVGLIPTTLKLTTLGDRVA 175

Query: 180 GDLINIEVDSMMRYIAR 196
           GD +N+EVD + +Y+ R
Sbjct: 176 GDPVNLEVDVLAKYVER 192


>gi|260911550|ref|ZP_05918136.1| riboflavin synthase [Prevotella sp. oral taxon 472 str. F0295]
 gi|260634340|gb|EEX52444.1| riboflavin synthase [Prevotella sp. oral taxon 472 str. F0295]
          Length = 202

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 116/206 (56%), Gaps = 11/206 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  ++AM    + +     +++ T ++K+  S+AH G+CLTV+ L  ++   
Sbjct: 1   MFSGIVEEMATLVAMKRYEENIDFTFKSTF-THELKIDQSVAHNGVCLTVIELDGDN--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y V    ET   +N+    +G  +N+ERS+K+  RLDGH+V GH+D T   + ++   
Sbjct: 57  --YTVTAMKETLIKSNLGLLQVGDKVNIERSMKMNGRLDGHIVQGHVDTTATCIAMEDAE 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y       N EQ     F   KGSV +NGVSLTV    +  F V +I +T E T + 
Sbjct: 115 GSTYFTFEYAFNPEQVGRGYFTVDKGSVTVNGVSLTVVSPTECTFKVAIIPYTRENTNFC 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYALN 201
             KVG ++N+E D + +YIAR+ +L+
Sbjct: 175 DIKVGSVVNLEFDILGKYIARMQSLS 200


>gi|170693629|ref|ZP_02884787.1| riboflavin synthase, alpha subunit [Burkholderia graminis C4D1M]
 gi|170141411|gb|EDT09581.1| riboflavin synthase, alpha subunit [Burkholderia graminis C4D1M]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 117/206 (56%), Gaps = 16/206 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + ++LG SI   G C+TVV    
Sbjct: 1   MFTGIVAAVGRIESVKPLGTNGDAGVRLSVEAGGLDLADVQLGDSITIQGACMTVVA--- 57

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D+ +EV+V  E+   T  A  G    +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 58  --KTDHSFEVDVSRESLNCT--AGLGEVGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S   R+  P  + +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRVLAPREIGRYLAYKGSITVNGVSLTVNSVKDRDDGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARL 197
           T  K  + G  +N+E+D + RY+ R+
Sbjct: 174 TALKHLREGTPVNLEIDLIARYVERM 199


>gi|332637712|ref|ZP_08416575.1| riboflavin synthase subunit alpha [Weissella cibaria KACC 11862]
          Length = 195

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 112/199 (56%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPI-AKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIV+++G+++A+T    K  RL + T S   +  KLG SI   G+CLT+   +    
Sbjct: 1   MFTGIVSEVGQVVALTKRNEKERRLAIKTASAYFADAKLGDSIMVDGVCLTITTYN---- 56

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            D+    +V   T  +T +  + +G  +NLE++++ GDR DGH V GH+DGT  I  +  
Sbjct: 57  -DHEATFDVMVPTMAVTRMQDYQVGEVVNLEQAIRAGDRFDGHFVLGHVDGTGTITTMSQ 115

Query: 119 IGDSMYCRLSLP-HNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             +++Y  ++     L   I  KGS+ +NGVSLTV       F + LI HT+  T  +  
Sbjct: 116 TDETVYLTITPADQGLMHQIVTKGSIAVNGVSLTVVTASATAFVIALIPHTLTHTMLRTV 175

Query: 178 KVGDLINIEVDSMMRYIAR 196
           + GD++N+E D + +Y+ +
Sbjct: 176 QTGDVVNLETDVLAKYLTK 194


>gi|288941491|ref|YP_003443731.1| riboflavin synthase subunit alpha [Allochromatium vinosum DSM 180]
 gi|288896863|gb|ADC62699.1| riboflavin synthase, alpha subunit [Allochromatium vinosum DSM 180]
          Length = 219

