BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit
alpha [Candidatus Liberibacter asiaticus str. psy62]
         (204 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|23501655|ref|NP_697782.1| riboflavin synthase subunit alpha [Brucella suis 1330]
 gi|23347575|gb|AAN29697.1| riboflavin synthase, alpha subunit [Brucella suis 1330]
          Length = 202

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 138/202 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY+ARL     
Sbjct: 181 DKVNIEIDQLARYVARLAQYQK 202


>gi|256159496|ref|ZP_05457264.1| riboflavin synthase subunit alpha [Brucella ceti M490/95/1]
 gi|256254782|ref|ZP_05460318.1| riboflavin synthase subunit alpha [Brucella ceti B1/94]
          Length = 202

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 108/202 (53%), Positives = 138/202 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W ET R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEETLRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|254718885|ref|ZP_05180696.1| riboflavin synthase subunit alpha [Brucella sp. 83/13]
 gi|306838195|ref|ZP_07471049.1| riboflavin synthase, alpha subunit [Brucella sp. NF 2653]
 gi|306841986|ref|ZP_07474660.1| riboflavin synthase, alpha subunit [Brucella sp. BO2]
 gi|306843712|ref|ZP_07476312.1| riboflavin synthase, alpha subunit [Brucella sp. BO1]
 gi|306276022|gb|EFM57731.1| riboflavin synthase, alpha subunit [Brucella sp. BO1]
 gi|306287914|gb|EFM59331.1| riboflavin synthase, alpha subunit [Brucella sp. BO2]
 gi|306406704|gb|EFM62929.1| riboflavin synthase, alpha subunit [Brucella sp. NF 2653]
          Length = 202

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVERVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|261221962|ref|ZP_05936243.1| riboflavin synthase subunit alpha [Brucella ceti B1/94]
 gi|265997925|ref|ZP_06110482.1| riboflavin synthase subunit alpha [Brucella ceti M490/95/1]
 gi|260920546|gb|EEX87199.1| riboflavin synthase subunit alpha [Brucella ceti B1/94]
 gi|262552393|gb|EEZ08383.1| riboflavin synthase subunit alpha [Brucella ceti M490/95/1]
          Length = 203

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 108/202 (53%), Positives = 138/202 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W ET R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEETLRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|265983871|ref|ZP_06096606.1| riboflavin synthase subunit alpha [Brucella sp. 83/13]
 gi|264662463|gb|EEZ32724.1| riboflavin synthase subunit alpha [Brucella sp. 83/13]
          Length = 203

 Score =  195 bits (496), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVERVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|254701541|ref|ZP_05163369.1| riboflavin synthase subunit alpha [Brucella suis bv. 5 str. 513]
          Length = 202

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 108/202 (53%), Positives = 138/202 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVEVW E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEVWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|261752091|ref|ZP_05995800.1| riboflavin synthase subunit alpha [Brucella suis bv. 5 str. 513]
 gi|261741844|gb|EEY29770.1| riboflavin synthase subunit alpha [Brucella suis bv. 5 str. 513]
          Length = 203

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 108/202 (53%), Positives = 138/202 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVEVW E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEVWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|161618735|ref|YP_001592622.1| riboflavin synthase subunit alpha [Brucella canis ATCC 23365]
 gi|163843039|ref|YP_001627443.1| riboflavin synthase subunit alpha [Brucella suis ATCC 23445]
 gi|254704090|ref|ZP_05165918.1| riboflavin synthase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|254707009|ref|ZP_05168837.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|254709882|ref|ZP_05171693.1| riboflavin synthase subunit alpha [Brucella pinnipedialis B2/94]
 gi|256031375|ref|ZP_05444989.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|256060884|ref|ZP_05451044.1| riboflavin synthase subunit alpha [Brucella neotomae 5K33]
 gi|256369200|ref|YP_003106708.1| riboflavin synthase subunit alpha [Brucella microti CCM 4915]
 gi|260168508|ref|ZP_05755319.1| riboflavin synthase subunit alpha [Brucella sp. F5/99]
 gi|260566662|ref|ZP_05837132.1| lumazine-binding protein [Brucella suis bv. 4 str. 40]
 gi|161335546|gb|ABX61851.1| riboflavin synthase, alpha subunit [Brucella canis ATCC 23365]
 gi|163673762|gb|ABY37873.1| riboflavin synthase, alpha subunit [Brucella suis ATCC 23445]
 gi|255999360|gb|ACU47759.1| riboflavin synthase subunit alpha [Brucella microti CCM 4915]
 gi|260156180|gb|EEW91260.1| lumazine-binding protein [Brucella suis bv. 4 str. 40]
          Length = 202

 Score =  194 bits (494), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|254713883|ref|ZP_05175694.1| riboflavin synthase subunit alpha [Brucella ceti M644/93/1]
 gi|254717060|ref|ZP_05178871.1| riboflavin synthase subunit alpha [Brucella ceti M13/05/1]
          Length = 202

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAEKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|225627266|ref|ZP_03785303.1| riboflavin synthase, alpha subunit [Brucella ceti str. Cudo]
 gi|261314476|ref|ZP_05953673.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|261317424|ref|ZP_05956621.1| riboflavin synthase subunit alpha [Brucella pinnipedialis B2/94]
 gi|261324882|ref|ZP_05964079.1| riboflavin synthase subunit alpha [Brucella neotomae 5K33]
 gi|261754750|ref|ZP_05998459.1| riboflavin synthase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|261757978|ref|ZP_06001687.1| lumazine-binding protein [Brucella sp. F5/99]
 gi|265988461|ref|ZP_06101018.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|294852129|ref|ZP_06792802.1| riboflavin synthase [Brucella sp. NVSL 07-0026]
 gi|225617271|gb|EEH14316.1| riboflavin synthase, alpha subunit [Brucella ceti str. Cudo]
 gi|261296647|gb|EEY00144.1| riboflavin synthase subunit alpha [Brucella pinnipedialis B2/94]
 gi|261300862|gb|EEY04359.1| riboflavin synthase subunit alpha [Brucella neotomae 5K33]
 gi|261303502|gb|EEY06999.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M163/99/10]
 gi|261737962|gb|EEY25958.1| lumazine-binding protein [Brucella sp. F5/99]
 gi|261744503|gb|EEY32429.1| riboflavin synthase subunit alpha [Brucella suis bv. 3 str. 686]
 gi|264660658|gb|EEZ30919.1| riboflavin synthase subunit alpha [Brucella pinnipedialis
           M292/94/1]
 gi|294820718|gb|EFG37717.1| riboflavin synthase [Brucella sp. NVSL 07-0026]
          Length = 203

 Score =  194 bits (493), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|62289720|ref|YP_221513.1| riboflavin synthase subunit alpha [Brucella abortus bv. 1 str.
           9-941]
 gi|82699649|ref|YP_414223.1| riboflavin synthase subunit alpha [Brucella melitensis biovar
           Abortus 2308]
 gi|189023969|ref|YP_001934737.1| riboflavin synthase subunit alpha [Brucella abortus S19]
 gi|254689029|ref|ZP_05152283.1| riboflavin synthase subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|254693512|ref|ZP_05155340.1| riboflavin synthase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697164|ref|ZP_05158992.1| riboflavin synthase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730060|ref|ZP_05188638.1| riboflavin synthase subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|256044454|ref|ZP_05447358.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113298|ref|ZP_05454166.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257279|ref|ZP_05462815.1| riboflavin synthase subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|260545527|ref|ZP_05821268.1| lumazine-binding protein [Brucella abortus NCTC 8038]
 gi|260563805|ref|ZP_05834291.1| lumazine-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|297248125|ref|ZP_06931843.1| riboflavin synthase, alpha subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|62195852|gb|AAX74152.1| RibE, riboflavin synthase, alpha subunit [Brucella abortus bv. 1
           str. 9-941]
 gi|82615750|emb|CAJ10746.1| Rhodopsin-like GPCR superfamily:Lumazine-binding protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189019541|gb|ACD72263.1| Lumazine-binding protein [Brucella abortus S19]
 gi|260096934|gb|EEW80809.1| lumazine-binding protein [Brucella abortus NCTC 8038]
 gi|260153821|gb|EEW88913.1| lumazine-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|297175294|gb|EFH34641.1| riboflavin synthase, alpha subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 202

 Score =  194 bits (492), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 136/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|153009854|ref|YP_001371069.1| riboflavin synthase subunit alpha [Ochrobactrum anthropi ATCC
           49188]
 gi|151561742|gb|ABS15240.1| riboflavin synthase, alpha subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 202

 Score =  194 bits (492), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 106/202 (52%), Positives = 136/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ +  
Sbjct: 1   MFTGIITDIGKVDRIKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGTNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+ W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISKWQSGRNINLERSLKLGDEMGGHLVSGHVDGQAEIVERKEEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNGNEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|269127206|ref|YP_003300576.1| riboflavin synthase subunit alpha [Thermomonospora curvata DSM
           43183]
 gi|268312164|gb|ACY98538.1| riboflavin synthase, alpha subunit [Thermomonospora curvata DSM
           43183]
          Length = 202

 Score =  194 bits (492), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 112/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+ P     RL V     T     G SIA  G+CLTVV ++ E    
Sbjct: 1   MFTGIVEELGEVVAVEPAGDSARLTVRGPLVTQDAVHGASIAVNGVCLTVVEVNGEE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++     G+ +NLER V+L DRL GHLV GH+DG   I+      
Sbjct: 58  --FTADVMKETLDRSSLGVLEPGSPVNLERPVRLSDRLGGHLVQGHVDGVGRIVSRRAEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +S+P  L ++I  KGS+ ++GVSLTV   G     V LI  T+E TT      G
Sbjct: 116 RWHLVTVSVPAELSRYIVEKGSIAIDGVSLTVVEAGPEQLSVSLIPTTLELTTLGRKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL A  T++
Sbjct: 176 DPVNLEVDVIAKYVERLTAHRTAE 199


>gi|261218870|ref|ZP_05933151.1| riboflavin synthase subunit alpha [Brucella ceti M13/05/1]
 gi|261321631|ref|ZP_05960828.1| riboflavin synthase subunit alpha [Brucella ceti M644/93/1]
 gi|260923959|gb|EEX90527.1| riboflavin synthase subunit alpha [Brucella ceti M13/05/1]
 gi|261294321|gb|EEX97817.1| riboflavin synthase subunit alpha [Brucella ceti M644/93/1]
          Length = 203

 Score =  194 bits (492), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAEKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|17987471|ref|NP_540105.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           16M]
 gi|237815208|ref|ZP_04594206.1| riboflavin synthase, alpha subunit [Brucella abortus str. 2308 A]
 gi|260754524|ref|ZP_05866872.1| riboflavin synthase subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|260757745|ref|ZP_05870093.1| riboflavin synthase subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260761570|ref|ZP_05873913.1| riboflavin synthase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883552|ref|ZP_05895166.1| riboflavin synthase subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|261213772|ref|ZP_05928053.1| riboflavin synthase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|265990875|ref|ZP_06103432.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994711|ref|ZP_06107268.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983167|gb|AAL52369.1| riboflavin synthase alpha chain [Brucella melitensis bv. 1 str.
           16M]
 gi|237790045|gb|EEP64255.1| riboflavin synthase, alpha subunit [Brucella abortus str. 2308 A]
 gi|260668063|gb|EEX55003.1| riboflavin synthase subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260672002|gb|EEX58823.1| riboflavin synthase subunit alpha [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674632|gb|EEX61453.1| riboflavin synthase subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|260873080|gb|EEX80149.1| riboflavin synthase subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|260915379|gb|EEX82240.1| riboflavin synthase subunit alpha [Brucella abortus bv. 3 str.
           Tulya]
 gi|262765824|gb|EEZ11613.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001659|gb|EEZ14234.1| riboflavin synthase subunit alpha [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 203

 Score =  194 bits (492), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 136/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQAEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|225852284|ref|YP_002732517.1| riboflavin synthase subunit alpha [Brucella melitensis ATCC 23457]
 gi|225640649|gb|ACO00563.1| riboflavin synthase, alpha subunit [Brucella melitensis ATCC 23457]
 gi|326408788|gb|ADZ65853.1| riboflavin synthase subunit alpha [Brucella melitensis M28]
 gi|326538506|gb|ADZ86721.1| riboflavin synthase, alpha subunit [Brucella melitensis M5-90]
          Length = 202

 Score =  193 bits (491), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 136/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQTEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|239831593|ref|ZP_04679922.1| riboflavin synthase, alpha subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239823860|gb|EEQ95428.1| riboflavin synthase, alpha subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 203

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 106/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ +  
Sbjct: 2   MFTGIITDIGKVDRIKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGTNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISAWQNGRNINLERSLKLGDEMGGHLVSGHVDGQAEIIDRKEEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVDGNEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|265999514|ref|ZP_05466743.2| lumazine-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|263094455|gb|EEZ18277.1| lumazine-binding protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 203

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 136/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 2   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+SW  G  INLERS+KLGD + GHLV GH+DG  EI+     G
Sbjct: 62  RWFEVEAWEEALRLTTISSWQSGRKINLERSLKLGDEMGGHLVFGHVDGQTEIVERKDEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 122 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 182 DKVNIEIDQLARYAARLAQYQK 203


>gi|148559282|ref|YP_001258747.1| riboflavin synthase subunit alpha [Brucella ovis ATCC 25840]
 gi|148370539|gb|ABQ60518.1| riboflavin synthase, alpha subunit [Brucella ovis ATCC 25840]
          Length = 202

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 107/202 (52%), Positives = 137/202 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK+  + P+ +G+ LR+ T+Y+   ++LG SIA +G+CLTVV L E+ S  
Sbjct: 1   MFTGIITDIGKVDRVKPLNEGVLLRIETAYDPETIELGASIACSGVCLTVVALPEKGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I++W  G  INLERS+KLGD + GHLVSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTISNWQSGRKINLERSLKLGDEMGGHLVSGHVDGQAEIVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FIA KGSV L+G SLTVN V  N FDVLLIRH++E TTW   K G
Sbjct: 121 DAVRFTLRAPEELAPFIAQKGSVALDGTSLTVNGVNANEFDVLLIRHSLEVTTWGECKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +NIE+D + RY ARL     
Sbjct: 181 DKVNIEIDQLARYAARLAQYQK 202


>gi|239939893|ref|ZP_04691830.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           15998]
 gi|239986379|ref|ZP_04707043.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           11379]
 gi|291443326|ref|ZP_06582716.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           15998]
 gi|291346273|gb|EFE73177.1| riboflavin synthase subunit alpha [Streptomyces roseosporus NRRL
           15998]
          Length = 202

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A   R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLADASRFRLRGPLVTEGAKHGDSIAVNGVCLTVVD-----TGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GEFTADVMAETLKRSSLGALAPGSRVNLERPMALGGRLGGHLVQGHVDGTGTIVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++GVSLTV     ++F + LI  T+  TT    + G
Sbjct: 116 HWEIVKVSLPPELTRYVVEKGSITVDGVSLTVVDAAADYFTISLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ R+      Q
Sbjct: 176 DPVNLEVDVIAKYVERMLGDRAGQ 199


>gi|256392293|ref|YP_003113857.1| riboflavin synthase, subunit alpha [Catenulispora acidiphila DSM
           44928]
 gi|256358519|gb|ACU72016.1| riboflavin synthase, alpha subunit [Catenulispora acidiphila DSM
           44928]
          Length = 223

 Score =  193 bits (489), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 77/201 (38%), Positives = 113/201 (56%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+       RLRV  S  TS  + G SIA  G+CLTV+   ++ +  
Sbjct: 1   MFTGIVEELGRVVALEADGDSARLRVAGSLVTSDAEHGSSIAVNGVCLTVIESGDQAAKA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +N+     G  +NLER +KLG RL GHLV GH+DG   +L      
Sbjct: 61  GEFTADVMAETLDKSNLGDLKPGDPVNLERPMKLGARLGGHLVQGHVDGVGVVLERIPGE 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R+SLP  L +++  KGS+ ++G+SLTV     + F V LI  T+E TT      G
Sbjct: 121 HWEVVRVSLPSALSRYVVDKGSITVDGISLTVVEAAADSFTVSLIPTTLELTTLGSKGPG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+E+D + +Y  RL  L+
Sbjct: 181 AAVNLEIDVIAKYTERLLGLD 201


>gi|254282467|ref|ZP_04957435.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR51-B]
 gi|219678670|gb|EED35019.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR51-B]
          Length = 218

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 116/199 (58%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I AM P    +RLR+ T   + S ++LG SI  +G CLTV  L      
Sbjct: 1   MFTGIIEAVGEIAAMEPRGGDLRLRIRTGKLDLSDVQLGDSICTSGTCLTVTEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  ET   T +     G  +NLERS+    RL GH+VSGH+DG  E++ +D  
Sbjct: 56  GDGYWADVSVETLNFTTLGDKKPGNRVNLERSLTPASRLGGHIVSGHVDGVGEVVAVDQD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P +L ++IA KGS+C++G SLTVN V    F++ +I  T++ET +  ++ 
Sbjct: 116 ARSWRYSVEAPPDLARYIAHKGSICVDGTSLTVNAVHGGRFELNIIPQTLQETVFGEYQP 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GSRVNLEVDVIARYLERLL 194


>gi|90419411|ref|ZP_01227321.1| riboflavin synthase, alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336348|gb|EAS50089.1| riboflavin synthase, alpha subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 205

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 97/204 (47%), Positives = 136/204 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+++    +  G R R+ T Y+ + + LG SIA +G+CLTV  L +    D
Sbjct: 1   MFTGIVTDVGRVVRTERLDAGRRFRIATHYDPAGIALGASIACSGVCLTVTALPQAGDAD 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T   SW   + +NLERS+K+GD + GHLVSGH+DG  EI+ +   G
Sbjct: 61  RWFEVEAWEEALRLTTAGSWEEASALNLERSLKIGDEIGGHLVSGHVDGQAEIVAVTGEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   L  P +L +FIA KGSVCL+G SLTVN V  + FDVLLIRH+++ TTW   K G
Sbjct: 121 EAVRFTLQAPGDLSRFIARKGSVCLDGTSLTVNGVDGDRFDVLLIRHSLDVTTWGARKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + RY  RL+   +++
Sbjct: 181 DRVNLEVDQIARYAERLFGARSAE 204


>gi|182439883|ref|YP_001827602.1| riboflavin synthase subunit alpha [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326780549|ref|ZP_08239814.1| riboflavin synthase, alpha subunit [Streptomyces cf. griseus
           XylebKG-1]
 gi|178468399|dbj|BAG22919.1| putative riboflavin synthase alpha subunit [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326660882|gb|EGE45728.1| riboflavin synthase, alpha subunit [Streptomyces cf. griseus
           XylebKG-1]
          Length = 202

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A   R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLADASRFRLRGPLVTEGAKHGDSIAVNGVCLTVVD-----TGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + + + +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GEFTADVMAETLKRSGLGALAPGSRVNLERPMALGGRLGGHLVQGHVDGTGTIVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++GVSLTV     +FF + LI  T+  TT    + G
Sbjct: 116 HWELVKVSLPPELSRYVVEKGSITVDGVSLTVVEAAADFFTISLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ R+      Q
Sbjct: 176 DPVNLEVDVIAKYVERMLGDRAGQ 199


>gi|290961889|ref|YP_003493071.1| riboflavin synthase subunit alpha [Streptomyces scabiei 87.22]
 gi|260651415|emb|CBG74537.1| putative riboflavin synthase alpha subunit [Streptomyces scabiei
           87.22]
          Length = 206

 Score =  191 bits (485), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 120/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEVTAVEKLGDSSRFRLRGPVVTEGARHGDSIAVNGVCLTVVE-----HED 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+  +V AE+ + +++ +  +G+ +NLER + +GDRL GH+V GH+DGT E++      
Sbjct: 56  DWFTADVMAESLQRSSLGALTVGSRVNLERPMAVGDRLGGHIVQGHVDGTGEVIERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G + F V LI  T++ TT    + G
Sbjct: 116 NWEIVKISLPADLTRYVVEKGSITVDGISLTVVDAGPDHFTVSLIPTTLDLTTLGRKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + +Y+ RL    
Sbjct: 176 DPVNLEVDVIAKYVERLLGDR 196


>gi|307326835|ref|ZP_07606027.1| riboflavin synthase, alpha subunit [Streptomyces violaceusniger Tu
           4113]
 gi|306887598|gb|EFN18592.1| riboflavin synthase, alpha subunit [Streptomyces violaceusniger Tu
           4113]
          Length = 240

 Score =  191 bits (485), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +    R +V     T   K G SIA  G+CLTVV L  E +  
Sbjct: 1   MFTGIVEELGEIVAIEHLGDASRFQVRGPVVTEGAKHGDSIAVNGVCLTVVDL-IEDAEG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  IG+ +NLER + LG RL GH+V GH+DGT  I+      
Sbjct: 60  TRFSADVMAETLDRSSLGALDIGSRVNLERPMALGGRLGGHIVQGHVDGTGAIVDRKLSE 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 120 HWEIVKISLPAELSRYVVEKGSITVDGISLTVVDAGSDYFTVSLIPTTLALTTLGVKQAG 179

