PSIBLAST alignment of GI: 254780347 and protein with PDB id: 1hze

>gi|15826467|pdb|1HZE|A Chain A, Solution Structure Of The N-Terminal Domain Of Riboflavin Synthase From E. Coli Length = 97
>gi|15826468|pdb|1HZE|B Chain B, Solution Structure Of The N-Terminal Domain Of Riboflavin Synthase From E. Coli Length = 97
 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 41/85 (48%)

Query: 102 LVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD 161
           + +G + GT +++ +D   +     + LP ++   +    SV  NG  LTV  +  N   
Sbjct: 1   MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVS 60

Query: 162 VLLIRHTIEETTWKMHKVGDLINIE 186
             L++ T+  T     KVGD +N+E
Sbjct: 61  FDLMKETLRITNLGDLKVGDWVNVE 85