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 113/198 (57%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  + P    +RL + T   +   + LG SIA  G+CLT V L+E    
Sbjct: 1   MFTGIIQSVGLIQRLEPRGGDVRLSIDTGKLSLDGVVLGDSIAVNGVCLTAVALTE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET  +T + +   G+ +NLE+++ L   L GHLVSGH+DG   +L     
Sbjct: 57  -CGFAADVSRETLTLTTLGALKPGSRVNLEKALTLSTPLGGHLVSGHVDGVGTLLERHED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   R+  P  L ++IA KGS+C++G SLTVN V    F++ ++ HTI+ET    ++ 
Sbjct: 116 ARSWRLRIQAPDELARYIAHKGSICVDGTSLTVNRVEGAVFELNIVPHTIQETIIGDYRP 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSRVNLEVDLIARYLERL 193


>gi|90415721|ref|ZP_01223655.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2207]
 gi|90333044|gb|EAS48214.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2207]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 115/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI++ +G++  + P     RL +   + + + ++LG SIA  G CLT V L+E    
Sbjct: 1   MFTGIISALGELTNLEPRGGDARLHINAGNLSMADVQLGDSIACNGTCLTAVELTE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET  +T       G+ INLE++++  DR  GH+VSGH+DG  E++ L   
Sbjct: 57  -NGFVADVSVETLTLTTTGDLKSGSRINLEKAMQATDRFGGHIVSGHVDGIGEVVSLHED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   R+  P  L +++A KGS+ ++G SLTVN V    F++ ++ HT+  T    ++V
Sbjct: 116 ARSWRFRIRAPRELAKYVAHKGSITVDGTSLTVNHVEGAEFELNIVPHTMVHTIMGDYQV 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GTKVNLEVDLVARYLERL 193


>gi|220912437|ref|YP_002487746.1| riboflavin synthase subunit alpha [Arthrobacter chlorophenolicus
           A6]
 gi|219859315|gb|ACL39657.1| riboflavin synthase, alpha subunit [Arthrobacter chlorophenolicus
           A6]
          Length = 226

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 112/210 (53%), Gaps = 15/210 (7%)

Query: 1   MFTGIVTDIGKIIAMT---PIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+ + G+++A+      +  +RLR      T  + LG SIA  G+CLT   +  + 
Sbjct: 1   MFTGIIAEQGEVLAVERDGDTSATVRLRA--PGTTEGLALGGSIAVNGVCLTATAIDGKE 58

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                + V+V  ET   + I     G  +NLER V  G RLDGH+V GH+DG   +L  +
Sbjct: 59  -----FSVDVMGETLVRSTIGELAAGDAVNLERCVPAGGRLDGHVVQGHVDGVGVLLERE 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG-----KNFFDVLLIRHTIEET 172
             G+    R  +P NL ++IA KGS+ ++GVSLTV  V      + +F+V LI  T+ ET
Sbjct: 114 PQGNWERLRFGVPANLARYIAEKGSIAIDGVSLTVTAVSAATEEQPWFEVGLIPTTLAET 173

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNT 202
                  G  +N+EVD + +Y  RL +  +
Sbjct: 174 GLGTKTTGSRVNLEVDVLAKYTERLLSFRS 203


>gi|86144159|ref|ZP_01062496.1| riboflavin synthase alpha chain [Leeuwenhoekiella blandensis
           MED217]
 gi|85829421|gb|EAQ47886.1| riboflavin synthase alpha chain [Leeuwenhoekiella blandensis
           MED217]
          Length = 194

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 110/200 (55%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G I  +    + + + V +   +S++K+  S+AH G+CLTVV L      D
Sbjct: 1   MFTGIIEDLGSIEKLEREGQNLHITVKSKL-SSELKIDQSVAHNGVCLTVVELE-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y+V    ET + TN+     G  +NLER++ LG RLDGH+V GH+D T   +  +   
Sbjct: 55  NSYKVTAIDETLKKTNLDQLKKGDLVNLERAMILGTRLDGHIVQGHVDQTATCVNKETQD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S     S   +       KGS+ +NGVSLTV     N F V +I +T E TT+K  +  
Sbjct: 115 GSWIFTFSYDASHNNVTIEKGSITINGVSLTVVNSKVNEFSVAIIPYTYEHTTFKSIEKD 174

Query: 181 DLINIEVDSMMRYIARLYAL 200
            ++N+E D + +Y+ RL  L
Sbjct: 175 SIVNLEFDVIGKYVKRLMNL 194


>gi|303327266|ref|ZP_07357708.1| riboflavin synthase, alpha subunit [Desulfovibrio sp. 3_1_syn3]
 gi|302863254|gb|EFL86186.1| riboflavin synthase, alpha subunit [Desulfovibrio sp. 3_1_syn3]
          Length = 227