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+EVD + +Y+ RL   + 
Sbjct: 180 DPVNLEVDVLAKYVERLLGRDN 201


>gi|119716674|ref|YP_923639.1| riboflavin synthase subunit alpha [Nocardioides sp. JS614]
 gi|119537335|gb|ABL81952.1| riboflavin synthase, alpha subunit [Nocardioides sp. JS614]
          Length = 217

 Score =  191 bits (484), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 67/208 (32%), Positives = 101/208 (48%), Gaps = 10/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+      +RL +  +       LG SIA  G CLTV          
Sbjct: 1   MFTGIVEELGTVAAVEDQGDAIRLTIRATTVLEDAALGDSIAVNGCCLTVAARD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   T++A    G  +NLER+V    RL GH+V GH+DG   ++      
Sbjct: 56  DTWTADVMQETLDKTSLAGVRPGDRVNLERAVTAHTRLGGHIVQGHVDGVGTVVRRTPSE 115

Query: 121 DSMYCRLSLPHN-----LEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
                 +S P       L +++  KGS+ ++GVSLTV     + F V LI  T+  TT  
Sbjct: 116 HWEVVEISFPPADQRGTLARYLVDKGSITVDGVSLTVVEATADGFTVSLIPETLARTTLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
             + GD +N+E D + +++ RL A    
Sbjct: 176 TRRPGDRVNLEADILAKHVERLLAHRDQ 203


>gi|306836171|ref|ZP_07469156.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49726]
 gi|304567954|gb|EFM43534.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49726]
          Length = 204

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 114/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + A+   A  +RL +      S  +LG SIA  G+CLT+  L       
Sbjct: 1   MFTGLVQELGTVAALEQQADALRLSIRAPQTVSDARLGDSIAINGVCLTIAELD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  E+   T +     G  +N+E ++    RL GH++ GH+DGT  ++  +   
Sbjct: 56  DIFCADVMQESLDRTGLGQLKEGARVNVEPALLPTTRLGGHMMQGHVDGTARLVSREHSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SLP +L +++  KGS+ +NG SLTV+ VG+++F+V LI  T+ ETT    KVG
Sbjct: 116 HWDVLRFSLPRDLARYVVEKGSIAVNGTSLTVSAVGEDWFEVSLIPTTLRETTHGESKVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++N+EVD + +Y+ ++ 
Sbjct: 176 DIVNLEVDVLAKYVEKML 193


>gi|226314398|ref|YP_002774294.1| riboflavin synthase alpha subunit [Brevibacillus brevis NBRC
           100599]
 gi|226097348|dbj|BAH45790.1| riboflavin synthase alpha subunit [Brevibacillus brevis NBRC
           100599]
          Length = 218

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 69/202 (34%), Positives = 113/202 (55%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + A+    +  RL +        +KLG SI+  GICLTV   +      
Sbjct: 1   MFTGLVEEVGVLEAIQGNEQARRLVIRAQQVLEGVKLGDSISVNGICLTVTSYTNRQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T++     G  +NLER+++LGDR  GH+VSGH+DGT  +   +   
Sbjct: 58  --FSVDVMPETMNKTSLRQLRSGQRVNLERAMRLGDRFGGHIVSGHVDGTGMVASREVNA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+     L +++  +GS+C++G+SLTV  V  + F V +I HT+  T+    + G
Sbjct: 116 NAVVFRIEAKPQLLKYVIARGSICIDGISLTVVEVNDSGFTVSIIPHTLANTSLADRRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+N+E D + +Y+ RL     
Sbjct: 176 DLVNLETDVIGKYVERLLGYQN 197


>gi|313680605|ref|YP_004058344.1| riboflavin synthase, alpha subunit [Oceanithermus profundus DSM
           14977]
 gi|313153320|gb|ADR37171.1| riboflavin synthase, alpha subunit [Oceanithermus profundus DSM
           14977]
          Length = 196

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++    P    +R+ +         ++G SIA +G CLTVV LS      
Sbjct: 1   MFTGIVEEVGRVTQAEPKGGNLRVWIEAEKVLEGTEVGDSIATSGACLTVVELSPR---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET + T    W  G  +NLER+ ++GDRLDGHLV+GH+DG   +   D   
Sbjct: 57  -GFAVELAQETVKRTAPR-WRPGARVNLERAARVGDRLDGHLVTGHVDGVGRVTRFDRRP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L ++IA KGS+ ++GVSLTV  V    F V LI HT++ TT    K G
Sbjct: 115 GAHDLYVEAPAELARYIAAKGSITIDGVSLTVVEVRGQVFSVTLIPHTLQVTTLGELKPG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E+D + RY+ RL  + T
Sbjct: 175 DAVNLEIDIIARYVERLLEVRT 196


>gi|225181337|ref|ZP_03734781.1| riboflavin synthase, alpha subunit [Dethiobacter alkaliphilus AHT
           1]
 gi|225167918|gb|EEG76725.1| riboflavin synthase, alpha subunit [Dethiobacter alkaliphilus AHT
           1]
          Length = 217

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 76/203 (37%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  ++      +L V      + ++LG SIA  G+CLTV   S +    
Sbjct: 1   MFTGIVEELGTVKTLSVRGDAGKLSVKAKQVLTDVRLGDSIAVNGVCLTVTSFSAQE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R TN+     G  +NLER++ LG RL GHLVSGH+DG   I+     G
Sbjct: 58  --FVADVMPETLRKTNLLQLQGGDPVNLERALALGGRLGGHLVSGHVDGVGAIVEKRPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+S P  + ++I  KGSV ++G+SLTV  V    F V +I HT   TT    K G
Sbjct: 116 NAVIYRISAPPEVLRYIIAKGSVAIDGISLTVADVSSEAFSVSVIPHTASVTTLGYKKEG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ RL + +  
Sbjct: 176 DAVNLENDMIGKYVERLLSAHRE 198


>gi|328881088|emb|CCA54327.1| Riboflavin synthase alpha chain [Streptomyces venezuelae ATCC
           10712]
          Length = 202

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 119/204 (58%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +    R R+     T   + G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEVVAVEQLEDASRFRLRGPLVTEGAQHGDSIAVNGVCLTVVEFG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +  +GT +NLER + +G RL GH+V GH+DGT  IL      
Sbjct: 56  GEFTADVMAETLKRSSLGALDVGTRVNLERPMAVGGRLGGHIVQGHVDGTGTILERSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++ LP +L +++  KGS+ ++GVSLTV  V  ++F + LI  T++ TT  + + G
Sbjct: 116 HWELVKVGLPAHLSRYVVEKGSITVDGVSLTVVEVADDWFTISLIPTTLDLTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL   +  +
Sbjct: 176 DPVNLEVDVIAKYVERLLGADAKE 199


>gi|29833444|ref|NP_828078.1| riboflavin synthase subunit alpha [Streptomyces avermitilis
           MA-4680]
 gi|29610567|dbj|BAC74613.1| putative riboflavin synthase alpha subunit [Streptomyces
           avermitilis MA-4680]
          Length = 202

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEVTAVENLGDASRFRLRGPVVTENAQHGDSIAVNGVCLTVVE-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   +++ +  +G+ +NLER + +G RL GH+V GH+DGT  ++      
Sbjct: 56  DEFTADVMAETLDRSSLGALAVGSRVNLERPMAVGARLGGHIVQGHVDGTGAVIERRPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT    + G
Sbjct: 116 NWEIVKVSLPADLSRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGRKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL    T +
Sbjct: 176 DPVNLEVDVVAKYVERLLGDRTRE 199


>gi|256824049|ref|YP_003148009.1| riboflavin synthase subunit alpha [Kytococcus sedentarius DSM
           20547]
 gi|256687442|gb|ACV05244.1| riboflavin synthase, alpha subunit [Kytococcus sedentarius DSM
           20547]
          Length = 204

 Score =  189 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 112/201 (55%), Gaps = 2/201 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I  + P    +RL V     TS    G SIA  G+CLTV  L E     
Sbjct: 1   MFTGIIEELGRIEVIDPAGDDVRLTVHGPLVTSDASRGDSIAVNGVCLTVTDLGEAGDSA 60

Query: 61  N--WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +   +  +V  ET   +++ +   G+ +NLER+V++  RL GH+V GH+DG   I     
Sbjct: 61  SPARFTADVMPETLTHSSLGALTPGSPVNLERAVRVDARLGGHIVQGHVDGVGTIADRTP 120

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                  R+S+P  L +++  KGS+ L+GVSLTV+ VG ++ +V LI  T+  TT     
Sbjct: 121 GDRWEVVRVSIPVALARYVVDKGSITLDGVSLTVSGVGTDWLEVSLIPETLARTTLGTAA 180

Query: 179 VGDLINIEVDSMMRYIARLYA 199
           VG  +N+EVD + +Y+ +L  
Sbjct: 181 VGSPVNVEVDVLAKYVEKLVG 201


>gi|239978359|ref|ZP_04700883.1| riboflavin synthase subunit alpha [Streptomyces albus J1074]
 gi|291450255|ref|ZP_06589645.1| riboflavin synthase subunit alpha [Streptomyces albus J1074]
 gi|291353204|gb|EFE80106.1| riboflavin synthase subunit alpha [Streptomyces albus J1074]
          Length = 207

 Score =  189 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 69/203 (33%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEVTAVEDLGDAARFRLRGPVVTEGARHGDSIAVNGVCLTVVDHD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   +++ +   G+ +NLER   +G RL GHLV GH+DG   +   +   
Sbjct: 56  DSFTADVMAETLTRSSLGALAPGSRVNLERPTAVGGRLGGHLVQGHVDGVGTLTAREPSA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++GVSLTV   G+  F + LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPAHLARYVVEKGSITVDGVSLTVVEAGEEHFTISLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+ R+     +
Sbjct: 176 DPVNLEVDVIAKYVERMLGHRAA 198


>gi|227503569|ref|ZP_03933618.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49725]
 gi|227075605|gb|EEI13568.1| riboflavin synthase subunit alpha [Corynebacterium accolens ATCC
           49725]
          Length = 200

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 67/198 (33%), Positives = 113/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + A+   A  +RL +      S  +LG SIA  G+CLT+  L       
Sbjct: 1   MFTGLVQELGTVAALEQQADALRLSIRAPQTVSDARLGDSIAINGVCLTIAELD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  E+   T +     G  +N+E ++    RL GH++ GH+DGT  ++  +   
Sbjct: 56  DIFCADVMQESLDRTGLGQLKEGARVNVEPALLPTTRLGGHMMQGHVDGTARLVSREHSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SL  +L +++  KGS+ +NG SLTV+ VG+++F+V LI  T+ ETT    +VG
Sbjct: 116 HWDVLRFSLSRDLARYVVEKGSIAVNGTSLTVSAVGEDWFEVSLIPTTLRETTHGESQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++N+EVD + +Y+ ++ 
Sbjct: 176 DIVNLEVDVLAKYVEKML 193


>gi|307945263|ref|ZP_07660599.1| riboflavin synthase, alpha subunit [Roseibium sp. TrichSKD4]
 gi|307771136|gb|EFO30361.1| riboflavin synthase, alpha subunit [Roseibium sp. TrichSKD4]
          Length = 203

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 92/203 (45%), Positives = 121/203 (59%), Gaps = 1/203 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I ++  +  G+R R+ T Y+   + +G SIA  G C TVV         
Sbjct: 1   MFTGIVTDLGEITSVEKVPAGLRTRIRTQYDPEGIDIGASIACGGPCHTVVAKG-TDDAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EV+  AET  +T ++ W  G  +NLERS+K+G  L GHLV GH+DG   I   +   
Sbjct: 60  NWFEVDSAAETRALTTVSDWKQGMKLNLERSLKMGTELGGHLVLGHVDGLATITKREDHE 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+Y +   P     FIA KGSV L+G SLTVN    + F V LI HT+E TTW    VG
Sbjct: 120 DSVYFQFQAPMEFAPFIAKKGSVALDGTSLTVNEADGDLFSVFLIPHTLEVTTWSERHVG 179

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD M RY ARL   + +
Sbjct: 180 DKVNLEVDMMARYAARLAEFSKA 202


>gi|302550092|ref|ZP_07302434.1| riboflavin synthase, alpha subunit [Streptomyces viridochromogenes
           DSM 40736]
 gi|302467710|gb|EFL30803.1| riboflavin synthase, alpha subunit [Streptomyces viridochromogenes
           DSM 40736]
          Length = 202

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A+  +    R R+     T   K G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEITAVETLDDACRFRLRGPVVTQGAKHGDSIAVNGVCLTVVD-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   +++ +   G+ +NLER + +G+RL GH+V GH+DGT EIL      
Sbjct: 56  DEFTADVMAETLNRSSLGALKAGSRVNLERPMAVGERLGGHIVQGHVDGTGEILERKPSD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G + F V LI  T+  TT    + G
Sbjct: 116 HWEIVKISLPADLTRYVVEKGSITVDGISLTVVDAGPDHFTVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ R+      +
Sbjct: 176 DPVNLEVDVIAKYVERMMGDRAQE 199


>gi|302541056|ref|ZP_07293398.1| riboflavin synthase, alpha subunit [Streptomyces hygroscopicus ATCC
           53653]
 gi|302458674|gb|EFL21767.1| riboflavin synthase, alpha subunit [Streptomyces himastatinicus
           ATCC 53653]
          Length = 206

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 75/200 (37%), Positives = 117/200 (58%), Gaps = 5/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +    R +V     T   + G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEIVAVENLGDASRFQVRGPVVTEGARHGDSIAVNGVCLTVVD-----TGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER + LG RL GHLV GH+DGT  ++      
Sbjct: 56  GGFSADVMAETLDRSSLGALAVGSRVNLERPMALGGRLGGHLVQGHVDGTGTLIERKLSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPSELGRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGVKQPG 175

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+EVD + +Y+ RL A 
Sbjct: 176 DPVNLEVDVLAKYVERLLAH 195


>gi|190891195|ref|YP_001977737.1| riboflavin synthase, alpha chain [Rhizobium etli CIAT 652]
 gi|190696474|gb|ACE90559.1| riboflavin synthase protein, alpha chain [Rhizobium etli CIAT 652]
          Length = 203

 Score =  188 bits (478), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 108/203 (53%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + +++P+ +G+RLRV T+Y+ S + +G SI+H+GICLTV  L  E S  
Sbjct: 1   MFTGIVTDVGTVESVSPLKEGIRLRVATAYDPSTIDMGASISHSGICLTVTGLPAEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWQQGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|121602297|ref|YP_988936.1| riboflavin synthase subunit alpha [Bartonella bacilliformis KC583]
 gi|6572099|emb|CAB63083.1| riboflavin synthase alpha chain [Bartonella bacilliformis]
 gi|120614474|gb|ABM45075.1| riboflavin synthase, alpha subunit [Bartonella bacilliformis KC583]
          Length = 205

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 107/201 (53%), Positives = 138/201 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  + P+A+G+RL + T Y+   +K+G S+A +GICLTVV  +      
Sbjct: 1   MFTGIVTDIGCVEEIQPLAQGVRLNISTHYDLENLKVGASVACSGICLTVVECASTQKNS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN++ W  GTF+NLERS++LGD + GHLVSGH+DG  EI+      
Sbjct: 61  HWFAVEAWEETLRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHVDGLAEIIDQKNER 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D +Y RL +P  L  FIA KGSV LNG SLT+N V  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DMVYFRLQVPEQLAPFIAQKGSVALNGTSLTINYVEDNVFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD   RY ARL+   
Sbjct: 181 DQVNLEVDQFARYAARLFNFK 201


>gi|302392185|ref|YP_003828005.1| riboflavin synthase, alpha subunit [Acetohalobium arabaticum DSM
           5501]
 gi|302204262|gb|ADL12940.1| riboflavin synthase, alpha subunit [Acetohalobium arabaticum DSM
           5501]
          Length = 217

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 126/201 (62%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ ++   ++ + L +        +K+G SIA +G+CLTV    E     
Sbjct: 1   MFTGIVEEMGEVSSINRGSQSVELEIKADKVLEDVKIGDSIATSGVCLTVTDFGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++ V+V  ET R +++A   IG+ +NLER+++L DRL GHLVSGHIDGT +I       
Sbjct: 56  DYFTVDVMPETMRKSSLAELQIGSKVNLERALRLQDRLGGHLVSGHIDGTGKIKKKQRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +SLP +L++++  KGS+ ++G+SLT+  + +  F V LI HT +ETT     +G
Sbjct: 116 NAILVTVSLPSDLKRYLIPKGSITVDGISLTIAELEETEFIVSLIPHTAQETTLGQKSIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + +Y+ R+    
Sbjct: 176 DTVNLEVDLIGKYVERMLNFQ 196


>gi|282866176|ref|ZP_06275223.1| riboflavin synthase, alpha subunit [Streptomyces sp. ACTE]
 gi|282558960|gb|EFB64515.1| riboflavin synthase, alpha subunit [Streptomyces sp. ACTE]
          Length = 206

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 75/203 (36%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV L       
Sbjct: 1   MFTGIVEELGEVTAVEKLDDASRFRLRGPVVTEGAKHGDSIAVNGVCLTVVDLD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +   G+ +NLER + LG RL GH+V GH+DGT  I+      
Sbjct: 56  GEFTADVMAETLDRSSLGALTTGSRVNLERPMALGGRLGGHIVQGHVDGTGRIVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP  L +++  KGS+ ++GVSLTV   G + F V LI  T+  TT  +   G
Sbjct: 116 HWELVKVSLPGGLARYVVEKGSITVDGVSLTVVDAGADHFTVSLIPTTLALTTLGIKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+ RL   +++
Sbjct: 176 DPVNLEVDVLAKYVERLLGASSA 198


>gi|319948956|ref|ZP_08023061.1| riboflavin synthase subunit alpha [Dietzia cinnamea P4]
 gi|319437394|gb|EFV92409.1| riboflavin synthase subunit alpha [Dietzia cinnamea P4]
          Length = 207

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 109/206 (52%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + ++       RLR+     TS    G SIA  G+CLTV          
Sbjct: 1   MFTGIVEELGTLESINRRGDSARLRIRGPLVTSDAGHGDSIAVNGVCLTVTDWE----TG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++V+V AET   T +A+   G  +NLER+++   R  GH+V GH+DGT  ++      
Sbjct: 57  GHFDVDVMAETLDRTALAALAPGDPVNLERAMRADARFGGHIVQGHVDGTGRVVSRVEHE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG-----KNFFDVLLIRHTIEETTWK 175
                R+SLP +L +++  KGS+ ++G SLTV+ V        +F+V LI  T+E T   
Sbjct: 117 HWHVLRISLPGDLARYVVEKGSITVSGTSLTVSAVSAPGEADAWFEVSLIPTTLEATILG 176

Query: 176 MHKVGDLINIEVDSMMRYIARLYALN 201
               GD +N+EVD + +Y+ RL    
Sbjct: 177 GLAHGDAVNLEVDVLAKYVERLLDGR 202


>gi|297195568|ref|ZP_06912966.1| riboflavin synthase subunit alpha [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721391|gb|EDY65299.1| riboflavin synthase subunit alpha [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 202

 Score =  188 bits (476), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEDLGDASRFRLRGPLVTEDAKHGDSIAVNGVCLTVVE-----TGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++     G+ +NLER   +G RL GH+V GH+DGT  ++      
Sbjct: 56  GEFTADVMAETLKRSSLGVLRAGSRVNLERPTAVGARLGGHIVQGHVDGTGTVVERTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP  L +++  KGS+ ++GVSLTV   G + F + LI  T+  TT  + + G
Sbjct: 116 NWEIVKISLPSGLARYVVEKGSITVDGVSLTVVDAGTDHFTISLIPTTLALTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ RL      +
Sbjct: 176 DPVNLEVDIIAKYVERLLGTQAEE 199


>gi|297155738|gb|ADI05450.1| riboflavin synthase subunit alpha [Streptomyces bingchenggensis
           BCW-1]
          Length = 209

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 76/202 (37%), Positives = 115/202 (56%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +    R  V     T   K G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEIVAVENLGDASRFLVSGPVVTEGAKHGDSIAVNGVCLTVVDFE-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GRFSADVMAETLNRSSLGALAVGSRVNLERPMALGGRLGGHLVQGHVDGTGTIVERKLSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G ++F V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPADLSRYVVEKGSITVDGISLTVVDAGPDYFTVSLIPTTLALTTLGVKQAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+EVD + +Y+ RL     
Sbjct: 176 DPVNLEVDVLAKYVERLLGKGA 197


>gi|127512120|ref|YP_001093317.1| riboflavin synthase subunit alpha [Shewanella loihica PV-4]
 gi|126637415|gb|ABO23058.1| riboflavin synthase, alpha subunit [Shewanella loihica PV-4]
          Length = 221

