PSIBLAST alignment of GI: 254780347 and protein with PDB id: 1hze

>gi|15826467|pdb|1HZE|A Chain A, Solution Structure Of The N-Terminal Domain Of Riboflavin Synthase From E. Coli Length = 97
>gi|15826468|pdb|1HZE|B Chain B, Solution Structure Of The N-Terminal Domain Of Riboflavin Synthase From E. Coli Length = 97
 Score = 81.3 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 6/102 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVM-TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV    K++++          V    +    ++ G S+AH G CLTV  ++     
Sbjct: 1   MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEIN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGH 101
            N    ++  ET RITN+    +G ++N+ER+ K  D + GH
Sbjct: 56  GNHVSFDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGH 97