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G+I ++       RL +   +  + +  G SIA  G CL+V    E HS +
Sbjct: 1   MFTGIIQGQGEITSLRKNGTECRLAIRPLFTLTDVIDGESIAVNGACLSV----ESHSRE 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +     AET   T + +   G  +NLER++ LGDRL GHLVSGH+D    +  +   G
Sbjct: 57  G-FTAYASAETLARTTLGTLLNGDLVNLERALALGDRLGGHLVSGHVDCLATVREVRPSG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+ CRL  P +L   +  KGSV L+G+SLTVN  G +F +V +I  T + TT ++ + G
Sbjct: 116 QSVCCRLEFPASLGPEVIAKGSVALDGISLTVNDCGPDFLEVNIIPDTQKRTTMRLWRPG 175

Query: 181 DLINIEVDSMMRYIARL 197
             +N+E D + +Y+  L
Sbjct: 176 TRVNMETDLIGKYVRSL 192


>gi|299140942|ref|ZP_07034080.1| riboflavin synthase, alpha subunit [Prevotella oris C735]
 gi|298577908|gb|EFI49776.1| riboflavin synthase, alpha subunit [Prevotella oris C735]
          Length = 199

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 113/205 (55%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  ++AMT   + +   +  S+ T ++K+  SIAH G+CLTVV +      +
Sbjct: 1   MFSGIVEEMATLVAMTKDKENIDFTLKCSF-TDELKIDQSIAHNGVCLTVVSME-----N 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   +N+    IG  +N+ERS+ +  RLDGH++ GH+D T + + +    
Sbjct: 55  NTYTVTAMKETLDRSNLGLLQIGDKVNIERSMLMNGRLDGHIMQGHVDRTAKCIGMRDAD 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y     P +        F   KGSV +NGVSLTV    +N F V +I +T   T + 
Sbjct: 115 GSTYFTFEYPFDKAMAKKGYFTVDKGSVTVNGVSLTVCEPTENTFTVAIIPYTRANTNFH 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
             +VG ++NIE D + +YIARL  L
Sbjct: 175 DIQVGSVVNIEFDILGKYIARLQTL 199


>gi|312898693|ref|ZP_07758083.1| riboflavin synthase, alpha subunit [Megasphaera micronuciformis
           F0359]
 gi|310620612|gb|EFQ04182.1| riboflavin synthase, alpha subunit [Megasphaera micronuciformis
           F0359]
          Length = 213

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 109/199 (54%), Gaps = 9/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I  M   A  +RL V          +G SIA  G+CLTV  ++      
Sbjct: 1   MFTGIIEETGTIAGMERQADSIRLTVRADKVLENTIIGDSIAVNGVCLTVTSMTS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGT--VEILFLDF 118
           + +  +V  ET R ++      G+ +NLER+V +G RL GH+VSGHIDGT  V  +  D 
Sbjct: 56  SSFCADVMHETMRRSSFKDIRNGSTVNLERAVAVGGRLGGHIVSGHIDGTGTVSRIVRDG 115

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           I    Y  ++   +L +FI  KGSVC++GVSLTV  V    F V LI HT   TT    K
Sbjct: 116 IAHVYY--ITASDDLLRFIVEKGSVCIDGVSLTVVSVTDTEFSVSLIPHTSGHTTLSEKK 173

Query: 179 VGDLINIEVDSMMRYIARL 197
            G ++N+E D + +YI +L
Sbjct: 174 AGSVVNLETDVIAKYIMKL 192


>gi|71276433|ref|ZP_00652709.1| Lumazine-binding protein [Xylella fastidiosa Dixon]
 gi|71900512|ref|ZP_00682642.1| Lumazine-binding protein [Xylella fastidiosa Ann-1]
 gi|170730981|ref|YP_001776414.1| riboflavin synthase subunit alpha [Xylella fastidiosa M12]
 gi|71162749|gb|EAO12475.1| Lumazine-binding protein [Xylella fastidiosa Dixon]
 gi|71729752|gb|EAO31853.1| Lumazine-binding protein [Xylella fastidiosa Ann-1]
 gi|167965774|gb|ACA12784.1| riboflavin synthase alpha chain [Xylella fastidiosa M12]
          Length = 200