 Score =  187 bits (475), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 77/205 (37%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGSLRKIERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVE-----QM 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +G  +NLE++V    RL GH+VSGH+DG   +    + 
Sbjct: 56  ADGYVADISAETVALTGFAHYQVGQKVNLEKAVTPTTRLGGHMVSGHVDGVASVDDRQYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V    F + ++ HT  ETT    K 
Sbjct: 116 GKAIEFWLTPPKGLARYIAHKGSITIDGVSLTVNEVDGERFRLTIVPHTASETTLIDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL +   ++
Sbjct: 176 GDRVNIEVDLIARHLERLLSFQAAE 200


>gi|209548783|ref|YP_002280700.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534539|gb|ACI54474.1| riboflavin synthase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 203

 Score =  187 bits (475), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 107/203 (52%), Positives = 143/203 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + +++P+ +G+RLRV T+Y+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDVGTVESVSPLKEGIRLRVATAYDPATIDMGASISHSGICLTVTGLPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|329938906|ref|ZP_08288280.1| riboflavin synthase subunit alpha [Streptomyces griseoaurantiacus
           M045]
 gi|329301791|gb|EGG45684.1| riboflavin synthase subunit alpha [Streptomyces griseoaurantiacus
           M045]
          Length = 201

 Score =  187 bits (474), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   + G SIA  G+CLTVV    E    
Sbjct: 1   MFTGIVEELGEVTAVENLGDAARFRLRGPVVTEGAQHGDSIAVNGVCLTVVDHEGEE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++ +  +G+ +NLER   +G RL GH+V GH+DGT EIL      
Sbjct: 58  --FTADVMAETLTRSSLGALTVGSRVNLERPTAVGARLGGHIVQGHVDGTGEILARTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G+  F V LI  T+  TT    + G
Sbjct: 116 HWEIVKVSLPPDLARYVVEKGSITVDGISLTVVEAGEAHFTVSLIPTTLALTTLGRKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+ RL   +  
Sbjct: 176 DPVNLEVDIVAKYVERLLGADRE 198


>gi|262373930|ref|ZP_06067207.1| riboflavin synthase, alpha subunit [Acinetobacter junii SH205]
 gi|262310941|gb|EEY92028.1| riboflavin synthase, alpha subunit [Acinetobacter junii SH205]
          Length = 219

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 78/203 (38%), Positives = 118/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTVV        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVVEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQAVNVEKAMLPTTRFGGHIVSGHVDGLGEITLVRHDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSLYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|296122847|ref|YP_003630625.1| riboflavin synthase, subunit alpha [Planctomyces limnophilus DSM
           3776]
 gi|296015187|gb|ADG68426.1| riboflavin synthase, alpha subunit [Planctomyces limnophilus DSM
           3776]
          Length = 205

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/205 (37%), Positives = 112/205 (54%), Gaps = 4/205 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT----SKMKLGCSIAHAGICLTVVRLSEE 56
           MFTG+V  +G+I A+     G+R+ V              LG S+A  G CLTVV L  +
Sbjct: 1   MFTGLVEGMGQIEAVVSEPGGVRIVVSPPVQMLLPEDPAVLGESVAINGCCLTVVELQNQ 60

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
                 +  +  +ET   TN+ +   G  +NLER++K   R  GH+V GH+DGT  IL +
Sbjct: 61  GEPAEKWSFQAGSETLSKTNLGTLASGASVNLERAMKANARFGGHIVQGHVDGTARILSI 120

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
           D   D ++   +L   L + +  KGSV ++GVSLTV    ++ F V LI HT++ETT   
Sbjct: 121 DHEADWVFMAFALAPELARQLVPKGSVTVDGVSLTVVEAKRDGFSVALIPHTLKETTLGQ 180

Query: 177 HKVGDLINIEVDSMMRYIARLYALN 201
            +VGD +NIE D + +Y+ RL A  
Sbjct: 181 RQVGDTVNIETDILGKYVERLMAGR 205


>gi|125972629|ref|YP_001036539.1| riboflavin synthase subunit alpha [Clostridium thermocellum ATCC
           27405]
 gi|256004716|ref|ZP_05429692.1| riboflavin synthase, alpha subunit [Clostridium thermocellum DSM
           2360]
 gi|281416821|ref|ZP_06247841.1| riboflavin synthase, alpha subunit [Clostridium thermocellum JW20]
 gi|125712854|gb|ABN51346.1| riboflavin synthase, alpha subunit [Clostridium thermocellum ATCC
           27405]
 gi|255991309|gb|EEU01415.1| riboflavin synthase, alpha subunit [Clostridium thermocellum DSM
           2360]
 gi|281408223|gb|EFB38481.1| riboflavin synthase, alpha subunit [Clostridium thermocellum JW20]
 gi|316941133|gb|ADU75167.1| riboflavin synthase, alpha subunit [Clostridium thermocellum DSM
           1313]
          Length = 218

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 79/203 (38%), Positives = 117/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  + P  K ++L +        +K+G SIA  GICLTV  L      +
Sbjct: 1   MFTGIVEEIGLVKEIIPGNKSIKLTIKCEKIMDDVKVGDSIAVNGICLTVTSLD-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  +T R TN+ +   G  +NLER+++  DR+ GH+VSGHIDGT  IL  +   
Sbjct: 56  GAFTADVMPQTMRKTNLGNLRTGEKVNLERALRPVDRMGGHIVSGHIDGTGVILSKEEED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +S P ++ ++I V+GSV L+GVSLTV  V +  F V LI HT   T     K G
Sbjct: 116 NAIWLEISAPSDILKYIVVRGSVALDGVSLTVAYVDEKSFKVSLIPHTASVTILGSKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D INIE D + +Y+ +L   +  
Sbjct: 176 DRINIECDMLGKYVEKLMCFDRQ 198


>gi|21219945|ref|NP_625724.1| riboflavin synthase subunit alpha [Streptomyces coelicolor A3(2)]
 gi|256788955|ref|ZP_05527386.1| riboflavin synthase subunit alpha [Streptomyces lividans TK24]
 gi|289772843|ref|ZP_06532221.1| riboflavin synthase, alpha subunit [Streptomyces lividans TK24]
 gi|11493385|emb|CAC17561.1| putative riboflavin synthase [Streptomyces coelicolor A3(2)]
 gi|289703042|gb|EFD70471.1| riboflavin synthase, alpha subunit [Streptomyces lividans TK24]
          Length = 200

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 116/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A+  +    R RV     T   + G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEITAVETLDDACRFRVRGPAVTEGARHGDSIAVNGVCLTVVD-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   +++ +  +G+ +NLER   +G RL GH+V GH+DGT EIL      
Sbjct: 56  DAFTADVMAETLNRSSLGALAVGSRVNLERPTAVGARLGGHIVQGHVDGTGEILERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP +L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + G
Sbjct: 116 HWEIVKISLPADLARYVVEKGSITVDGISLTVVDAGPDFFTVSLIPTTLALTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+ RL     S
Sbjct: 176 DPVNLEVDVIAKYVERLLGAQGS 198


>gi|254392898|ref|ZP_05008066.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|294811514|ref|ZP_06770157.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|326440098|ref|ZP_08214832.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|197706553|gb|EDY52365.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
 gi|294324113|gb|EFG05756.1| riboflavin synthase subunit alpha [Streptomyces clavuligerus ATCC
           27064]
          Length = 211

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +  +    R R+     T   + G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGQVTGVETLGDSARFRLRGPLVTDGARHGDSIAVNGVCLTVVDHG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G  +NLER   +G RL GH+V GH+DG   I+      
Sbjct: 56  GEFTADVMAETLKRSSLGALAPGDRVNLERPTPVGGRLGGHVVQGHVDGVGTIVERAPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP  L +++  KGS+ ++GVSLTV  VG++ F V LI  T+  TT  +   G
Sbjct: 116 HWELVTVSLPAPLARYVVEKGSITVDGVSLTVVSVGEDRFTVSLIPTTLALTTLGVKGTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIEVD + +Y+ RL     +
Sbjct: 176 DPVNIEVDVIAKYVERLLGHRAA 198


>gi|56963576|ref|YP_175307.1| riboflavin synthase subunit alpha [Bacillus clausii KSM-K16]
 gi|56909819|dbj|BAD64346.1| riboflavin synthase alpha subunit RibB [Bacillus clausii KSM-K16]
          Length = 214

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 111/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+ +++   K M L V      +   +G SIA  G+CLTV  +SE     
Sbjct: 1   MFTGIIEEMGKVASVSKKGKAMTLAVNCKTVLADAAIGDSIAVNGVCLTVTAISE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +V  ET   T I     G F+NLER++ +G R  GH++SGH+DG   I     + 
Sbjct: 56  SQFQADVMPETYEATTIKQLVPGQFVNLERAMAVGSRFGGHIISGHVDGVGTIQKRQPVE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +     L ++I  KGS+ ++G SLTV  V    F + +I HT+E T     K G
Sbjct: 116 NAVLFEVEADRELVRYIVQKGSIAVDGTSLTVFAVTDTSFTISIIPHTLEMTIMGTKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ +L A   S
Sbjct: 176 DHVNLECDIIGKYVEKLLAPKES 198


>gi|121997690|ref|YP_001002477.1| riboflavin synthase subunit alpha [Halorhodospira halophila SL1]
 gi|121589095|gb|ABM61675.1| riboflavin synthase, alpha subunit [Halorhodospira halophila SL1]
          Length = 219

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 109/199 (54%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   G++ A+    +G  LR+       ++ ++G SIA  G CLT   +      
Sbjct: 1   MFTGIVETCGRVAAIEHSGEGRILRIDAPRLGLAECRIGDSIAVDGACLTATGIE----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  +V  ET R T +     G  +NLER+V     L GHLV+GH+DG  E++     
Sbjct: 56  DGQFRADVSDETLRCTTLGGLRSGVRVNLERAVTPSTPLGGHLVTGHVDGVGEVVERAPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   R  +P  L +++AVKGS+ + GVSLT+N V    F+V LI HT++ T     + 
Sbjct: 116 GGSERWRFRVPEGLARYVAVKGSIAVAGVSLTINAVAGREFEVNLIPHTLDATNLGERRA 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           GD +NIEVD + RY+ RL 
Sbjct: 176 GDPVNIEVDLVARYVERLL 194


>gi|239993721|ref|ZP_04714245.1| riboflavin synthase subunit alpha [Alteromonas macleodii ATCC
           27126]
          Length = 220

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +      +RL V +   + S + LG SIA  G+CLTV  +      
Sbjct: 1   MFTGIIQALGTIKKLDNRGNDIRLTVSSPTLDMSDVALGDSIATNGVCLTVTDMGP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  +V AET ++T  A +  G+ +NLE++++  DRL GH+VSGH+DG  E+  +   
Sbjct: 57  -DYYCADVSAETIKLTGFAHYSAGSTVNLEKAMRPSDRLGGHIVSGHVDGVGEVTQIIKH 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D +   +  P  L ++IA KGS+ ++G+SLTVN V    F + +I HT++ET    +KV
Sbjct: 116 SDYVEFWVKAPEALAKYIAHKGSITVDGISLTVNEVNGAEFMLWIIPHTLQETIMGSYKV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTAVNLEVDVIARYLERLMLGDKA 199


>gi|169830808|ref|YP_001716790.1| riboflavin synthase subunit alpha [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637652|gb|ACA59158.1| riboflavin synthase, alpha subunit [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 215

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +          RL +         +LG SIA  G+CLTV          
Sbjct: 1   MFTGIIEELGTLRRAERGPASARLHIEARTVLEDARLGESIAVNGVCLTVADFG-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+  +V AET + TN+     G  +NLER+++LG+RL GHLVSGH+DG   ++  +  G
Sbjct: 56  GWFTADVMAETLKRTNLGEVRPGERVNLERAMRLGERLGGHLVSGHVDGVGTVVGCEPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++  R+  P  + +++  KGSV ++G+SLTV    +  F V +I HT + TT    + G
Sbjct: 116 IALVFRIQAPEGVMRYVIEKGSVAVDGISLTVVDHDRETFRVSIIPHTAQMTTLGFKRAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +N+E D + +Y+ R+      +
Sbjct: 176 ARVNLEADMIAKYVERMLGGRREE 199


>gi|325124199|gb|ADY83722.1| riboflavin synthase alpha chain [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 219

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYEVTAPAELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|262280658|ref|ZP_06058441.1| riboflavin synthase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257558|gb|EEY76293.1| riboflavin synthase subunit alpha [Acinetobacter calcoaceticus
           RUH2202]
          Length = 219

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT + T     +VG
Sbjct: 116 RSIYYEVTAPAELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAKRTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|254516857|ref|ZP_05128915.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR5-3]
 gi|219674362|gb|EED30730.1| riboflavin synthase, alpha subunit [gamma proteobacterium NOR5-3]
          Length = 221

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/200 (37%), Positives = 111/200 (55%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +RLR+ T   +   + +G SIA  G+CLTV  L      
Sbjct: 1   MFTGIIQAVGTVAAQQPSGGDLRLRIQTGKLSLDDVAIGDSIATNGVCLTVTEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T +     G+ +NLE+S+    RL GH+VSGH+DG  EI+ L   
Sbjct: 56  GDGFWADVSRETLSLTTLGGLSQGSPVNLEKSLTPQSRLGGHIVSGHVDGLGEIVSLKED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P+ L ++I  KGS+C++G SLTVN V    FD+ +I  T+ ET +  +  
Sbjct: 116 ARSWRIVVRAPYELAKYIVHKGSICIDGTSLTVNAVDGANFDLNIIPQTMAETLFAHYSP 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ RL  
Sbjct: 176 GSRVNLEVDVIARYLERLLQ 195


>gi|323138568|ref|ZP_08073636.1| riboflavin synthase, alpha subunit [Methylocystis sp. ATCC 49242]
 gi|322396202|gb|EFX98735.1| riboflavin synthase, alpha subunit [Methylocystis sp. ATCC 49242]
          Length = 199

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+I+A+ P  +  RLR+  +Y+   + LG SIA AG CLTVV ++ E +  
Sbjct: 1   MFTGIVTDIGEIVAVEPRGELRRLRIACNYDADGIALGASIACAGTCLTVVAVAREGAR- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++V+  AET   T +  W +GT INLER++++GD L GH+V+GHIDG   I+  D   
Sbjct: 60  TVFDVDAAAETLARTTVGIWAVGTRINLERALRIGDELGGHIVTGHIDGIARIMSRDDFD 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +  PH L +F+A KGSV L+G SLTVN V  + F +LLI HT+  TT+   K G
Sbjct: 120 GMARYWIETPHELSRFVAQKGSVALDGASLTVNEVEGDRFSILLIPHTLAVTTFGARKAG 179

Query: 181 DLINIEVDSMMRYIARL 197
           D +NIEVD M RY ARL
Sbjct: 180 DALNIEVDLMARYAARL 196


>gi|209964641|ref|YP_002297556.1| riboflavin synthase subunit alpha [Rhodospirillum centenum SW]
 gi|209958107|gb|ACI98743.1| riboflavin synthase, alpha subunit [Rhodospirillum centenum SW]
          Length = 196

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G + A+       R  + T Y+T+ + LG SIA  G CLTVV L     + 
Sbjct: 1   MFTGIITDVGHVAAIERRGDT-RFTIGTRYDTAAIDLGASIACNGCCLTVVEL-----LP 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET   T +  W +GT +NLER+++LGD L GH+VSGH+DG  E+L +   G
Sbjct: 55  GAFRVDASGETLSKTTLGDWQVGTPVNLERALRLGDELGGHIVSGHVDGVAEVLSVVPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS   R  +P  L +FIA KGSV L+GVSLTVN V    F V +I HT   TT+   + G
Sbjct: 115 DSTRWRFRVPDALARFIAPKGSVALDGVSLTVNEVDGPVFGVNIIPHTRAHTTFGTLRPG 174

Query: 181 DLINIEVDSMMRYIARL 197
             +N+EVD + RY+ARL
Sbjct: 175 GRVNMEVDMLARYVARL 191


>gi|169659026|dbj|BAG12722.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 100/203 (49%), Positives = 136/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVARQFMPFIFNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+AL   
Sbjct: 181 DRVNLEIDQLARYAAKLFALKRE 203


>gi|77461239|ref|YP_350746.1| riboflavin synthase subunit alpha [Pseudomonas fluorescens Pf0-1]
 gi|77385242|gb|ABA76755.1| riboflavin synthase alpha chain [Pseudomonas fluorescens Pf0-1]
          Length = 220

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T +     G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLDCTAMNDLKSGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVSRSDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F + +I HT+ ET    +K 
Sbjct: 116 ARAVEFRIRAPKELAKYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|159184646|ref|NP_354187.2| riboflavin synthase subunit alpha [Agrobacterium tumefaciens str.
           C58]
 gi|159139944|gb|AAK86972.2| riboflavin synthase alpha chain [Agrobacterium tumefaciens str.
           C58]
          Length = 203

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 103/203 (50%), Positives = 141/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G +  +  + +G+RLRV T+Y+   + +G SI+H G+CLTV +L ++ S +
Sbjct: 1   MFTGIVTDVGTVSELEALPEGVRLRVATNYDPKTIDMGASISHGGVCLTVTKLPDDGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            WYEVE W E  R+T IA W  GT +NLER++K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWYEVEAWEEALRLTTIAGWRQGTHVNLERALKIGDELGGHIVSGHVDGRAEILSVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRHT+  TTW   + G
Sbjct: 121 EAVRIRLRAPEHLAKFVAPKGSVALDGTSLTVNAVEGTDFDVLLIRHTLAVTTWGERQPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|332652828|ref|ZP_08418573.1| riboflavin synthase, alpha subunit [Ruminococcaceae bacterium D16]
 gi|332517974|gb|EGJ47577.1| riboflavin synthase, alpha subunit [Ruminococcaceae bacterium D16]
          Length = 215

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 112/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I ++        L +      S +K+G S+A  G+CLT   +       
Sbjct: 1   MFTGIVEELGSIRSVRRGQHSSVLSIAAKDILSDLKVGDSVAVNGVCLTATTVD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +++ S  +G+ +NLER++    R  GH+VSGHIDGT  I  L    
Sbjct: 56  SGFTADVMHETLNRSSLGSLTVGSHVNLERAMAANGRFGGHIVSGHIDGTGTITALRKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +S    L ++I  KGS+ ++G+SLTV  VG+++F +  I HT+  TT    + G
Sbjct: 116 NAVWYTISASQELLRYIVEKGSIAIDGISLTVAEVGESWFSISAIPHTVAVTTLGEKRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L      +
Sbjct: 176 DTVNLENDVIGKYVEKLLRPQPQE 199


>gi|219871321|ref|YP_002475696.1| riboflavin synthase subunit alpha [Haemophilus parasuis SH0165]
 gi|219691525|gb|ACL32748.1| riboflavin synthase subunit alpha [Haemophilus parasuis SH0165]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +    +   L +  S   + M LG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGKVAKIHKQGEFAVLTITGSKIFTDMHLGDSIAVNGVCLTVTEFG-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET   T++      + +NLER++    R  GH+VSGHIDGT EI+ +    
Sbjct: 56  NHFSADVMSETLARTSLGELQPNSPVNLERAMAANGRFGGHIVSGHIDGTGEIVSITPAN 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S++ ++     L ++I  KGS+ ++G+SLTV    +N F   +I HT+ ET     KVG
Sbjct: 116 NSVWYQIKTTAKLMRYIIEKGSITIDGISLTVVDCDENSFRASIIPHTLSETNLGTKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            ++N+E D + +Y+ +L +   S+
Sbjct: 176 SIVNLENDVIGKYVEKLLSPKQSE 199


>gi|308048549|ref|YP_003912115.1| riboflavin synthase, alpha subunit [Ferrimonas balearica DSM 9799]
 gi|307630739|gb|ADN75041.1| riboflavin synthase, alpha subunit [Ferrimonas balearica DSM 9799]
          Length = 217

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 81/205 (39%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  + P    +RL V T       ++LG SIA  G+CLTVV    EH  
Sbjct: 1   MFTGIIEAVGTLRKLEPRGGDLRLTVATGKLPMEDVQLGDSIATNGVCLTVVEKGAEH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V AET  +TN   + +G  +NLER+V    RL GHLVSGH+DG+ E++  +  
Sbjct: 59  ---YVADVSAETLALTNFPHYAVGHKVNLERAVTPSTRLGGHLVSGHVDGSAEVVARENR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   L  P  L +++  KGSV ++GVSLT+N V    F + ++ HT +ETT    +V
Sbjct: 116 ARAIEFWLQAPAELARYLPHKGSVTIDGVSLTLNEVDGARFRLTIVPHTAQETTLLDLQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +N+EVD + RY+ RL     +Q
Sbjct: 176 GDRVNLEVDLLARYLERLMQPAPTQ 200


>gi|325068551|ref|ZP_08127224.1| riboflavin synthase subunit alpha [Actinomyces oris K20]
          Length = 219

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 74/218 (33%), Positives = 110/218 (50%), Gaps = 19/218 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++ +  +    RL V     T  + LG S++  G CLTV  +       
Sbjct: 1   MFTGIVEELGRVVRLETVEDSARLTVEAPTVTQDVNLGDSVSVNGCCLTVTAV-----HG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++ AET   T + S   G  +NLER+++  DRL GH+V GH+D T E+L      
Sbjct: 56  STFTADLMAETLTRTTLGSQAPGDPVNLERALRASDRLGGHIVQGHVDATAEVLDHHHGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV--------------GKNFFDVLLIR 166
                R+ LP  + +++AVKGSV L+GVSLTV  V                    V LI 
Sbjct: 116 HWDLLRIGLPQEIARYVAVKGSVALDGVSLTVVDVVDASSTLDVAPVPGAGASLSVGLIP 175

Query: 167 HTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            T+  TT    + G+ +N+EVD + +Y  RL     SQ
Sbjct: 176 ETLRRTTLGSRRPGERVNLEVDVLAKYAERLLGARPSQ 213


>gi|302533294|ref|ZP_07285636.1| riboflavin synthase, alpha subunit [Streptomyces sp. C]
 gi|302442189|gb|EFL14005.1| riboflavin synthase, alpha subunit [Streptomyces sp. C]
          Length = 207

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A+  R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLAEASRFRLRGPVVTEGAKHGDSIAVNGVCLTVVE-----TED 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  GEFTADVMQETLNRSSLGALAAGSRVNLERPMALGGRLGGHLVQGHVDGTGRIISRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++SLP NL +++  KGS+ ++GVSLTV     ++F + LI  T+  TT  + + G
Sbjct: 116 HWEIVKVSLPENLARYVVEKGSITVDGVSLTVVEAAADYFTISLIPTTLALTTLGIKQSG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ RL A
Sbjct: 176 DPVNLEVDVLAKYVERLLA 194


>gi|169659028|dbj|BAG12723.1| riboflavin synthase [Bartonella grahamii]
 gi|169659030|dbj|BAG12724.1| riboflavin synthase [Bartonella grahamii]
 gi|169659032|dbj|BAG12725.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 100/203 (49%), Positives = 136/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVARQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+AL   
Sbjct: 181 DRVNLEIDQLARYAAKLFALKRE 203


>gi|293610034|ref|ZP_06692335.1| riboflavin synthase [Acinetobacter sp. SH024]
 gi|292827266|gb|EFF85630.1| riboflavin synthase [Acinetobacter sp. SH024]
          Length = 219

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYEVTAPTELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|317470713|ref|ZP_07930098.1| riboflavin synthase [Anaerostipes sp. 3_2_56FAA]
 gi|316901848|gb|EFV23777.1| riboflavin synthase [Anaerostipes sp. 3_2_56FAA]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 59/204 (28%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G ++++    +   +R+  S     +  G SIA  G+CLT V    +    
Sbjct: 1   MFTGIIEELGTVLSVKRGGQSSAVRIGASRVLEDIHTGDSIAVNGVCLTAVTFDGQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ +   G  +NLER+++ G R  GH+V+GH+DGT  +  +    
Sbjct: 57  -GFLADVMNETFERSSLENLKPGDPVNLERAMRAGGRFGGHIVAGHVDGTGTVTSVKQDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +  P  + ++   KGS+ ++G+SLT+   G  +F V +I HT++ET     K G
Sbjct: 116 NAVWFTVKAPPGIMRYCIKKGSIAVDGISLTIADTGDQWFQVSVIPHTLKETVLGYKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L      +
Sbjct: 176 DPVNLENDMIGKYVEKLMQPEHGE 199


>gi|167855406|ref|ZP_02478172.1| riboflavin synthase alpha chain [Haemophilus parasuis 29755]
 gi|167853472|gb|EDS24720.1| riboflavin synthase alpha chain [Haemophilus parasuis 29755]
          Length = 214

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +    +   L +  S   + M LG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGKVAKIHKQGEFAVLTITGSKIFTDMHLGDSIAVNGVCLTVTEFG-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET   T++      + +NLER++    R  GH+VSGHIDGT EI+ +    
Sbjct: 56  NHFSADVMSETLARTSLGELQPNSPVNLERAMAANGRFGGHIVSGHIDGTGEIVSITPAN 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S++ ++     L ++I  KGS+ ++G+SLTV    +N F   +I HT+ ET     KVG
Sbjct: 116 NSVWYQIKTTAKLMRYIIEKGSITIDGISLTVVDCDENSFRASIIPHTLSETNLGTKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            ++N+E D + +Y+ +L +   S+
Sbjct: 176 SIVNLENDVIGKYVEKLLSPKQSE 199


>gi|322420506|ref|YP_004199729.1| riboflavin synthase subunit alpha [Geobacter sp. M18]
 gi|320126893|gb|ADW14453.1| riboflavin synthase, alpha subunit [Geobacter sp. M18]
          Length = 214

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+++++        L V TS    ++++G SIA  G CLTVVR        
Sbjct: 1   MFTGLIETVGELVSIERRGASGSLTVKTSLPLDEIEIGASIAINGACLTVVRKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET   T       G+ +N+ER+++L DRLDGHLVSGH+D    +     + 
Sbjct: 56  GTVTFDVSPETIDRTAFKHLKSGSPVNMERAMRLSDRLDGHLVSGHVDCIAAVTERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++      P    ++IA KGSV ++G+SLTVN VG + F V +I HT  +TT    ++G
Sbjct: 116 NNIIFSFRFPVEFAKYIAAKGSVAIDGISLTVNSVGPDSFSVNVIPHTAAKTTLLSRRIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIE D + RY+ RL A   ++
Sbjct: 176 DEVNIETDLLCRYLERLLAGRETR 199


>gi|260551095|ref|ZP_05825299.1| riboflavin synthase subunit alpha [Acinetobacter sp. RUH2624]
 gi|260405862|gb|EEW99350.1| riboflavin synthase subunit alpha [Acinetobacter sp. RUH2624]
          Length = 219

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPITRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|299771885|ref|YP_003733911.1| riboflavin synthase subunit alpha [Acinetobacter sp. DR1]
 gi|298701973|gb|ADI92538.1| riboflavin synthase subunit alpha [Acinetobacter sp. DR1]
          Length = 219

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYYDVTAPTELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|162286754|ref|YP_001083300.2| riboflavin synthase subunit alpha [Acinetobacter baumannii ATCC
           17978]
 gi|169797508|ref|YP_001715301.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AYE]
 gi|184156568|ref|YP_001844907.1| riboflavin synthase subunit alpha [Acinetobacter baumannii ACICU]
 gi|213155678|ref|YP_002317723.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii AB0057]
 gi|215484943|ref|YP_002327184.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           AB307-0294]
 gi|239502076|ref|ZP_04661386.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB900]
 gi|260556400|ref|ZP_05828619.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii ATCC
           19606]
 gi|301346212|ref|ZP_07226953.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB056]
 gi|301512961|ref|ZP_07238198.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB058]
 gi|301595092|ref|ZP_07240100.1| riboflavin synthase subunit alpha [Acinetobacter baumannii AB059]
 gi|332851508|ref|ZP_08433505.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332866792|ref|ZP_08437196.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332874948|ref|ZP_08442799.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6014059]
 gi|169150435|emb|CAM88332.1| riboflavin synthase alpha chain [Acinetobacter baumannii AYE]
 gi|183208162|gb|ACC55560.1| Riboflavin synthase alpha chain [Acinetobacter baumannii ACICU]
 gi|193076095|gb|ABO10698.2| riboflavin synthase alpha chain [Acinetobacter baumannii ATCC
           17978]
 gi|213054838|gb|ACJ39740.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii AB0057]
 gi|213987419|gb|ACJ57718.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           AB307-0294]
 gi|260410455|gb|EEX03754.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii ATCC
           19606]
 gi|322506455|gb|ADX01909.1| ribC [Acinetobacter baumannii 1656-2]
 gi|323516334|gb|ADX90715.1| riboflavin synthase subunit alpha [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332729961|gb|EGJ61292.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013150]
 gi|332734400|gb|EGJ65520.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6013113]
 gi|332736891|gb|EGJ67867.1| riboflavin synthase, alpha subunit [Acinetobacter baumannii
           6014059]
          Length = 219

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|116251388|ref|YP_767226.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256036|emb|CAK07117.1| putative riboflavin synthase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 204

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 109/203 (53%), Positives = 143/203 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++P+ +G++LRV TSY+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 2   MFTGIVTDIGTIESVSPLKEGIKLRVATSYDPATIDMGASISHSGICLTVTGLPQEGSNG 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 62  RWFEVEAWEEALRLTTIGAWQEGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTAEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 122 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 181

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 182 DFVNFEVDTMARYAARLAEFPST 204


>gi|327190086|gb|EGE57201.1| riboflavin synthase protein, alpha chain [Rhizobium etli CNPAF512]
          Length = 203

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 108/203 (53%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G +  ++P+ +G+RLRV T+Y+ S + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDVGTVEFVSPLKEGIRLRVATAYDPSTIDMGASISHSGICLTVTGLPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWQQGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|271964338|ref|YP_003338534.1| riboflavin synthase [Streptosporangium roseum DSM 43021]
 gi|270507513|gb|ACZ85791.1| Riboflavin synthase [Streptosporangium roseum DSM 43021]
          Length = 202

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 110/199 (55%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A+ P+    R+ +     T+    G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEELGEIAAIEPLRDAARMSIRGKVVTADAGHGDSIAVNGVCLTVVEVD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + + +   G+  NLER+V+   RL GH+V GH+DGT  +L  +   
Sbjct: 56  EVFTADVMKETLDRSCLGALRPGSRANLERAVRADQRLGGHIVQGHVDGTGVLLSREPDE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SLP  L +++  KGS+ ++GVSLTV  V  + F V LI  T++ TT    + G
Sbjct: 116 HWEVVRFSLPAELNRYVVEKGSIAVDGVSLTVVGVDGSGFAVSLIPTTLQLTTLGAKQPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +++ +L  
Sbjct: 176 DPVNLEVDVIAKHVEKLVG 194


>gi|333028401|ref|ZP_08456465.1| putative riboflavin synthase, alpha subunit [Streptomyces sp.
           Tu6071]
 gi|332748253|gb|EGJ78694.1| putative riboflavin synthase, alpha subunit [Streptomyces sp.
           Tu6071]
          Length = 206

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVVE-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GH+V GH+DGT  IL  +   
Sbjct: 56  AEFTADVMAETLKRSSLGALAPGSRVNLERPTPVGGRLGGHVVQGHVDGTGTILRREPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV     + F V LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEATDDTFSVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + +Y+ R+    T+
Sbjct: 176 APVNLEVDVLAKYVERMLRYGTA 198


>gi|167746302|ref|ZP_02418429.1| hypothetical protein ANACAC_01011 [Anaerostipes caccae DSM 14662]
 gi|167654295|gb|EDR98424.1| hypothetical protein ANACAC_01011 [Anaerostipes caccae DSM 14662]
          Length = 214

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 59/204 (28%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G ++++    +   +R+  S     +  G SIA  G+CLT V    +    
Sbjct: 1   MFTGIIEELGTVLSVKRGGQSSAVRIGASRVLEDIHTGDSIAVNGVCLTAVTFDGQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ +   G  +NLER+++ G R  GH+V+GH+DGT  +  +    
Sbjct: 57  -GFLADVMNETFEKSSLENLKPGDPVNLERAMRAGGRFGGHIVAGHVDGTGTVTSVKQDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +  P  + ++   KGS+ ++G+SLT+   G  +F V +I HT++ET     K G
Sbjct: 116 NAVWFTVKAPPGIMRYCIKKGSIAVDGISLTIADTGDQWFQVSVIPHTLKETVLGYKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L      +
Sbjct: 176 DPVNLENDMIGKYVEKLMQPEHGE 199


>gi|318057035|ref|ZP_07975758.1| riboflavin synthase subunit alpha [Streptomyces sp. SA3_actG]
 gi|318078666|ref|ZP_07985998.1| riboflavin synthase subunit alpha [Streptomyces sp. SA3_actF]
          Length = 206

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVVE-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GHLV GH+DGT  IL  +   
Sbjct: 56  AEFTADVMAETLKRSSLGALAPGSRVNLERPTPVGGRLGGHLVQGHVDGTGTILRREPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV     + F V LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEATDDTFSVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + +Y+ R+    T+
Sbjct: 176 APVNLEVDVLAKYVERMLRYGTA 198


>gi|317124750|ref|YP_004098862.1| riboflavin synthase, subunit alpha [Intrasporangium calvum DSM
           43043]
 gi|315588838|gb|ADU48135.1| riboflavin synthase, alpha subunit [Intrasporangium calvum DSM
           43043]
          Length = 203

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 71/207 (34%), Positives = 105/207 (50%), Gaps = 8/207 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +    +   LR+      +    G SIA  G+CLTV          
Sbjct: 1   MFTGIVEELGTVGTIESSPESAVLRIEGPLVAADAAHGDSIAVNGVCLTVTSHD-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET R +++ +   G  +NLER++    R  GH+V GH+DGT  I+      
Sbjct: 56  GGFSVDVMAETLRRSSLGALRPGDPVNLERAMAASGRFGGHVVQGHVDGTATIVERVPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  SLP  L +++  KGS+ ++GVSLTV  V    F V LI  T+  TT     VG
Sbjct: 116 RWEVVTFSLPGQLVRYVVEKGSITVDGVSLTVTAVDGATFSVSLIPTTLGATTLGHKGVG 175

Query: 181 DLINIEVDSMMRYIARLY---ALNTSQ 204
           D +N+EVD + +Y+  L    AL+  +
Sbjct: 176 DPVNLEVDVLAKYVESLLRHGALSKEE 202


>gi|332141885|ref|YP_004427623.1| riboflavin synthase subunit alpha [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551907|gb|AEA98625.1| riboflavin synthase subunit alpha [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 220

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 119/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +      +RL V +   + S + LG SIA  G+CLTV  +      
Sbjct: 1   MFTGIIQALGTIKKLDNRGNDIRLTVSSPTLDMSDVALGDSIATNGVCLTVTDMG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  +V AET ++T  A +  G+ +NLE++++  DR  GH+VSGH+DG  E+  +   
Sbjct: 56  ADYYCADVSAETIKLTGFAHYSAGSTVNLEKAMRPTDRFGGHIVSGHVDGVGEVTQIIKH 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D +   +  P  + ++IA KGS+ ++G+SLTVN V    F + +I HT++ET    +KV
Sbjct: 116 SDYVEFWVKAPEAIAKYIAHKGSITVDGISLTVNEVNGAEFMLWIIPHTLQETIMGSYKV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTAVNLEVDVIARYLERLMLGDKA 199


>gi|163759205|ref|ZP_02166291.1| putative riboflavin synthase [Hoeflea phototrophica DFL-43]
 gi|162283609|gb|EDQ33894.1| putative riboflavin synthase [Hoeflea phototrophica DFL-43]
          Length = 204

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 102/201 (50%), Positives = 139/201 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG++ A++P  +G+RLR+ TS++ + + +G SIA +G+CLTV  L E     
Sbjct: 1   MFTGIITDIGRLAAISPRDQGIRLRIETSWDPATIDIGASIACSGVCLTVTGLPEAGETA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +WG GT INLERS+++GD L GH+V+GH+DG  +++ +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGAWGEGTRINLERSLRIGDELGGHMVTGHVDGMADLVSVKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++    L  P  L +FIA KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EARRFTLRAPDGLARFIAPKGSVALDGTSLTVNGVEGADFDVLLIRHSLEVTTWADRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+EVD M RY ARL  ++
Sbjct: 181 DRINLEVDQMARYAARLTEMS 201


>gi|222085510|ref|YP_002544040.1| riboflavin synthase [Agrobacterium radiobacter K84]
 gi|221722958|gb|ACM26114.1| riboflavin synthase [Agrobacterium radiobacter K84]
          Length = 207

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 107/200 (53%), Positives = 139/200 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG + +++P+ +G++LRV+T+Y+ + + +G SI+H+GICLTV  L E  S  
Sbjct: 2   MFTGIVTDIGTVESVSPLKEGIKLRVVTNYDPATIDMGASISHSGICLTVTGLPEAGSNG 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I  W  G+ INLERS+K+GD L GH+VSGH+DG  EIL     G
Sbjct: 62  RWFEVEAWEEALRLTTIGKWQAGSNINLERSLKIGDELGGHIVSGHVDGKAEILSATEEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 122 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERKAG 181

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N EVD+M RY ARL   
Sbjct: 182 DFVNFEVDTMARYAARLAEF 201


>gi|294648977|ref|ZP_06726425.1| riboflavin synthase subunit alpha [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825112|gb|EFF83867.1| riboflavin synthase subunit alpha [Acinetobacter haemolyticus ATCC
           19194]
          Length = 219

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 118/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQAVNVEKAMLPTTRFGGHIVSGHVDGLGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSLYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 TKVNLEVDVLARYIERLLLGDKA 198


>gi|325292543|ref|YP_004278407.1| Riboflavin synthase alpha chain [Agrobacterium sp. H13-3]
 gi|325060396|gb|ADY64087.1| Riboflavin synthase alpha chain [Agrobacterium sp. H13-3]
          Length = 203

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 104/203 (51%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G +  +  +A+G+RLRV T+Y+   + +G SI+H G+CLTV +L E+ S +
Sbjct: 1   MFTGIVTDVGTVSELEALAEGIRLRVATNYDPKTIDMGASISHGGVCLTVTKLPEDGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            WYEVE W E  R+T IA W  GT +NLER++K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWYEVEAWEEALRLTTIAGWQKGTHVNLERALKIGDELGGHIVSGHVDGKAEILSVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+  TTW   + G
Sbjct: 121 EAVRIRLRAPDHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLTVTTWGERQPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|296269351|ref|YP_003651983.1| riboflavin synthase subunit alpha [Thermobispora bispora DSM 43833]
 gi|296092138|gb|ADG88090.1| riboflavin synthase, alpha subunit [Thermobispora bispora DSM
           43833]
          Length = 199

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 74/200 (37%), Positives = 111/200 (55%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++A+        RL V     T+    G SIA  G+CLTV  LS     
Sbjct: 1   MFTGIVEELGEVVALERGGGASARLAVRGPVVTAGAAAGDSIAVNGVCLTVTGLS----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   +++ +   G+ +NLER+V  G RL GH+V GH+DG   +L  +  
Sbjct: 56  GDVFTADVMKETLDRSSLGALEPGSPVNLERAVPAGGRLGGHIVQGHVDGVGTVLSREPG 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +    R SLP  L +++  KGS+ ++GVSLTV     + F V LI  T+E TT    + 
Sbjct: 116 DNWEIVRFSLPPALSRYVVEKGSIAVDGVSLTVVEAAGDSFTVSLIPTTLELTTLGRKRP 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           GD +N+EVD + +Y+ RL  
Sbjct: 176 GDPVNLEVDVIAKYVERLLE 195


>gi|169634647|ref|YP_001708383.1| riboflavin synthase subunit alpha [Acinetobacter baumannii SDF]
 gi|169153439|emb|CAP02581.1| riboflavin synthase alpha chain [Acinetobacter baumannii]
          Length = 219

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDGVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SQVNLEVDVLARYIERLLLGDKA 198


>gi|220934732|ref|YP_002513631.1| riboflavin synthase, alpha subunit [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996042|gb|ACL72644.1| riboflavin synthase, alpha subunit [Thioalkalivibrio sp. HL-EbGR7]
          Length = 220

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 80/199 (40%), Positives = 121/199 (60%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++  + P     RLR+ T   + S ++LG SIA  G+CLT V L      
Sbjct: 1   MFTGIIQAVGEVAGIEPRGGDCRLRIRTGKLDLSDVQLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T++ + G G+ +NLE+++    RL GHLVSGH+DG  E+L L   
Sbjct: 56  GDGFVADVSGETLSLTSLGALGKGSAVNLEKALTPTTRLGGHLVSGHVDGLGEVLSLKDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   +  P  L ++IA KGS+C++GVSLTVN V    F V ++ HT +ETT + ++ 
Sbjct: 116 GRSVRYEIRAPAGLARYIAPKGSICMDGVSLTVNRVDGAVFSVNIVPHTQQETTIRFYRA 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTRVNLEVDLIARYLERLL 194


>gi|254448034|ref|ZP_05061498.1| riboflavin synthase, alpha subunit [gamma proteobacterium HTCC5015]
 gi|198262460|gb|EDY86741.1| riboflavin synthase, alpha subunit [gamma proteobacterium HTCC5015]
          Length = 219

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 113/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A       +RL + T       ++LG SIA  G+CLT V L     +
Sbjct: 1   MFTGIIQAVGRVAAAENKGGDLRLHIDTADLPMEGVELGDSIAVNGVCLTAVDL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  +V  ET  +T++A  G G  +NLE+++       GH+VSGH+DG  E++     
Sbjct: 56  DRGFWADVSRETLNLTSLAGIGAGRRVNLEKAMTPTTHFGGHIVSGHVDGLGEVVSRHSD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    L  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+E T    ++ 
Sbjct: 116 GRSERFVLRAPDELARYIAKKGSITVDGTSLTVNEVKGADFELNIVPHTLEHTIMGDYQA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GSKVNLEVDVVARYLERLLLGDKA 199