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+  +G++ A   + +G  +R      T   S++  G SIA  G+CLTV       
Sbjct: 1   MFTGIIGGVGRLAAR--VLQGGDVRFTFEVGTLPFSEVSYGESIAVNGVCLTVTAFDAL- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                ++ +   ET  +T +     G  +NLER++   DRL GHLVSGH+DG   +L + 
Sbjct: 58  ----CFQADASTETLALTTLGQLPEGATLNLERAMCPTDRLGGHLVSGHVDGIGRVLSVH 113

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               +     + P  L +++A KGS+C++GVSLTVN V    F+V LI HT+  T +   
Sbjct: 114 EDARAQRWSFAAPVPLLKYVAKKGSICVDGVSLTVNAVNAKGFEVALIPHTVAHTRFSRT 173

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
            +G+ +N+E+D + RY+ RL      Q
Sbjct: 174 VIGEAVNLEIDLIARYVERLLVTGNKQ 200


>gi|282880697|ref|ZP_06289399.1| riboflavin synthase, alpha subunit [Prevotella timonensis CRIS
           5C-B1]
 gi|281305423|gb|EFA97481.1| riboflavin synthase, alpha subunit [Prevotella timonensis CRIS
           5C-B1]
          Length = 199

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 115/202 (56%), Gaps = 11/202 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++  ++A++   + +   +  S+   ++K+  SI+H G+CLTVVRL      D
Sbjct: 1   MFSGIVEEMATVVAISHDQENIDFTLKCSF-VDELKIDQSISHNGVCLTVVRLH-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V    ET   +N+    IG  +N+ERS+ +  RLDGH+V GH+D T   + +    
Sbjct: 55  DTYTVTAMKETLERSNLRLITIGDKVNVERSMLMNGRLDGHIVQGHVDQTATCVKMQDAD 114

Query: 121 DSMYCRLSLPHNLEQ----FIAV-KGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y     P++ E     +I V KGSV +NGVSLTV     N F V +I +T E T + 
Sbjct: 115 GSTYFTFEYPYSREMAKRGYITVDKGSVTVNGVSLTVCEPTDNRFTVAIIPYTKEHTNFC 174

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
             KVG ++N+E D + +YIARL
Sbjct: 175 DIKVGSIVNLEFDILGKYIARL 196


>gi|254448034|ref|ZP_05061498.1| riboflavin synthase, alpha subunit [gamma proteobacterium HTCC5015]
 gi|198262460|gb|EDY86741.1| riboflavin synthase, alpha subunit [gamma proteobacterium HTCC5015]
          Length = 219

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A       +RL + T+      ++LG SIA  G+CLT V L     +
Sbjct: 1   MFTGIIQAVGRVAAAENKGGDLRLHIDTADLPMEGVELGDSIAVNGVCLTAVDL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  +V  ET  +T++A  G G  +NLE+++       GH+VSGH+DG  E++     
Sbjct: 56  DRGFWADVSRETLNLTSLAGIGAGRRVNLEKAMTPTTHFGGHIVSGHVDGLGEVVSRHSD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    L  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+E T    ++ 
Sbjct: 116 GRSERFVLRAPDELARYIAKKGSITVDGTSLTVNEVKGADFELNIVPHTLEHTIMGDYQA 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GSKVNLEVDVVARYLERL 193


>gi|288799651|ref|ZP_06405110.1| riboflavin synthase, alpha subunit [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288332899|gb|EFC71378.1| riboflavin synthase, alpha subunit [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 200

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 116/205 (56%), Gaps = 11/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GI+ ++  ++A+    + +   +  S+ T+++K+  S+AH G+CLTVV L       
Sbjct: 1   MFSGIIEEMATVVAIVHDKENIHFTLECSF-TNELKIDQSVAHNGVCLTVVELD-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   +N+  W +G  +N+ERS+++  RLDGH+V GH+D T     ++   
Sbjct: 55  NRYTVTAMKETIIRSNLGLWNVGDKVNVERSMQMNGRLDGHIVQGHVDTTAICSAIEDAN 114

Query: 121 DSMYCRLSLPHNLEQ-----FIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
            S Y   S   + EQ     F   KGSV +NGVSLTV    ++ F V +I +T E T + 
Sbjct: 115 GSTYFTFSYEFDKEQASRGYFTVDKGSVTVNGVSLTVVSPTRDSFKVAIIPYTKEHTNFC 174