>gi|118587986|ref|ZP_01545396.1| riboflavin synthase subunit alpha [Stappia aggregata IAM 12614]
 gi|118439608|gb|EAV46239.1| riboflavin synthase subunit alpha [Stappia aggregata IAM 12614]
          Length = 203

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 99/203 (48%), Positives = 128/203 (63%), Gaps = 1/203 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I+A+  I  GMR R+ T+Y+T    +G SI+ AG+C TV       S  
Sbjct: 1   MFTGIVTDLGEILAIDKIPAGMRTRIRTAYDTESFDIGASISCAGVCHTVTAKDN-GSNG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EVE  AET  +TN+A+W +G  +NLERS+ +G  L GHLV GH+DG   +   +   
Sbjct: 60  NWFEVESAAETLALTNVAAWKVGQKLNLERSLTMGAELGGHLVLGHVDGLATVTKREDHP 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+Y +   P     FIA KGSV L+G SLTVN V    F V LI HT+E TTW   +VG
Sbjct: 120 DSVYFQFEAPAEAAPFIAKKGSVALDGTSLTVNEVDGLLFSVFLIPHTLEVTTWSDRQVG 179

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D IN+EVD M RY ARL   + +
Sbjct: 180 DKINLEVDMMARYAARLAEFSKT 202


>gi|119774154|ref|YP_926894.1| riboflavin synthase subunit alpha [Shewanella amazonensis SB2B]
 gi|119766654|gb|ABL99224.1| riboflavin synthase, alpha subunit [Shewanella amazonensis SB2B]
          Length = 217

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++  +      +RL V +   + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGQLRRIDRKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVVEC-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET ++T    +  G  +NLE++V    RL GHLVSGH+DG   ++    +
Sbjct: 56  ADGYVADVSAETVKLTGFGDYRPGQAVNLEKAVTPTTRLGGHLVSGHVDGRAMVVSRSHL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L  P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT     V
Sbjct: 116 GKAIEFWLEAPAELARYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLAV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +N+EVD + RY+ RL      
Sbjct: 176 GDKVNLEVDQIARYLERLMQRGEE 199


>gi|262376971|ref|ZP_06070197.1| riboflavin synthase, alpha subunit [Acinetobacter lwoffii SH145]
 gi|262308009|gb|EEY89146.1| riboflavin synthase, alpha subunit [Acinetobacter lwoffii SH145]
          Length = 219

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 75/203 (36%), Positives = 117/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+   E     
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIDWGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T + +W  G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGTWKAGQPVNVEKAMLPTTRFGGHIVSGHVDAVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGSV ++G+SLT+N +  +   + LI HT E T     KVG
Sbjct: 116 RSIYYEVTAPAEIAKYLAEKGSVTVDGISLTINHLRGSVISLNLIPHTAERTNIGTWKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|254386272|ref|ZP_05001581.1| riboflavin synthase subunit alpha [Streptomyces sp. Mg1]
 gi|194345126|gb|EDX26092.1| riboflavin synthase subunit alpha [Streptomyces sp. Mg1]
          Length = 209

 Score =  184 bits (466), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 117/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +A+  R R+     T   K G SIA  G+CLTVV      + D
Sbjct: 1   MFTGIVEELGEVTAVEQLAEASRFRLRGPVVTEGAKHGDSIAVNGVCLTVVE-----TAD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ + G G+ +NLER + LG RL GHLV GH+DGT EIL      
Sbjct: 56  GEFTADVMQETLNRSSLGTLGQGSRVNLERPMALGGRLGGHLVQGHVDGTGEILSRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                +++LP +L +++  KGS+ ++GVSLTV     + F + LI  T+  TT  + + G
Sbjct: 116 HWELVKVALPAHLARYVVEKGSITVDGVSLTVVEAAADHFTISLIPTTLALTTLGIKQPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ RL A
Sbjct: 176 DPVNLEVDVLAKYVERLLA 194


>gi|296133285|ref|YP_003640532.1| riboflavin synthase, alpha subunit [Thermincola sp. JR]
 gi|296031863|gb|ADG82631.1| riboflavin synthase, alpha subunit [Thermincola potens JR]
          Length = 219

 Score =  184 bits (466), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 80/204 (39%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  M   A   RL +        +KLG SIA  GICLTV   +     +
Sbjct: 1   MFTGIVEELGVLKGMKKGADSARLTIQAEKVLQDVKLGDSIAVNGICLTVTEFN-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++ V+V AET R TN+     G F+NLER++++GDRL GH+VSGHIDG   I+      
Sbjct: 56  RFFSVDVMAETLRRTNLLDLQPGNFVNLERALRVGDRLGGHIVSGHIDGVGTIIRQQRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   +  P  + ++I  KGSV ++G+SLTV       F V LI HT + TT    K G
Sbjct: 116 IAIITEIEAPPEVMKYILTKGSVAVDGISLTVVNHTDRTFVVSLIPHTAKMTTLGYKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + RY+ RL   +  +
Sbjct: 176 DKVNLESDIIGRYVERLLGCHQQE 199


>gi|295839978|ref|ZP_06826911.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB74]
 gi|295827730|gb|EFG65560.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB74]
          Length = 203

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 73/206 (35%), Positives = 117/206 (56%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVVA-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET + +++ +   G+ +NLER   +G RL GHLV GH+DGT  IL  +   
Sbjct: 56  TEFTADVMAETLQRSSLGALAPGSRVNLERPTPVGGRLGGHLVQGHVDGTGTILRREPSA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP +L +++  KGS+ ++G+SLTV   G++ F V LI  T+  TT    + G
Sbjct: 116 HWELVTVSLPGDLARYVVEKGSITVDGISLTVVEAGEDSFSVSLIPTTLALTTLGHKQPG 175

Query: 181 DLINIEVDSMMRYIARLY--ALNTSQ 204
             +N+EVD + +Y+ R+    +N ++
Sbjct: 176 APVNLEVDVLAKYVERMLRHGVNPTE 201


>gi|229592848|ref|YP_002874967.1| riboflavin synthase subunit alpha [Pseudomonas fluorescens SBW25]
 gi|229364714|emb|CAY52679.1| riboflavin synthase alpha chain [Pseudomonas fluorescens SBW25]
          Length = 220

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +RL V T   +   +KLG SIA +G+CLTV+ L      
Sbjct: 1   MFTGIIESIGSIRAMTPKGGDVRLLVETGKLDLGDVKLGDSIAVSGVCLTVIEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T +     G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLDCTAMNDLKAGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARSEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ +I HT+ ET    ++ 
Sbjct: 116 ARAVEFRIRAPKELAKYIAHKGSITVDGTSLTVNAVNGAEFELTIIPHTLSETIMASYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLMGDKA 199


>gi|241204004|ref|YP_002975100.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857894|gb|ACS55561.1| riboflavin synthase, alpha subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 203

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 108/203 (53%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV TSY+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDIGTIESVSSLKEGIKLRVATSYDPATIDMGASISHSGICLTVTGLPQEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGAWQEGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGDRKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPST 203


>gi|84496638|ref|ZP_00995492.1| putative riboflavin synthase alpha subunit [Janibacter sp.
           HTCC2649]
 gi|84383406|gb|EAP99287.1| putative riboflavin synthase alpha subunit [Janibacter sp.
           HTCC2649]
          Length = 202

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 71/198 (35%), Positives = 106/198 (53%), Gaps = 3/198 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +    +  RL +     TS    G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGQVDRIDLGDESARLTLRGPLVTSDAVHGASIAVNGVCLTVVEHD---VDA 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V AET   + +     G  +NLER++    R  GH+V GH+DGT  +L      
Sbjct: 58  GWFTVDVMAETLSRSGLGELVAGAPVNLERAMAASSRFGGHIVQGHVDGTAVVLERVPGD 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  +LP +L +++  KGS+ ++GVSLTV+ +  + F V LI  T+  TT     VG
Sbjct: 118 RWEVVTFTLPADLARYVVEKGSITVDGVSLTVSAITDDTFSVSLIPTTLALTTLGHRVVG 177

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+EVD + +Y+ RL 
Sbjct: 178 DTVNLEVDVLAKYVERLL 195


>gi|126727896|ref|ZP_01743724.1| riboflavin synthase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
 gi|126702837|gb|EBA01942.1| riboflavin synthase subunit alpha [Rhodobacterales bacterium
           HTCC2150]
          Length = 204

 Score =  184 bits (466), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 126/197 (63%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+      +R R+ +SY  + + +G SIA  G+CLTVV      +  
Sbjct: 1   MFTGIITDVGRIEALENRGD-LRARLSSSYPLAGIDMGASIACDGVCLTVVGKGSTENDG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN+ +W     +NLER++K+GD L GH+VSGH+DG  EI+ +   G
Sbjct: 60  SWFDVDISAETLSKTNLHTWAEARAVNLERALKVGDELGGHIVSGHVDGLAEIIEITDEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  PH L  FIA KGSV LNG SLTVN V    F +  I HT   TTW    VG
Sbjct: 120 DSTRVTLRAPHALAGFIASKGSVALNGASLTVNDVQCTDFGINFIPHTKSVTTWGRIAVG 179

Query: 181 DLINIEVDSMMRYIARL 197
           DL+N+E+D++ RY+ARL
Sbjct: 180 DLVNLEIDTLARYVARL 196


>gi|313904566|ref|ZP_07837941.1| riboflavin synthase, alpha subunit [Eubacterium cellulosolvens 6]
 gi|313470536|gb|EFR65863.1| riboflavin synthase, alpha subunit [Eubacterium cellulosolvens 6]
          Length = 224

 Score =  184 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +       R+R+  S    + ++G SIA  GICLTV  L       
Sbjct: 1   MFTGIIEETGVVERLELRGSSGRIRIRASKVLEETRIGDSIAVNGICLTVTDL-----AG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +E +V AET R +++ S G    +NLER+++   R  GH+V+GHIDG   I  +    
Sbjct: 56  NSFEADVMAETVRRSSLGSLGNHDRVNLERAMRADSRFGGHIVTGHIDGCGVIRSMKREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ R+  P  L + I  KGS+ ++G+SLTV  V +N F V +I HT EETT    K G
Sbjct: 116 NAIWVRIVPPEGLLRGIVEKGSIAIDGISLTVAEVDENGFAVSVIPHTGEETTLLGKKAG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +Y+ +L 
Sbjct: 176 DPVNLETDILGKYVEKLL 193


>gi|255320995|ref|ZP_05362168.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SK82]
 gi|262379915|ref|ZP_06073070.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SH164]
 gi|255301959|gb|EET81203.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SK82]
 gi|262298109|gb|EEY86023.1| riboflavin synthase, alpha subunit [Acinetobacter radioresistens
           SH164]
          Length = 219

 Score =  184 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 116/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+   E     
Sbjct: 1   MFTGIIESLGKVQSLQSVGGDVRLRIQTDLDMSDVNLGDSIATNGICLTVIEWGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQPVNVEKAMLPTTRFGGHIVSGHVDAVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGS+ ++G+SLT+N +  N   + LI HT E T     K G
Sbjct: 116 RSVYYEVTAPKEIAKYLAEKGSITVDGISLTINHLRGNILSLNLIPHTAERTNISTWKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|83858226|ref|ZP_00951748.1| riboflavin synthase subunit alpha [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853049|gb|EAP90901.1| riboflavin synthase subunit alpha [Oceanicaulis alexandrii
           HTCC2633]
          Length = 210

 Score =  184 bits (466), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 80/201 (39%), Positives = 119/201 (59%), Gaps = 2/201 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+ +G+I+++       R+ V + Y+   + LG SIAHAG+CLTVV    +  + 
Sbjct: 1   MFTGLVSALGRIVSI-KDGDVRRMTVSSPYDADTIALGASIAHAGVCLTVVAC-RKTQMG 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+++V  ET   T + SW  G  +NLER++K+GD L GH+V GH+DG   +       
Sbjct: 59  AEYDLDVSPETLSKTTLGSWKAGDGVNLERALKVGDELGGHIVQGHVDGVGRVTARTDED 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
             +   +  P +L  FIA KGS+ ++GVSLTVN V  + F++++I HT E TT    + G
Sbjct: 119 GWIRFIVEAPTDLSPFIAYKGSIAVDGVSLTVNRVEGDEFELMIIPHTAEVTTLGALQAG 178

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+EVD M RY ARL    
Sbjct: 179 TRVNLEVDVMARYAARLMQAR 199


>gi|295696431|ref|YP_003589669.1| riboflavin synthase, alpha subunit [Bacillus tusciae DSM 2912]
 gi|295412033|gb|ADG06525.1| riboflavin synthase, alpha subunit [Bacillus tusciae DSM 2912]
          Length = 200

 Score =  183 bits (465), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 86/198 (43%), Positives = 118/198 (59%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  + P  +G+ L V         K+G SIA +G+CLTVV L     V 
Sbjct: 1   MFTGIVEEIGILREVRPTDQGVELTVQAHRVLEDAKIGDSIAVSGVCLTVVDL-----VA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET R T + +   G  +NLER++ L  RL GHLVSGH+DG   +  + F G
Sbjct: 56  EAFRVDVVAETLRRTTLGAASPGARLNLERALTLQTRLGGHLVSGHVDGVGIVEEVGFEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    + +P  L+++IA KGSV ++GVSLTV  V +  F V LI HT +ETT    + G
Sbjct: 116 DSAVVDVRVPAPLQKYIAEKGSVAVDGVSLTVMGVTEKGFRVALIPHTQKETTLGELRSG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+EVD + RY+ RL 
Sbjct: 176 SRVNLEVDVVARYVERLL 193


>gi|13476939|ref|NP_108509.1| riboflavin synthase subunit alpha [Mesorhizobium loti MAFF303099]
 gi|14027702|dbj|BAB54295.1| riboflavin synthase alpha chain [Mesorhizobium loti MAFF303099]
          Length = 205

 Score =  183 bits (465), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 101/203 (49%), Positives = 136/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG + A+ P+++G+ LR+ T+Y+   + +G SI+  G+CLTV  L E  S  
Sbjct: 1   MFTGIVTDIGTVAAVRPLSEGVGLRIDTAYDPETIAIGASISCGGVCLTVTALPEHGSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T  +SW  G+ +NLER++K+GD L GH+VSGH+DGT E++     G
Sbjct: 61  RWFEVEAWEEALRLTTASSWKSGSKVNLERALKIGDELGGHIVSGHVDGTAELVERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P +L +FIA KGSV L+G SLTVN V    FDVLLI H++  TTW   KVG
Sbjct: 121 DAVRFTLEAPRHLAKFIAPKGSVALDGTSLTVNKVEGTRFDVLLIHHSLTVTTWGERKVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE+D+M RY ARL      
Sbjct: 181 DRVNIEIDTMARYAARLAEAAKE 203


>gi|88704436|ref|ZP_01102150.1| riboflavin synthase alpha chain [Congregibacter litoralis KT71]
 gi|88701487|gb|EAQ98592.1| riboflavin synthase alpha chain [Congregibacter litoralis KT71]
          Length = 221

 Score =  183 bits (465), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 74/200 (37%), Positives = 113/200 (56%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +RLR+ T   +   + +G SIA  G+CLTV  L      
Sbjct: 1   MFTGIIQAVGTVAAQQPSGGDLRLRIHTGKLSLDDVGIGDSIATNGVCLTVTEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T + +   G+ +NLE+S+    RL GH+VSGH+DG  EI+ +   
Sbjct: 56  GDGFWADVSRETLNLTTLGNLSQGSPVNLEKSLTPQSRLGGHIVSGHVDGLGEIVSMVED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++IA KGS+C++G SLTVN V    FD+ +I  T+ ET ++ +  
Sbjct: 116 ARSWRVVVRAPDALAKYIAHKGSICIDGTSLTVNAVDGACFDLNIIPQTMTETVFEHYSP 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ RL  
Sbjct: 176 GSPVNLEVDVIARYLERLLQ 195


>gi|145594418|ref|YP_001158715.1| riboflavin synthase subunit alpha [Salinispora tropica CNB-440]
 gi|145303755|gb|ABP54337.1| riboflavin synthase, alpha subunit [Salinispora tropica CNB-440]
          Length = 221

 Score =  183 bits (465), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPI-AKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G++I +T        + +      +  + G SIA  G+CLTVV L      
Sbjct: 1   MFTGIVEELGEVIHITETAEDSAVVTINGPLVVTDARPGDSIAVNGVCLTVVEL-----A 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET R + +     G  +NLER+  LG RL GHLV GH++G  E+L  +  
Sbjct: 56  GGAFTADVMGETLRRSALGVLRPGDPVNLERAATLGSRLGGHLVQGHVNGIGELLAREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP  L +++  KGS+ ++GVSLTV  +G ++F+V LI  T+  TT    +V
Sbjct: 116 ARWETVRFRLPTALARYVVTKGSITVDGVSLTVASIGPDWFEVGLIPTTLRLTTLGSRRV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +N+EVD + +Y+ RL   + S
Sbjct: 176 GDAVNLEVDVLAKYVERLLGRDQS 199


>gi|330812013|ref|YP_004356475.1| riboflavin synthase subunit alpha [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380121|gb|AEA71471.1| riboflavin synthase alpha chain [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 225

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T +     G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFLADVSRETLDCTAMNDLKGGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVSRTDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F + +I HT+ ET    ++ 
Sbjct: 116 ARAVEFRIRAPKELAKYIAHKGSITVDGTSLTVNAVDGAEFLLTIIPHTLSETIMASYRP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLMGDKA 199


>gi|260893813|ref|YP_003239910.1| riboflavin synthase, alpha subunit [Ammonifex degensii KC4]
 gi|260865954|gb|ACX53060.1| riboflavin synthase, alpha subunit [Ammonifex degensii KC4]
          Length = 216

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 112/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  +T      ++ +        +++G S+A  G CLTV RL       
Sbjct: 1   MFTGLVEEVGRVRRITRGPASAQIEIEARRVLEDLRVGDSVAVNGACLTVTRLGP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +  AET R TN+   G G  +NLER+++L DRL GHLV+GH+DG  +IL  +   
Sbjct: 56  GGFWADAMAETLRRTNLGELGPGDKVNLERALRLSDRLGGHLVTGHVDGVGKILRKEKED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    ++ P  +  ++  KGSV ++GVSLTV  V  + F V LI HT E TT  +   G
Sbjct: 116 VAWVLSIAAPPQVTPYLIEKGSVAVDGVSLTVVEVKGDVFKVSLIPHTAEHTTLGLKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ R   +   +
Sbjct: 176 DKVNLEADLIGKYVRRFLEVLQEK 199


>gi|218463059|ref|ZP_03503150.1| riboflavin synthase subunit alpha [Rhizobium etli Kim 5]
          Length = 203

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 106/203 (52%), Positives = 140/203 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + +++ + +G+RLRV T+Y+   + +G SI+HAGICLTV  L +E S  
Sbjct: 1   MFTGIVTDVGTVESVSLLKEGIRLRVATAYDPKTIDMGASISHAGICLTVTALPDEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G  INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGRRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   + G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERQAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|254480935|ref|ZP_05094181.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214038730|gb|EEB79391.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 218

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 79/200 (39%), Positives = 113/200 (56%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  M P    MRLRV T   + S + LG SIA  G CLTVV L      
Sbjct: 1   MFTGIIQAVGEIADMQPSGGDMRLRVNTGKLDLSDVALGDSIAANGACLTVVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  ET   T +     G+ +NLE+++    RL GH+VSGH+DG  E++ L   
Sbjct: 56  GDGYWADVSVETLNFTTLGGLKTGSKVNLEKALTPASRLGGHIVSGHVDGVGEVVSLQED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P +L ++IA KGS+ ++G SLTVN V    FD+ +I  T+ ET +  ++ 
Sbjct: 116 ARSWRFVMRAPDDLAKYIAHKGSITVDGTSLTVNAVNGAEFDLNIIPQTMAETVFGDYQP 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ RL  
Sbjct: 176 GSKLNLEVDVIARYLERLMQ 195


>gi|314924236|gb|EFS88067.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL001PA1]
 gi|314964910|gb|EFT09009.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL082PA2]
 gi|314982173|gb|EFT26266.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA3]
 gi|315090404|gb|EFT62380.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA4]
 gi|315093790|gb|EFT65766.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL060PA1]
 gi|315103909|gb|EFT75885.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL050PA2]
 gi|327325609|gb|EGE67408.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL103PA1]
          Length = 204

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++      
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVSRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP +L +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPADLSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 181 DEVNVEVDIIAKYLEALTNKERS 203


>gi|282855093|ref|ZP_06264425.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J139]
 gi|282581681|gb|EFB87066.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J139]
          Length = 199

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 1   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++      
Sbjct: 58  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVSRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP +L +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 116 HWEVFRFALPADLSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 176 DEVNVEVDIIAKYLEALTNKERS 198


>gi|167630210|ref|YP_001680709.1| riboflavin synthase, alpha subunit [Heliobacterium modesticaldum
           Ice1]
 gi|167592950|gb|ABZ84698.1| riboflavin synthase, alpha subunit [Heliobacterium modesticaldum
           Ice1]
          Length = 219

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 114/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A++  A+  ++ +        +KLG SIA  G+CLTVVR        
Sbjct: 1   MFTGIVEELGVVRAISRGARSAKIEINAKTVVEDVKLGDSIAVNGVCLTVVRYD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   T ++    G  +NLER+V++GDRL GH+VSGHID    I   + + 
Sbjct: 56  SSFTADVMAETLDRTALSELQPGHRVNLERAVRVGDRLGGHIVSGHIDAVGVIRGQERVD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   ++ P  L +++  KGS+ ++G+SLTV  V +  F V LI HT   TT  + K G
Sbjct: 116 IAVVTEIAAPPELLRYVIPKGSIAIDGISLTVVDVFEAAFTVSLIPHTAGMTTLGLKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+E D + +Y+ RL    
Sbjct: 176 HKVNLEADVIGKYVERLLTGR 196


>gi|302866840|ref|YP_003835477.1| riboflavin synthase subunit alpha [Micromonospora aurantiaca ATCC
           27029]
 gi|315503255|ref|YP_004082142.1| riboflavin synthase, alpha subunit [Micromonospora sp. L5]
 gi|302569699|gb|ADL45901.1| riboflavin synthase, alpha subunit [Micromonospora aurantiaca ATCC
           27029]
 gi|315409874|gb|ADU07991.1| riboflavin synthase, alpha subunit [Micromonospora sp. L5]
          Length = 203

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 74/202 (36%), Positives = 108/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLR-VMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+I+  T       L  +     TS  + G SIA  G+CLTVV +      
Sbjct: 1   MFTGIVEELGEIVRSTETGDDSALVAIRGPLVTSDARHGDSIAVNGVCLTVVDVD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET R T + +   G  +NLER+  L  RL GHLV GH+DG  EI+  +  
Sbjct: 56  GGVFTADVMGETLRRTALGALRPGDPVNLERAAALNSRLGGHLVQGHVDGVGEIVAREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP  L +++  KGS+ ++GVSLTV   G ++F V LI  T++ T     ++
Sbjct: 116 AQWETVRFRLPAGLARYVVEKGSITVDGVSLTVAEAGDDWFSVGLIPTTLKLTVLGTKRI 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +N+EVD + +Y+ RL    
Sbjct: 176 GDPVNLEVDVLAKYVERLLGDR 197


>gi|114319538|ref|YP_741221.1| riboflavin synthase subunit alpha [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114225932|gb|ABI55731.1| riboflavin synthase, alpha subunit [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 221

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 79/199 (39%), Positives = 114/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G+I    P  + MRL +     + + ++LG SIA  G+CLT V L+     
Sbjct: 1   MFTGIVQAVGRIQRRDPRGEDMRLWIAAGDLDLTGVRLGDSIAVNGVCLTAVELT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET R+T++   G G  +NLE ++ L   L GHLVSGH+DG  E++     
Sbjct: 56  ADAFAADVSVETLRLTSLGDLGEGDALNLELALTLQTPLGGHLVSGHVDGLGEVVSRRPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   R   P  L ++IA KGS+ ++GVSLTVN V    F+V L+ HT+E T     + 
Sbjct: 116 GRSEVWRFRAPEGLARYIAAKGSITVDGVSLTVNGVDGAEFEVNLVPHTLEVTRLGQLRP 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GSRVNLEVDIIARYLERLL 194


>gi|328951150|ref|YP_004368485.1| riboflavin synthase, alpha subunit [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451474|gb|AEB12375.1| riboflavin synthase, alpha subunit [Marinithermus hydrothermalis
           DSM 14884]
          Length = 202

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 109/199 (54%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I   TP    +RL +     T   ++G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEEVGTIREATPSNGNLRLWIEAHTVTQDARIGDSIAVNGVCLTVVA-----REP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + VE+  ET   T    W  G  +NLER++ LGDRL GH V+GH+DG   +     + 
Sbjct: 56  HGFAVELARETLERTAPR-WAAGRRVNLERALALGDRLGGHFVTGHVDGVGRVQARRNVP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L ++IA KGS+ ++GVSLTV  V    F V LI HT++ TT    + G
Sbjct: 115 GAYDLVIQAPPELARYIARKGSIAIDGVSLTVVQVEGATFSVTLIPHTLKATTLGELQEG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY+ RL  
Sbjct: 175 DAVNLEVDLIARYLERLLQ 193


>gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040024|gb|ACT56820.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 204

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD
Sbjct: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG
Sbjct: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG
Sbjct: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DLINIEVDSMMRYIARLYALNTSQ
Sbjct: 181 DLINIEVDSMMRYIARLYALNTSQ 204


>gi|328954277|ref|YP_004371611.1| riboflavin synthase, alpha subunit [Desulfobacca acetoxidans DSM
           11109]
 gi|328454601|gb|AEB10430.1| riboflavin synthase, alpha subunit [Desulfobacca acetoxidans DSM
           11109]
          Length = 215

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 121/203 (59%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  IG+I A+   A+G+RL +   +N +++K G SIA +G CLTVV L+      
Sbjct: 1   MFTGLVEGIGEITAIAREAEGLRLSLTAPFNLTEVKPGDSIAVSGPCLTVVELTAR---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VEV  ET R T++A+  +G  +N+ER++++GDRL GH+VSGHID   +++      
Sbjct: 57  -TFTVEVSPETVRRTSLAAKRVGDRVNIERALRVGDRLGGHIVSGHIDCVGQLVKKMVRP 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
             + C + L  N  +++  KGS+ L+GVSLTVN    + F V +I  T   TT    + G
Sbjct: 116 QHLQCVIRLTDNWSRYVIEKGSIALDGVSLTVNSCTGDEFSVNIIPFTARHTTLIEVRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ +L +    
Sbjct: 176 DRLNVETDIIGKYVEKLLSPQRQ 198


>gi|226951735|ref|ZP_03822199.1| riboflavin synthase subunit alpha [Acinetobacter sp. ATCC 27244]
 gi|226837525|gb|EEH69908.1| riboflavin synthase subunit alpha [Acinetobacter sp. ATCC 27244]
          Length = 219

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 76/203 (37%), Positives = 118/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK+ ++  +   +RLR+ T  + S + LG SIA  GICLTV+        D
Sbjct: 1   MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+DG  EI  +    
Sbjct: 56  HWYAADVSRESLNRTTLGQWKVGQAVNVEKAMLPTTRFGGHIVSGHVDGLGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  L +++A KGSV ++G+SLT+N +  N   + LI HT E T     +VG
Sbjct: 116 RSLYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNIGTWQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 TKVNLEVDVLARYIERLLLGDKA 198


>gi|86357149|ref|YP_469041.1| riboflavin synthase subunit alpha [Rhizobium etli CFN 42]
 gi|86281251|gb|ABC90314.1| riboflavin synthase, alpha chain protein [Rhizobium etli CFN 42]
          Length = 203

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 106/203 (52%), Positives = 141/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV T+Y+ + + +G SI+H+GICLTV  L  E S  
Sbjct: 1   MFTGIVTDIGTIESVSSLKEGIKLRVATAYDPATIDMGASISHSGICLTVTGLPAEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVSSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT++ TTW   K G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLDVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|147678095|ref|YP_001212310.1| riboflavin synthase subunit alpha [Pelotomaculum thermopropionicum
           SI]
 gi|146274192|dbj|BAF59941.1| riboflavin synthase alpha chain [Pelotomaculum thermopropionicum
           SI]
          Length = 216

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+       RL +  +     +++G SIA  G+CLT    +      
Sbjct: 1   MFTGIVEELGVVRAVRSGTASARLVIGATKVLEDLRVGDSIAVNGVCLTAESFTSRE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   TN+     G  +NLER+++LGDRL GHLVSGHIDG   I   +   
Sbjct: 58  --FTADVMAETLAKTNLGGLSPGDRVNLERALRLGDRLGGHLVSGHIDGVGTITRQERFD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  PH + +++  KGSV ++G+SLTV   G + F V LI HT   TT    KVG
Sbjct: 116 IATLITIKAPHEVMRYVIKKGSVAIDGISLTVVDFGPDSFQVSLIPHTARVTTLGFKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +YI RL  L   +
Sbjct: 176 DTVNLEGDIIGKYIERLMELRREE 199


>gi|118580018|ref|YP_901268.1| riboflavin synthase subunit alpha [Pelobacter propionicus DSM 2379]
 gi|118502728|gb|ABK99210.1| riboflavin synthase, alpha subunit [Pelobacter propionicus DSM
           2379]
          Length = 213

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D G++ A     K   LRV +S    ++ +G S+A  G CLTV    E     
Sbjct: 1   MFTGLIEDTGRVTAFERRGKAGLLRVASSLPLDEIAIGDSVAVNGACLTVTEKRE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  E+   T + S   G+ +NLER+++LGDR+ GH+V+GH+D    +   +   
Sbjct: 56  GTLTFDVSPESLTATTLGSLASGSLVNLERALRLGDRMGGHIVTGHVDCVGRLARTENSS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  SLP    +++  KGSV ++G+SLTVN V ++ F V +I HT+E T+    + G
Sbjct: 116 HHHVLEFSLPAGNARYLVTKGSVTIDGISLTVNRVSQDGFTVNIIPHTLERTSLHSLRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           + +NIE D + +Y+ RL     S
Sbjct: 176 NEVNIETDIIGKYVERLTQPWKS 198


>gi|197105133|ref|YP_002130510.1| riboflavin synthase, alpha subunit [Phenylobacterium zucineum HLK1]
 gi|196478553|gb|ACG78081.1| riboflavin synthase, alpha subunit [Phenylobacterium zucineum HLK1]
          Length = 196

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 82/196 (41%), Positives = 121/196 (61%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++ ++    +  R  + T+++TS + +G S++HAG CLT+V         
Sbjct: 1   MFTGIVTDVGRVRSVRETNRDRRFEIETAFDTSTLDIGASVSHAGCCLTIVEKGP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  W +G  +NLER+ ++GD L GH+VSGH+DG  E++ ++  G
Sbjct: 56  GWFAVEVSGETLSRTTLDQWAVGRRVNLERAARVGDELGGHIVSGHVDGVGEVVSVESEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R+  P  L ++IA KGS+ + GVSLTVN V  + F V LI HT E TT      G
Sbjct: 116 GSHRVRIRAPRPLHRYIAEKGSIAVEGVSLTVNEVEDDVFGVNLIPHTWEVTTLGELAPG 175

Query: 181 DLINIEVDSMMRYIAR 196
             +N+E+D + RY+AR
Sbjct: 176 GRVNLEIDMLARYLAR 191


>gi|312963302|ref|ZP_07777785.1| riboflavin synthase alpha chain [Pseudomonas fluorescens WH6]
 gi|311282382|gb|EFQ60980.1| riboflavin synthase alpha chain [Pseudomonas fluorescens WH6]
          Length = 220

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/204 (39%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +RL V T   +   +KLG SIA +G+CLTVV L      
Sbjct: 1   MFTGIIESIGSIRAMTPKGGDVRLLVDTGKLDLGDVKLGDSIAVSGVCLTVVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T ++    G+ +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLDCTAMSDLKAGSPVNLEKALTPTTRLGGHLVSGHVDGVGEVVARSEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ +I HT+ ET    ++ 
Sbjct: 116 ARAVEFRIRAPKALAKYIAHKGSITVDGTSLTVNAVNGAEFELTIIPHTLSETIMASYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|197119394|ref|YP_002139821.1| riboflavin synthase subunit alpha [Geobacter bemidjiensis Bem]
 gi|197088754|gb|ACH40025.1| riboflavin synthase [Geobacter bemidjiensis Bem]
          Length = 214

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 112/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+++++        L V TS    ++ +G SIA  G CLTVVR        
Sbjct: 1   MFTGLIETVGELVSIEKRGASGSLTVKTSLPLDEVAIGASIAINGACLTVVRKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                ++  ET   T   +   G+ +N+ER+++L DRLDGHLVSGH+D    ++    + 
Sbjct: 56  GAVTFDISPETIDRTGFKNLKSGSPVNMERAMRLSDRLDGHLVSGHVDCVATVIERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++      P    ++IA KGSV ++G+SLTVN  G + F + +I HT  +TT    +VG
Sbjct: 116 GNIVFSFRFPPQYGKYIAAKGSVAIDGISLTVNSAGPDSFSINVIPHTAAKTTLIGKRVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + RY+ RL A   +
Sbjct: 176 DEVNIETDLLCRYLERLLAGRET 198


>gi|296448858|ref|ZP_06890692.1| riboflavin synthase, alpha subunit [Methylosinus trichosporium
           OB3b]
 gi|296253637|gb|EFH00830.1| riboflavin synthase, alpha subunit [Methylosinus trichosporium
           OB3b]
          Length = 199

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 121/197 (61%), Gaps = 1/197 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTDIG+I+++ P  +  R+ +  SY    + LG SIA +G CLT V L  E    
Sbjct: 1   MFTGLVTDIGEIVSVEPRGELRRIAISCSYPLESIALGASIACSGPCLTAVDLRREGGR- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +EV+  AET   T    W +G  INLERS+K+GD L GH+V+GH+DG   IL  +   
Sbjct: 60  TVFEVDAAAETLARTTAGQWTVGRRINLERSLKIGDELGGHIVTGHVDGVATILSREDFD 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +  PH L +FIA KGSV L+G SLTVN V  + F VL+I HT+  TTW  ++ G
Sbjct: 120 GMSRFWIEAPHGLARFIAEKGSVALDGTSLTVNAVEGDRFSVLIIPHTLAVTTWGEYRAG 179

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD M RY ARL
Sbjct: 180 DRLNLEVDLMARYAARL 196


>gi|227504399|ref|ZP_03934448.1| riboflavin synthase subunit alpha [Corynebacterium striatum ATCC
           6940]
 gi|227199047|gb|EEI79095.1| riboflavin synthase subunit alpha [Corynebacterium striatum ATCC
           6940]
          Length = 204

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 112/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG +  +      +RL +          LG SIA  G+CLTV   +      
Sbjct: 1   MFTGLVEEIGTVACLERQGDAIRLGIAAPKILDDAALGDSIAINGVCLTVAERT-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  E+   + +    +G+ +N+ER++    RL GH++ GH+DGT +++      
Sbjct: 56  DVFIADVMQESLNRSALGELRVGSQVNVERALLPTTRLGGHIMQGHVDGTAKLISRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R  LP  L +++  KGS+ ++G SLTV+ +G ++F+V LI  T+ +T +   +VG
Sbjct: 116 NWEVVRFELPAGLARYVVEKGSIAVSGTSLTVSSIGADWFEVSLIPTTLRDTIFGQLEVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + +Y+ +++  N S
Sbjct: 176 AAVNLEVDVLAKYVEKMFGPNAS 198


>gi|169659036|dbj|BAG12727.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/203 (47%), Positives = 135/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVQQAAA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R++N+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLSNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVARQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+AL   
Sbjct: 181 DRVNLEIDQLARYAAKLFALKRE 203


>gi|182678212|ref|YP_001832358.1| riboflavin synthase, alpha subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634095|gb|ACB94869.1| riboflavin synthase, alpha subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 202

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 94/198 (47%), Positives = 124/198 (62%), Gaps = 1/198 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+++D+G++ A+    +  RLR+  SY    + LG SIA  G CLTVV   +E S +
Sbjct: 1   MFTGLISDVGEVGAVEERGQLRRLRIFCSYPAESVVLGASIACNGPCLTVVAFDQEKSSN 60

Query: 61  N-WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             W+EV+V AET   T    W  GT +NLERS+K+GD L GH+V+GH+D   EI  +D  
Sbjct: 61  RIWFEVDVGAETLARTTAEHWTPGTKLNLERSLKVGDELGGHIVTGHVDAVAEITAIDDF 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                  + +P +L +FIA KGSV L+G SLTVN V  N F VLLI HT+  TTW   +V
Sbjct: 121 DGMRRFSIRVPESLARFIAEKGSVSLDGTSLTVNSVEGNVFSVLLIPHTLAVTTWGGKQV 180

Query: 180 GDLINIEVDSMMRYIARL 197
            D +N+EVD M RY ARL
Sbjct: 181 EDRVNLEVDLMARYAARL 198


>gi|326331207|ref|ZP_08197501.1| riboflavin synthase, alpha subunit [Nocardioidaceae bacterium
           Broad-1]
 gi|325950977|gb|EGD43023.1| riboflavin synthase, alpha subunit [Nocardioidaceae bacterium
           Broad-1]
          Length = 202

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 67/198 (33%), Positives = 107/198 (54%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +      +RL +  +   S  +LG SIA  G CLTV  L       
Sbjct: 1   MFTGIVEELGTVAGIEDQGDAVRLTISATTVLSDAELGASIAVNGCCLTVATLGSGE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET + T++ +  +G  +NLER+V    RL GH+V GH+DG   I+  +   
Sbjct: 58  --WTADVMLETLKRTSLHAVSVGDQVNLERAVTPTTRLGGHIVQGHVDGVGRIVSREPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +SLP  L +++  KGS+ ++G+SLTV  V ++ F V LI  T+  T+     VG
Sbjct: 116 HWEVVTISLPPELARYVVEKGSIAVDGISLTVVSVTEDSFTVSLIPETLARTSLGFRAVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +++ +L 
Sbjct: 176 DEVNLETDIIAKHVEKLV 193


>gi|254419910|ref|ZP_05033634.1| riboflavin synthase, alpha subunit [Brevundimonas sp. BAL3]
 gi|196186087|gb|EDX81063.1| riboflavin synthase, alpha subunit [Brevundimonas sp. BAL3]
          Length = 196

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 83/196 (42%), Positives = 117/196 (59%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG++  +    +  R  + T+++ S + LG SI+HAG CLTV          
Sbjct: 1   MFTGIVTDIGRVRDVRETERDRRYEIQTAWDVSGIDLGASISHAGCCLTVTEKG-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VEV  ET   T +  W  G  INLER+ KLGD + GH+VSGH+DG   ++ +   G
Sbjct: 56  DWFAVEVSNETLSKTTLGGWKAGDGINLERAAKLGDEMGGHVVSGHVDGLGRVVSITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    +  P  L ++IA KGS+ ++GVSLTVN V    F + +I HT + TT    K G
Sbjct: 116 GSHRLEVEAPAPLHRYIAAKGSITVDGVSLTVNSVAGQVFSLNIIPHTWDVTTLGRLKAG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E+D + RY+AR
Sbjct: 176 DPVNLEIDMLARYLAR 191


>gi|253699857|ref|YP_003021046.1| riboflavin synthase subunit alpha [Geobacter sp. M21]
 gi|251774707|gb|ACT17288.1| riboflavin synthase, alpha subunit [Geobacter sp. M21]
          Length = 214

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+++++        L V TS    ++ +G SIA  G CLTVVR        
Sbjct: 1   MFTGLIETVGELVSIEKRGASGSLTVKTSLPLDEVAIGASIAINGACLTVVRKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                ++  ET   T   +   G+ +N+ER+++L DRLDGHLVSGH+D    ++    + 
Sbjct: 56  GAVTFDISPETIDRTGFKNLKSGSPVNMERAMRLSDRLDGHLVSGHVDCVATVIERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++      PH   ++IA KGSV ++G+SLTVN  G + F + +I HT  +TT    +VG
Sbjct: 116 GNIVFSFRFPHQYGKYIAAKGSVAIDGISLTVNSAGPDSFSINVIPHTAAKTTLIGKRVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + RY+ RL A   +
Sbjct: 176 DEVNIETDLLCRYLERLLAGREN 198


>gi|169659012|dbj|BAG12715.1| riboflavin synthase [Bartonella grahamii]
 gi|169659016|dbj|BAG12717.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 101/203 (49%), Positives = 134/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSREFMPFIVNKGSIALNGTSLTVNGVENCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+ L   
Sbjct: 181 DRVNLEIDQLARYAAKLFTLKRE 203


>gi|262072916|dbj|BAI47766.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 98/203 (48%), Positives = 136/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVKQATA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVVRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY+A+L+AL   
Sbjct: 181 DWVNLEIDQLARYVAKLFALKRE 203


>gi|269795120|ref|YP_003314575.1| riboflavin synthase subunit alpha [Sanguibacter keddieii DSM 10542]
 gi|269097305|gb|ACZ21741.1| riboflavin synthase, alpha subunit [Sanguibacter keddieii DSM
           10542]
          Length = 200

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/205 (34%), Positives = 102/205 (49%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMT---PIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIV ++G + A+           L V      S   LG SIA  G+CLTV  L    
Sbjct: 1   MFTGIVEELGTVTALELPDASRSDAVLTVSGPLVVSDAALGDSIAVDGVCLTVTSL---- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                +  +V  E+   T +AS  +G  +NLER+++   RL GH+V GH+DG   ++   
Sbjct: 57  -PGGGFTADVMPESLSRTALASLAVGRRVNLERAMRADARLGGHIVQGHVDGVGTLVSRT 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                          + +++A KGS+ ++GVSLTV  V    F V LI  T+E TT    
Sbjct: 116 PGERWDDLVFETSPEVARYVAEKGSITVSGVSLTVTGVTATTFGVSLIPTTLEATTLGGL 175