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
             ++G ++N+E D + +YIAR+  L
Sbjct: 175 AIELGSVVNLEFDIIGKYIARMNNL 199


>gi|307293538|ref|ZP_07573382.1| riboflavin synthase, alpha subunit [Sphingobium chlorophenolicum
           L-1]
 gi|306879689|gb|EFN10906.1| riboflavin synthase, alpha subunit [Sphingobium chlorophenolicum
           L-1]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 119/209 (56%), Gaps = 13/209 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG-MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+TDIG I   T   +G +RL +  +Y+   + +G SIA +G CLTVV    E   
Sbjct: 1   MFTGIITDIGTI--RTHEQRGDLRLVIGCAYDMETVAIGASIACSGACLTVV----EKGA 54

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D W+ V++ AET   T    W +G  +NLER++K+GD L GH+V+GH+DG   ++     
Sbjct: 55  D-WFAVDLSAETVARTAPGLWELGGRLNLERALKVGDELGGHIVTGHVDGIGTLVSATGE 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTW 174
           GDS    ++ P  L   +A KGS+ ++G+SLTVN V     G   F + +I HT   TT 
Sbjct: 114 GDSTRLLIAAPAALASALAAKGSITVDGISLTVNTVEDQADGSVHFSLNIIPHTAAATTL 173

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNTS 203
                G   N+E+D + RY+ R+ +L  S
Sbjct: 174 DRLAEGRTFNLEIDVLARYLDRMQSLRMS 202


>gi|227833016|ref|YP_002834723.1| Riboflavin synthase alpha chain [Corynebacterium aurimucosum ATCC
           700975]
 gi|262182496|ref|ZP_06041917.1| Riboflavin synthase alpha chain [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454032|gb|ACP32785.1| Riboflavin synthase alpha chain [Corynebacterium aurimucosum ATCC
           700975]
          Length = 212

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 112/209 (53%), Gaps = 13/209 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG++ ++ P    +RL +  S   S  +LG SIA  G+CLTV  L E     
Sbjct: 1   MFTGLVEEIGRVDSVEPQGDAVRLGIAASTVLSDAQLGDSIAVNGVCLTVAELGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   +++    +G  +NLER+V    RL GH+V GH+DGT  +L      
Sbjct: 56  GTFTADVMKESLNRSSLGELEVGAPVNLERAVLPTTRLGGHIVQGHVDGTGTLLSRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV--------GKNFFDVLLIRHTIEET 172
                R SLP  L +++  KGS+ + G SLTV+ +         + FF+V LI  T+ +T
Sbjct: 116 HWEVLRFSLPAELARYVVEKGSIAVQGTSLTVSALADGQGEPDAEAFFEVSLIPTTLRDT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALN 201
            +   K G  +N+EVD + +Y+ ++   N
Sbjct: 176 VFGSMKPGARVNLEVDVVAKYVEKMVHPN 204


>gi|226306508|ref|YP_002766468.1| riboflavin synthase alpha chain [Rhodococcus erythropolis PR4]
 gi|229493556|ref|ZP_04387341.1| riboflavin synthase, alpha subunit [Rhodococcus erythropolis SK121]
 gi|226185625|dbj|BAH33729.1| riboflavin synthase alpha chain [Rhodococcus erythropolis PR4]
 gi|229319517|gb|EEN85353.1| riboflavin synthase, alpha subunit [Rhodococcus erythropolis SK121]
          Length = 202

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 8/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A   +    R  V     TS    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGEIVAKEELVDAARFTVRGPLVTSDAGHGDSIAVNGVCLTVVDVL----AD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++A   +G+ +NLER+  L  RL GHLV GH+DGT  ++      
Sbjct: 57  GSFTADVMQETLNRSSLAKLDVGSRVNLERAAALNSRLGGHLVQGHVDGTGHVISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
           +    R++LP ++ +++  KGS+ ++GVSLTV+ +G +    +F++ LI  T+E TT   
Sbjct: 117 NWEVVRIALPDSISRYVVEKGSITVDGVSLTVSALGGDRGFEYFEISLIPTTLELTTLGT 176

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
             VG  +N+EVD + +Y+ RL++
Sbjct: 177 AVVGTPVNLEVDVIAKYVERLHS 199


>gi|294055300|ref|YP_003548958.1| riboflavin synthase, alpha subunit [Coraliomargarita akajime