Query: 178 KVGDLINIEVDSMMRYIARLYALNT 202
           +VGD +N+EVD + +Y+ RL     
Sbjct: 176 EVGDPVNLEVDVIAKYVERLLGARA 200


>gi|296283378|ref|ZP_06861376.1| riboflavin synthase subunit alpha [Citromicrobium bathyomarinum
           JL354]
          Length = 205

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 115/205 (56%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG + A+      + +R+   ++  ++ +G SIA +G+CLTV       + D
Sbjct: 1   MFTGIVTAIGTVAAIEQRGD-LHVRIACPFDPERIAIGASIACSGVCLTVTERGG-SAGD 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V  ET   T    W  G  +NLE S++LGD L GHLV+GH+D   E+     + 
Sbjct: 59  AWFAVDVSQETVSRTVPGLWEEGRKLNLEPSLRLGDELGGHLVTGHVDAVGEVAERRSVD 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHTIEETTWK 175
            S++  +  P  L  FIA KGS+ ++GVSLTVN V         F + +I HT E TT  
Sbjct: 119 GSIHFEIRAPKALAPFIAAKGSITVDGVSLTVNAVEDEADGSARFALNIIPHTGEVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
               GD +N+E+D + RY+ R+ AL
Sbjct: 179 ALSEGDKVNLEIDVLARYLKRMQAL 203


>gi|169659024|dbj|BAG12721.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 100/203 (49%), Positives = 134/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHVDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+ L   
Sbjct: 181 DRVNLEIDQLARYAAKLFTLKRE 203


>gi|320352892|ref|YP_004194231.1| riboflavin synthase subunit alpha [Desulfobulbus propionicus DSM
           2032]
 gi|320121394|gb|ADW16940.1| riboflavin synthase, alpha subunit [Desulfobulbus propionicus DSM
           2032]
          Length = 217

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/198 (36%), Positives = 107/198 (54%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G +    P   GM   +   +  +  + G SIA  G CLT   +       
Sbjct: 1   MFTGIIQGLGTLFEKRPSGGGMIFGLEADFALTDPEEGESIAVNGACLTARNIK-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  E+   T +     G+ +NLER+++L DRL GHLVSGH+D   ++     +G
Sbjct: 56  NRFYVDVSPESLARTGLGRLQTGSRVNLERALRLSDRLGGHLVSGHVDAQAQVKDRRRVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SL   L +++  KGS+ +NGVSLTVN   +  F V +I HT+  TT  M K G
Sbjct: 116 EFTLFAFSLDPALGKYVIEKGSITINGVSLTVNSCDREGFSVSIIPHTLAVTTLGMLKEG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +NIEVD + +Y+ +L 
Sbjct: 176 DHVNIEVDMIGKYVEKLL 193


>gi|328543538|ref|YP_004303647.1| riboflavin synthase subunit alpha [polymorphum gilvum SL003B-26A1]
 gi|326413282|gb|ADZ70345.1| Riboflavin synthase subunit alpha [Polymorphum gilvum SL003B-26A1]
          Length = 201

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/202 (48%), Positives = 122/202 (60%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G I+ +  I  G R R+ T+Y+   + +G SIA  G C TV        V 
Sbjct: 1   MFTGIVTDVGTILRVESIPAGRRTRIATAYDPDTIDIGASIACGGPCHTVTAKGRTGGV- 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EVE  AET R+T ++ W  G  +NLERS+ LG  L GHLV GH+DGT  IL      
Sbjct: 60  NWFEVESGAETLRLTTVSDWTAGMRLNLERSLMLGAELGGHLVLGHVDGTATILERRDHP 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S+Y R   P  L +FIA KGSV L+G SLTVN V  + F V LI HT++ TTW     G
Sbjct: 120 ESVYFRFEAPAGLARFIARKGSVALDGTSLTVNEVEGDSFSVFLIPHTLQVTTWAERHAG 179

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+EVD M RY ARL   + 
Sbjct: 180 DRVNLEVDMMARYAARLAEYHA 201


>gi|229916730|ref|YP_002885376.1| riboflavin synthase, subunit alpha [Exiguobacterium sp. AT1b]
 gi|229468159|gb|ACQ69931.1| riboflavin synthase, alpha subunit [Exiguobacterium sp. AT1b]
          Length = 213

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 108/202 (53%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG + A+      +RL +        +KLG SIA  GICLTV         D
Sbjct: 1   MFTGIVEEIGSVKAVKRNGPSLRLVLSAVKVLDDVKLGDSIAVNGICLTVTTFD-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + +++     GT +NLER++    R  GH VSGH+DG   I     + 
Sbjct: 56  ATFSVDVMPETLKASSLDGVKPGTQVNLERAMPANGRFGGHFVSGHVDGVGRITKKRPLA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  +     L  +I  KGS+C++G SLTV  V +  F + LI HT  ET   M + G
Sbjct: 116 NAVYIDIQCDRALLSYIVPKGSICVDGTSLTVFDVSERGFTLSLIPHTYSETVLGMKQTG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+N+E D + +Y+ ++   + 
Sbjct: 176 DLVNLECDLLAKYMEKVVGQSK 197


>gi|315499925|ref|YP_004088728.1| riboflavin synthase, alpha subunit [Asticcacaulis excentricus CB
           48]
 gi|315417937|gb|ADU14577.1| riboflavin synthase, alpha subunit [Asticcacaulis excentricus CB
           48]
          Length = 196

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 86/196 (43%), Positives = 125/196 (63%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG + A+     G R  V T+Y+ S + +G S+AH+G CLTVV         
Sbjct: 1   MFTGIITDIGTLTAIDRHEGGARFEVQTAYDLSTVDIGASVAHSGCCLTVVE-----KRG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y +++  ET  +T + +W +G  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 56  DRYTLDLSNETLAVTTLDNWRVGDRVNLERALKVGDELGGHIVSGHVDGVGELIALTEDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   ++ +P  L ++IA KGS+ L+G+SLTVN V  + F V +I HT   TT    KVG
Sbjct: 116 DAYRLKVRVPRPLHRYIAHKGSIALDGISLTVNEVEDDVFGVAIIPHTWTHTTLSDRKVG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E+D M RY AR
Sbjct: 176 DKLNLEIDLMARYAAR 191


>gi|225164209|ref|ZP_03726484.1| riboflavin synthase, alpha subunit [Opitutaceae bacterium TAV2]
 gi|224801183|gb|EEG19504.1| riboflavin synthase, alpha subunit [Opitutaceae bacterium TAV2]
          Length = 203

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 111/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G + + T      +L++        + LG SIA  G CLTV     E    
Sbjct: 1   MFTGIIEETGSVASFTKGRNAWKLQIAARLALEAVSLGDSIAINGCCLTVTAFDHE---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            +   ++  ET+R+TNI     G+ +NLERS++ G ++ GH V+GHIDG   I  L+  G
Sbjct: 57  -FIWFDLLEETHRLTNIGKLAPGSAVNLERSLRFGGKMGGHFVTGHIDGMGVIEVLEQRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +  Y R+  P    + +  KGS+ ++G+SLTV  V  + F V LI  T++ T  +   VG
Sbjct: 116 NDYYLRVHTPPGNGRHLIHKGSIAIDGISLTVAEVEGDHFAVWLIPTTMQVTNLRTRSVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ +L A  ++
Sbjct: 176 DHVNLEFDMLGKYVEKLLAGRSA 198


>gi|196233898|ref|ZP_03132736.1| riboflavin synthase, alpha subunit [Chthoniobacter flavus Ellin428]
 gi|196222092|gb|EDY16624.1| riboflavin synthase, alpha subunit [Chthoniobacter flavus Ellin428]
          Length = 196

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 107/201 (53%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G+++A+   A+G RL V     T  + LG S+A  G CLTV          
Sbjct: 1   MFTGLVEETGELLALARSAEGARLTVRAPLVTGDVHLGDSVAVNGCCLTVTA-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                ++  ET   TN+ +   G  +NLER++    RL GH V GH+D T  +L  + + 
Sbjct: 56  QTLAFDLLEETLARTNLGALTPGAPVNLERALAAHARLGGHFVQGHVDTTSRVLAFEQVK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 ++LP    +++A KGS+ ++G+SLTV  V    F V +I HT+  T  +  K G
Sbjct: 116 ADYRLEIALPAEFARYVAFKGSIAIDGISLTVAEVRDPSFVVWIIPHTLSVTNLRAKKAG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           +L+N+E D + +Y+ R+ A  
Sbjct: 176 ELVNLEFDLLAKYVERIVATR 196


>gi|311742371|ref|ZP_07716180.1| riboflavin synthase subunit alpha [Aeromicrobium marinum DSM 15272]
 gi|311313999|gb|EFQ83907.1| riboflavin synthase subunit alpha [Aeromicrobium marinum DSM 15272]
          Length = 211

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/208 (34%), Positives = 109/208 (52%), Gaps = 7/208 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G + A+  +   +RL V     T+    G SIA  G CLTV     E    
Sbjct: 1   MFTGLVEEKGVVTAVERLGDSVRLTVRGPVVTADAAHGDSIAVNGCCLTVAS-RPEAPEP 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AE+   T++ +  +G+ +NLER++  GDRL GHLV GH+DGT  ++      
Sbjct: 60  STFSADVMAESLDRTSLGALTVGSEVNLERAMAAGDRLGGHLVQGHVDGTGRLVDRTASE 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV------GKNFFDVLLIRHTIEETTW 174
           +    R ++P  L +++  KGS+ + GVSLTV  V         +F V LI  TI +TT 
Sbjct: 120 NWEVLRFTVPAALARYLVSKGSITVEGVSLTVVEVVDDDPEHGCWFSVSLIPTTIADTTL 179

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNT 202
                G  +N+EVD + +Y+ RL     
Sbjct: 180 GTLTPGSPVNLEVDVLAKYVERLLEHRK 207


>gi|150396043|ref|YP_001326510.1| riboflavin synthase subunit alpha [Sinorhizobium medicae WSM419]
 gi|150027558|gb|ABR59675.1| riboflavin synthase, alpha subunit [Sinorhizobium medicae WSM419]
          Length = 206

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 110/203 (54%), Positives = 143/203 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G +LRV T+Y+   + +G SIAHAG+CLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLREGAKLRVATNYDPKTIDMGASIAHAGVCLTVTALPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA+W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIAAWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRH+++ TTW   K G
Sbjct: 121 DAVRFRLRAPEHLAKFVAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLDVTTWGERKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+N EVD+M RY ARL     +
Sbjct: 181 DLVNFEVDTMARYAARLAEFPAA 203


>gi|314925875|gb|EFS89706.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL036PA3]
          Length = 204

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 107/203 (52%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R + P  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFAPPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 181 DEVNVEVDIIAKYLEALTNKERS 203


>gi|113969441|ref|YP_733234.1| riboflavin synthase subunit alpha [Shewanella sp. MR-4]
 gi|114046669|ref|YP_737219.1| riboflavin synthase subunit alpha [Shewanella sp. MR-7]
 gi|113884125|gb|ABI38177.1| riboflavin synthase, alpha subunit [Shewanella sp. MR-4]
 gi|113888111|gb|ABI42162.1| riboflavin synthase, alpha subunit [Shewanella sp. MR-7]
          Length = 218

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLAAPAELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + RY+ RL   +T +
Sbjct: 176 GDKVNIEVDLIARYLERLMRFDTKE 200


>gi|182415673|ref|YP_001820739.1| riboflavin synthase, alpha subunit [Opitutus terrae PB90-1]
 gi|177842887|gb|ACB77139.1| riboflavin synthase, alpha subunit [Opitutus terrae PB90-1]
          Length = 198

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 108/202 (53%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK++  TP  +  RL++        + LG SIA  G CLTV          
Sbjct: 1   MFTGIVEETGKVVGFTPEREAWRLQIEARAALGGVALGDSIAVNGCCLTV-----AGVAG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +  + +V  ET R+TN A    G  +NLERS++   ++ GH V+GHIDG   I  L+  G
Sbjct: 56  SVLQFDVLEETRRLTNFAMLAPGAPVNLERSLRFDGKVGGHFVTGHIDGLGVIELLEPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
              Y ++  P +   ++  KGS+ ++G+SLTV  V    FDV LI  T+  T     K G
Sbjct: 116 KDHYLKVRAPDDCAHYLVHKGSIAIDGISLTVAAVDGPVFDVWLIPTTMTVTNLGARKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           + +N+E D + +Y+ +L A  +
Sbjct: 176 EAVNLEFDLLGKYVEKLLAARS 197


>gi|218673495|ref|ZP_03523164.1| riboflavin synthase subunit alpha [Rhizobium etli GR56]
          Length = 203

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 107/203 (52%), Positives = 142/203 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I +++ + +G++LRV TSY+ + + +G SI+H+GICLTV  L +E S  
Sbjct: 1   MFTGIVTDIGTIESVSTLKEGIKLRVATSYDPATIDMGASISHSGICLTVTGLPQEGSNG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I +W  G+ INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 61  RWFEVEAWEEALRLTTIGTWREGSRINLERSLKIGDELGGHIVSGHVDGKAEILSVTSEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+   RL  P +L +F+A KGS+ L+G SLTVN V    FDVLLIRHT+E TTW   + G
Sbjct: 121 DATRYRLRAPEHLAKFVAPKGSIALDGTSLTVNAVDGTDFDVLLIRHTLEVTTWGERQAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL    ++
Sbjct: 181 DFVNFEVDTMARYAARLAEFPSA 203


>gi|222055765|ref|YP_002538127.1| riboflavin synthase, alpha subunit [Geobacter sp. FRC-32]
 gi|221565054|gb|ACM21026.1| riboflavin synthase, alpha subunit [Geobacter sp. FRC-32]
          Length = 215

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 109/201 (54%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG +  M   +    L V  ++ + ++ +G SIA  G CLTVV         
Sbjct: 1   MFTGLIEEIGTVAGMEMKSNAGILSVSAAFPSDRIAIGDSIAVNGACLTVV-----GKGA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   T++     GT +NLER++ +  RLDGHLVSGH+D    +     + 
Sbjct: 56  GTFSFDVSPETVNRTSLKELKKGTPVNLERALAVSGRLDGHLVSGHVDCLAVVRDRRTVS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      +P    +++A KGS+ ++GVSLTVN V  + F V +I HT+ +TT    K G
Sbjct: 116 GNTVFFFRMPAEYLRYVAAKGSIAIDGVSLTVNTVDDDGFSVNIIPHTLAKTTLAGKKAG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D++NIE D + +Y+ RL    
Sbjct: 176 DVVNIETDILAKYVERLLRHR 196


>gi|237756117|ref|ZP_04584691.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691721|gb|EEP60755.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 210

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 119/204 (58%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GKI A+     G++++V  +     +KLG S+A  G+CLTVV + +     
Sbjct: 1   MFTGLIEEVGKISAINKKDDGLKIKVECNKILDDIKLGDSVAVNGVCLTVVNIDK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  + EV  ET + +N     I  ++NLER++    RL GH+V GH+D T EI  +  +G
Sbjct: 56  NSLDFEVSNETIKRSNFKFLKINEYVNLERAMTPSSRLGGHIVQGHVDTTGEITSITNLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++  P   +  +  KGS+ ++G+SLT+N + +N  D+ +I HT E T  K  KVG
Sbjct: 116 KHTNIKIRFPSEYDYLVIEKGSIAIDGISLTINYINENVIDLNIIPHTWENTNLKYRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+A++  L   +
Sbjct: 176 DIVNIEFDILGKYVAKMLNLGKQK 199


>gi|50083527|ref|YP_045037.1| riboflavin synthase subunit alpha [Acinetobacter sp. ADP1]
 gi|49529503|emb|CAG67215.1| riboflavin synthase alpha chain [Acinetobacter sp. ADP1]
          Length = 219

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 116/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G++ ++  +   +RLR+ T  + S + LG SIA  GICLTV+   +     
Sbjct: 1   MFTGIIESLGQVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNGICLTVIEWGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWY  +V  E+   T +  W +G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  NWYAADVSRESLNRTTLGQWKVGQPVNVEKAMLPTTRFGGHIVSGHVDAVGEITLVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGSV ++G+SLT+N +  N   + LI HT E T     K G
Sbjct: 116 RSIYYEVTAPAEIAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHTAERTNISTWKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SKVNLEVDVLARYIERLLLGDKA 198


>gi|70732822|ref|YP_262589.1| riboflavin synthase subunit alpha [Pseudomonas fluorescens Pf-5]
 gi|68347121|gb|AAY94727.1| riboflavin synthase, alpha subunit [Pseudomonas fluorescens Pf-5]
          Length = 220

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + + +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLADVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  E++  +  
Sbjct: 56  GDGFWADVSRETLDCTAFHQLKAGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVVAREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRIRAPKELAKYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLAETIMADYRP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRQVNLEVDLLARYLERLLLGDKA 199


>gi|88856441|ref|ZP_01131099.1| riboflavin synthase subunit alpha [marine actinobacterium PHSC20C1]
 gi|88814308|gb|EAR24172.1| riboflavin synthase subunit alpha [marine actinobacterium PHSC20C1]
          Length = 207

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 76/200 (38%), Positives = 118/200 (59%), Gaps = 5/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+++ +     G+RL V      S    G SI+ +G+CLTVV         
Sbjct: 1   MFTGIIEELGEVVDLAATNDGVRLTVRAPQAVSDAGHGDSISVSGVCLTVVD-----QGP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+  +V   T  ++ + S   G+ +N+ER++++GDRL GH+V GHIDGT  +L +   G
Sbjct: 56  DWFTADVMGVTLDMSTLGSLAAGSRVNIERAMQVGDRLGGHIVQGHIDGTSTVLSVTDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SL   L   +A KGS+ ++GVSLTV+ VG+++F+V LI  T+  TT     VG
Sbjct: 116 SWNILRFSLTDELAPLVARKGSIAVHGVSLTVSAVGRDWFEVSLIPETLTATTLGALAVG 175

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +NIE D + R++AR+   
Sbjct: 176 DSVNIETDILARHVARMAEF 195


>gi|307317769|ref|ZP_07597207.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti AK83]
 gi|306896531|gb|EFN27279.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti AK83]
          Length = 206

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 111/204 (54%), Positives = 143/204 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G++LRV T+Y+   + LG S+AHAGICLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLEEGIKLRVATNYDPQTIDLGASVAHAGICLTVTSLPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIADWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +F+A KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EAVRFRLRAPEHLAKFVAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLEVTTWGERKSG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N EVD+M RY ARL      +
Sbjct: 181 DLVNFEVDTMARYAARLAEFPAPK 204


>gi|158313559|ref|YP_001506067.1| riboflavin synthase subunit alpha [Frankia sp. EAN1pec]
 gi|158108964|gb|ABW11161.1| riboflavin synthase, alpha subunit [Frankia sp. EAN1pec]
          Length = 227

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 76/221 (34%), Positives = 107/221 (48%), Gaps = 22/221 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRL------- 53
           MFTGIV ++G + A+ P      L V        +  G S+A  G+CLTV          
Sbjct: 1   MFTGIVEELGVVTAIEPRHDAASLTVECHGVLDDVTHGASVAVNGVCLTVTSFVHPPDGA 60

Query: 54  ---------SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVS 104
                        +    +  +V  ET R + +    +G  +NLER V+L DRL GHLV 
Sbjct: 61  AGGDVSGPAGSSGTAAGGFTADVMLETLRRSALGDLSVGDRVNLERPVRLSDRLGGHLVQ 120

Query: 105 GHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV------GKN 158
           GH+DG   +L           R+SLP  L++++  KGSV ++GVSLTV  V         
Sbjct: 121 GHVDGVGVVLERVPAEHWEVVRVSLPPGLDRYLVEKGSVTVDGVSLTVVDVRAAAGGEPA 180

Query: 159 FFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            F V LI  T+  TT     VGD +NIEVD + +Y+ +L+A
Sbjct: 181 SFSVSLIPTTLAVTTLGTRAVGDKVNIEVDVVAKYVEKLHA 221


>gi|313773158|gb|EFS39124.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL074PA1]
 gi|313800983|gb|EFS42251.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA2]
 gi|313808723|gb|EFS47177.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL087PA2]
 gi|313810308|gb|EFS48024.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL083PA1]
 gi|313812184|gb|EFS49898.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL025PA1]
 gi|313817903|gb|EFS55617.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL046PA2]
 gi|313819815|gb|EFS57529.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL036PA1]
 gi|313823305|gb|EFS61019.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL036PA2]
 gi|313824947|gb|EFS62661.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL063PA1]
 gi|313828279|gb|EFS65993.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL063PA2]
 gi|313830201|gb|EFS67915.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL007PA1]
 gi|313833123|gb|EFS70837.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL056PA1]
 gi|313838063|gb|EFS75777.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL086PA1]
 gi|314960752|gb|EFT04853.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL002PA2]
 gi|314963427|gb|EFT07527.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL082PA1]
 gi|314968930|gb|EFT13028.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL037PA1]
 gi|314972941|gb|EFT17037.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL053PA1]
 gi|314975460|gb|EFT19555.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL045PA1]
 gi|314979408|gb|EFT23502.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL072PA2]
 gi|314984253|gb|EFT28345.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA1]
 gi|314986171|gb|EFT30263.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA2]
 gi|314988783|gb|EFT32874.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA3]
 gi|315077276|gb|EFT49338.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL053PA2]
 gi|315079955|gb|EFT51931.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL078PA1]
 gi|315083283|gb|EFT55259.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL027PA2]
 gi|315086944|gb|EFT58920.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL002PA3]
 gi|315089870|gb|EFT61846.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL072PA1]
 gi|315096642|gb|EFT68618.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL038PA1]
 gi|315106175|gb|EFT78151.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL030PA1]
 gi|327325059|gb|EGE66865.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL096PA3]
 gi|327325314|gb|EGE67119.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL096PA2]
 gi|327332328|gb|EGE74064.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL097PA1]
 gi|327443829|gb|EGE90483.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL043PA1]
 gi|327449141|gb|EGE95795.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL043PA2]
 gi|327449257|gb|EGE95911.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL013PA2]
 gi|328756398|gb|EGF70014.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL020PA1]
 gi|328761072|gb|EGF74622.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL099PA1]
          Length = 204

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 181 DEVNVEVDIIAKYLEALTNKERS 203


>gi|313763121|gb|EFS34485.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL013PA1]
 gi|313814723|gb|EFS52437.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL059PA1]
 gi|314914449|gb|EFS78280.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL005PA4]
 gi|314917773|gb|EFS81604.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL050PA1]
 gi|314919501|gb|EFS83332.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL050PA3]
 gi|314930093|gb|EFS93924.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL067PA1]
 gi|314957062|gb|EFT01167.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL027PA1]
 gi|314957696|gb|EFT01799.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL002PA1]
 gi|315097871|gb|EFT69847.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL059PA2]
 gi|315100735|gb|EFT72711.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL046PA1]
 gi|327451323|gb|EGE97977.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL087PA3]
 gi|327452163|gb|EGE98817.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL083PA2]
 gi|328752419|gb|EGF66035.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL087PA1]
 gi|328755094|gb|EGF68710.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL025PA2]
          Length = 204

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 181 DEVNVEVDIIAKYLEALTNKERS 203


>gi|50843211|ref|YP_056438.1| riboflavin synthase subunit alpha [Propionibacterium acnes
           KPA171202]
 gi|289424986|ref|ZP_06426765.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK187]
 gi|289427692|ref|ZP_06429404.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J165]
 gi|50840813|gb|AAT83480.1| riboflavin synthase alpha chain [Propionibacterium acnes KPA171202]
 gi|289154685|gb|EFD03371.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK187]
 gi|289159183|gb|EFD07375.1| riboflavin synthase, alpha subunit [Propionibacterium acnes J165]
 gi|332676150|gb|AEE72966.1| riboflavin synthase alpha chain RibE [Propionibacterium acnes 266]
          Length = 199

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 1   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 58  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 116 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 176 DEVNVEVDIIAKYLEALTNKERS 198


>gi|15964964|ref|NP_385317.1| riboflavin synthase subunit alpha [Sinorhizobium meliloti 1021]
 gi|307301035|ref|ZP_07580804.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti BL225C]
 gi|15074143|emb|CAC45790.1| Probable riboflavin synthase alpha chain [Sinorhizobium meliloti
           1021]
 gi|20385602|gb|AAM21352.1| riboflavin synthase [Sinorhizobium meliloti]
 gi|306903990|gb|EFN34576.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti BL225C]
          Length = 206

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 112/204 (54%), Positives = 143/204 (70%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +TP+ +G++LRV T+Y+   + LG S+AHAGICLTV  L E  S +
Sbjct: 1   MFTGIITDIGTVEKVTPLEEGIKLRVATNYDPQTIDLGASVAHAGICLTVTSLPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T IA W  GT INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTIADWREGTRINLERSLKIGDELGGHIVSGHVDGKAEILAVEAEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL  P +L +FIA KGSV L+G SLTVN V    FDVLLIRH++E TTW   K G
Sbjct: 121 EAVRFRLRAPEHLAKFIAPKGSVALDGTSLTVNKVDGVEFDVLLIRHSLEVTTWGERKSG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N EVD+M RY ARL      +
Sbjct: 181 DLVNFEVDTMARYAARLAEFPAPK 204


>gi|317131625|ref|YP_004090939.1| riboflavin synthase, alpha subunit [Ethanoligenens harbinense
           YUAN-3]
 gi|315469604|gb|ADU26208.1| riboflavin synthase, alpha subunit [Ethanoligenens harbinense
           YUAN-3]
          Length = 212

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 112/198 (56%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I ++        L V  S     ++LG SIA  G+CLT   L+E     
Sbjct: 1   MFTGIIEEVGIIRSIQKSGCSAVLTVGASAVLDGLRLGDSIAVNGVCLTATSLAE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +V  ET   +N+ +  +G  +NLER++ L  R  GH+V+GHIDGT  I  +    
Sbjct: 56  DFFSADVIHETAARSNLLNRNVGGTVNLERAMPLDGRFGGHIVAGHIDGTGVISKVQKDE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    ++ +++  KGSV ++G+SLTV  V K  F V +I HT   TT    +VG
Sbjct: 116 NAIWFTVRTSPSILRYVIEKGSVAVDGISLTVAGVTKQDFSVSVIPHTARNTTLGEKRVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +Y+ +L 
Sbjct: 176 DTVNLENDCIGKYVEKLL 193


>gi|121533689|ref|ZP_01665516.1| riboflavin synthase, alpha subunit [Thermosinus carboxydivorans
           Nor1]
 gi|121307680|gb|EAX48595.1| riboflavin synthase, alpha subunit [Thermosinus carboxydivorans
           Nor1]
          Length = 218

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 76/202 (37%), Positives = 113/202 (55%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  +   AK +RL V        +K+G SIA  G CLTVV   E     
Sbjct: 1   MFTGLVEELGQVKVVARGAKSIRLTVTARKVLDDVKIGDSIAVNGTCLTVVEFGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+  +V  ET   T +A    G  +NLER+++LGDRL GH+V+GHIDG   I   +   
Sbjct: 56  NWFTADVMPETVARTVLAHLKPGDAVNLERTLRLGDRLGGHIVTGHIDGIGYIQAKERSD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+     + ++I  KGSV ++GVSLTV   G ++F V LI HT   TT  +   G
Sbjct: 116 NAVIVRIGAGPEVMRYIVRKGSVAIDGVSLTVIDYGSDWFTVSLIPHTAAVTTVGLKGTG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+E D + +Y+ +L     
Sbjct: 176 APVNLEADIIGKYVEKLLGQKE 197


>gi|295131276|ref|YP_003581939.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK137]
 gi|291375341|gb|ADD99195.1| riboflavin synthase, alpha subunit [Propionibacterium acnes SK137]
          Length = 199

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 75/203 (36%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 1   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +   G G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 58  --FGCDVMAETLNRTALGGLGPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 116 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 176 DEVNVEVDIIAKYLEALTNKERS 198


>gi|154253351|ref|YP_001414175.1| riboflavin synthase subunit alpha [Parvibaculum lavamentivorans
           DS-1]
 gi|154157301|gb|ABS64518.1| riboflavin synthase, alpha subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 208

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 94/210 (44%), Positives = 123/210 (58%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+       R  + T+Y T  + +G SIA AG CLTVV    + S  
Sbjct: 1   MFTGIITDVGRIRAVEKRGD-ARFVIGTAYGTDGIDIGASIACAGCCLTVVEKGRDSS-G 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V+V AE+   T +  W  GT +NLER++K GD L GH+VSGH+DG   I  +   G
Sbjct: 59  DWFAVDVSAESLTCTTLGGWAEGTRVNLERALKAGDELGGHIVSGHVDGICHIREIRPEG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF---------FDVLLIRHTIEE 171
           DSM      P +L +FIA KGSV LNG SLTVN V             F V +I HT   
Sbjct: 119 DSMRFVFEAPGDLGRFIAPKGSVTLNGTSLTVNEVEDRKAGGNAGSTLFGVNIIPHTQAV 178

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           TTW M K GD +N+E+D + RY+ARL   +
Sbjct: 179 TTWGMAKAGDPVNLEIDMLARYVARLVQKD 208


>gi|217978261|ref|YP_002362408.1| riboflavin synthase, alpha subunit [Methylocella silvestris BL2]
 gi|217503637|gb|ACK51046.1| riboflavin synthase, alpha subunit [Methylocella silvestris BL2]
          Length = 207

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 90/204 (44%), Positives = 126/204 (61%), Gaps = 1/204 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+++D+G+I  + P     R R++ SY    + +G SIA +G CLTVV        D
Sbjct: 1   MFTGLISDVGQIAHIEPRGALRRARIICSYPFHTIAIGASIACSGPCLTVVDAGALGG-D 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EV+V AET   T  ++W  G  +NLERS+K+GD L GH+V+GH+DGT EI+++D   
Sbjct: 60  AWFEVDVAAETLARTTASAWTSGDRVNLERSLKIGDELGGHIVTGHVDGTAEIIWIDDFD 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 +  P  L +FIA KGS+ L+G SLTVN V  + F VLLI HT++ TTW   + G
Sbjct: 120 GMKRFAIRAPRQLSRFIAEKGSIALDGTSLTVNAVEGDVFSVLLIPHTLKVTTWGDRRAG 179

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           + +N+EVD M RY ARL      +
Sbjct: 180 EAVNLEVDLMARYAARLTEAAKEE 203


>gi|309810722|ref|ZP_07704530.1| riboflavin synthase, alpha subunit [Dermacoccus sp. Ellin185]
 gi|308435353|gb|EFP59177.1| riboflavin synthase, alpha subunit [Dermacoccus sp. Ellin185]
          Length = 218

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 70/201 (34%), Positives = 105/201 (52%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G +  +   A    L +  +        G SIA  G+CLTV    E+    
Sbjct: 1   MFTGIIEATGTLERIEHTADAAILTIAGAAVLDDAHHGDSIAVNGVCLTVTTFDEQR--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T++ +   G+ +NLER++    R  GH+V GH+D TV I  ++   
Sbjct: 58  --FSVDVMKETLDRTSLGALVPGSRVNLERAMSAQARFGGHVVQGHVDATVRITAIEPGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R  LP +L  ++  KGSV L+GVSLTV    +  F V LI  T+E TT+   +VG
Sbjct: 116 RWSVVRFDLPVDLAPYVVEKGSVTLDGVSLTVASRQEASFSVSLIPTTLELTTFGAARVG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
            L+N+EVD + +Y+ ++ A  
Sbjct: 176 GLVNVEVDVLAKYVEQMLAPR 196


>gi|114562214|ref|YP_749727.1| riboflavin synthase subunit alpha [Shewanella frigidimarina NCIMB
           400]
 gi|114333507|gb|ABI70889.1| riboflavin synthase, alpha subunit [Shewanella frigidimarina NCIMB
           400]
          Length = 219

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 119/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + +KLG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEALGTLRKIDRKGNDIRLTVASGKLDLTDVKLGDSIATNGVCLTVVE-----RL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  + + +G  +NLE++V    RL GH+VSGH+DG  ++    + 
Sbjct: 56  GDGYVADISAETVDLTGFSHYQVGQKVNLEKAVTATTRLGGHMVSGHVDGIAKVEQCAYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS+P  L ++IA KGS+ ++GVSLTVN V    F + ++ HT  ETT    KV
Sbjct: 116 GKALEFWLSVPAQLSRYIAHKGSITIDGVSLTVNEVDGARFRLTIVPHTAGETTLVDLKV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +NIEVD + RY+ RL     +
Sbjct: 176 GDSVNIEVDLIARYLERLMQPEAN 199


>gi|302382997|ref|YP_003818820.1| riboflavin synthase, subunit alpha [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193625|gb|ADL01197.1| riboflavin synthase, alpha subunit [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 196

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 89/196 (45%), Positives = 122/196 (62%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG++ ++   A+  R  V T+++ S + LG SI+HAG CLTVV   E     
Sbjct: 1   MFTGIITDIGRVRSVAETARDRRYEVETAWDVSGIDLGASISHAGCCLTVVEKGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  WG GT +NLER+ K+GD L GH+VSGH+DG   ++ +   G
Sbjct: 56  GWFAVEVSGETLDKTTLGRWGTGTPVNLERATKVGDELGGHIVSGHVDGLGTVVEITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    L  P  L ++IA KGS+ ++GVSLTVN V    F + +I HT E TT     VG
Sbjct: 116 GSHRLTLEAPAPLHRYIAAKGSITVDGVSLTVNSVDGQRFGLNIIPHTWEATTLGRLSVG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +N+E+D + RY+AR
Sbjct: 176 DPVNLEIDMLARYLAR 191


>gi|212634189|ref|YP_002310714.1| riboflavin synthase subunit alpha [Shewanella piezotolerans WP3]
 gi|212555673|gb|ACJ28127.1| Lumazine-binding protein [Shewanella piezotolerans WP3]
          Length = 221

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGHLRKVERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVE-----QL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADISAETVSLTGFAHYAVGTAVNLEKAVTPTTRLGGHMVSGHVDGIAHVDDRQVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLTPPAELGRYIAHKGSITIDGVSLTVNEVQGHRFRLTIVPHTAGETTLIDLKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL + ++ Q
Sbjct: 176 GDSVNIEVDLIARHLERLMSYSSEQ 200


>gi|296117960|ref|ZP_06836543.1| riboflavin synthase, alpha subunit [Corynebacterium ammoniagenes
           DSM 20306]
 gi|295969191|gb|EFG82433.1| riboflavin synthase, alpha subunit [Corynebacterium ammoniagenes
           DSM 20306]
          Length = 204

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 64/198 (32%), Positives = 113/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + GKI+ +  +   +R+ +     TS   LG SI+  G+CLTV  L       
Sbjct: 1   MFTGLVEEKGKIVRLEELGDSIRMSIEAPVVTSDATLGDSISVNGVCLTVAELE-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++  E+   + +      + +NLER++    RL GH+V GH+DGT +++      
Sbjct: 56  SVFVADIMQESLNRSALGQLDQDSAVNLERALLPTTRLGGHIVQGHVDGTSKLISRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R  LP +L++++  KGS+ ++G SLT++ +G ++F+V LI  T++ET      VG
Sbjct: 116 HWEVLRFELPQDLDRYVVGKGSIAISGTSLTISALGSDWFEVSLIPVTLQETILGDLSVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           DL+N+EVD + +Y+ ++ 
Sbjct: 176 DLVNLEVDVLAKYVEKMV 193


>gi|114704831|ref|ZP_01437739.1| riboflavin synthase subunit alpha [Fulvimarina pelagi HTCC2506]
 gi|114539616|gb|EAU42736.1| riboflavin synthase subunit alpha [Fulvimarina pelagi HTCC2506]
          Length = 202

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 105/199 (52%), Positives = 138/199 (69%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I++   + KG R RV T+Y+ + + LG SIA +GICLTV   SE     
Sbjct: 1   MFTGIVTDVGRILSSETLPKGRRFRVETTYDCAGIDLGASIACSGICLTVTGFSEAGDTR 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T   +WG GT INLERS+K+GD L GHLVSGH+DG  +I+ ++  G
Sbjct: 61  RWFEVEAWEEALRLTTAGTWGEGTRINLERSLKIGDELGGHLVSGHVDGLADIVAIEEEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  RL      ++FIA KGSVCL+G SLTVN V    FDVLLIRH++E TTW   +VG
Sbjct: 121 EAVRFRLRAGEGEKRFIAQKGSVCLDGTSLTVNSVQDAEFDVLLIRHSLEVTTWAERRVG 180

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY ARL+ 
Sbjct: 181 DRVNLEVDQIARYAARLFG 199


>gi|319405759|emb|CBI79382.1| Riboflavin synthase alpha chain [Bartonella sp. AR 15-3]
          Length = 205

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 104/204 (50%), Positives = 137/204 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLTVV  + + +V 
Sbjct: 1   MFTGIITDIGCVEDIQPLKQGIRLNISTHYDVESLEIGASIACSGICLTVVERTSKPTVA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + VE W ET  +TN+  W  GTFINLERS++LGD + GHLV GHIDG  EIL     G
Sbjct: 61  HCFTVEAWEETLCLTNLTQWTKGTFINLERSLRLGDEVAGHLVFGHIDGLAEILEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L  P  L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DATRFHLQAPMKLAPFIAEKGSIALNGTSLTVNYIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + RY+ARL     ++
Sbjct: 181 DQVNLEVDQLARYVARLSDFKMNK 204


>gi|298291640|ref|YP_003693579.1| riboflavin synthase, subunit alpha [Starkeya novella DSM 506]
 gi|296928151|gb|ADH88960.1| riboflavin synthase, alpha subunit [Starkeya novella DSM 506]
          Length = 196

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 92/201 (45%), Positives = 119/201 (59%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  + P     RL + + Y+T+ ++LG SIA +G+CLTVV L       
Sbjct: 1   MFTGIVTDIGTLRRVEPRNDVRRLTIASRYDTATIELGASIACSGVCLTVVALQP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EVE   ET  +T    W  G  +NLER++K+GD L GH+V GH+DG   ++  + IG
Sbjct: 56  DAFEVEAAPETLAVTTARDWTEGRRLNLERALKIGDELGGHVVQGHVDGVATVIAREDIG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++       P  L  FIAVKGSV L+G SLTVN V    F  LLI HT+  TTW     G
Sbjct: 116 ETTRFVFDAPEALAPFIAVKGSVTLDGTSLTVNEVDGTRFSCLLIPHTLAHTTWGDVHAG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD M RY ARL    
Sbjct: 176 DHVNIEVDMMARYAARLAEFR 196


>gi|297567807|ref|YP_003686778.1| hypothetical protein Mesil_3463 [Meiothermus silvanus DSM 9946]
 gi|296852256|gb|ADH65270.1| putative hypothetical protein [Meiothermus silvanus DSM 9946]
          Length = 199

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A     +   + +        +++G S+A +G CLTVV    E    
Sbjct: 1   MFTGIVEEVGQVVAARQAGENRVVTIHARKVVEDLRVGDSVACSGACLTVVACEPE---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET   T    W +G  +NLER+++   RL GH+V+GH+DGT ++  +    
Sbjct: 57  -GFTVELSQETLAKTAPR-WSVGARLNLERALRADGRLGGHVVTGHVDGTGKVRGVRPNP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +M   + +P  L  ++  KGSVC++GVSLTV  V +  F V LI HT+  TT    + G
Sbjct: 115 GAMEVTIQVPQGLRPYLVPKGSVCVDGVSLTVVEVKEEAFSVWLIPHTLAVTTLGQLEPG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
            ++N+E D + +Y+ R+     
Sbjct: 175 AVVNLEADILAKYLERMLEARE 196


>gi|262072908|dbj|BAI47762.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 99/203 (48%), Positives = 132/203 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+  W  GTF+NLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLVQWIKGTFVNLERSLRLGDEMGGHLVFGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+ L   
Sbjct: 181 DRVNLEIDQLARYAAKLFTLKRE 203


>gi|222148206|ref|YP_002549163.1| riboflavin synthase subunit alpha [Agrobacterium vitis S4]
 gi|221735194|gb|ACM36157.1| riboflavin synthase alpha chain [Agrobacterium vitis S4]
          Length = 204

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 108/203 (53%), Positives = 139/203 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  + P+ +G++LR++T+Y+   + +G SIAH+G CLTV  L E  S  
Sbjct: 2   MFTGIVTDIGTVEDIVPLKEGVKLRIVTAYDPHTIDMGASIAHSGTCLTVTGLPEAGSNA 61

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I SW  GT INLERS+K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 62  RWFEVEAWEEALRLTTIGSWQKGTRINLERSLKIGDELGGHIVSGHVDGKAEILAIKAEG 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L +P NL +F+A KGSV L+G SLTVN V    FD+LLIRHT+E TTW   +VG
Sbjct: 122 DATRFTLRVPENLARFVAPKGSVALDGTSLTVNGVEGCDFDILLIRHTLEVTTWGDRQVG 181

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD+M RY ARL     +
Sbjct: 182 DFVNFEVDTMARYAARLAEFPKA 204


>gi|56696636|ref|YP_166997.1| riboflavin synthase subunit alpha [Ruegeria pomeroyi DSS-3]
 gi|56678373|gb|AAV95039.1| riboflavin synthase, alpha subunit [Ruegeria pomeroyi DSS-3]
          Length = 195

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG ++ +      +R R+ T Y+TS + +G SIA  G+CLTV+ L       
Sbjct: 1   MFTGIVTDIGTVVELEQRGD-LRARIRTGYDTSGIDIGASIASDGVCLTVIALGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+VE+ AET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVEISAETVSKTNLGGWSVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVAMADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPADLARFIAPKGSVALNGTSLTVNAVEGAEFGINFIPHTKEATTWGGVAVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY+ARL
Sbjct: 175 DRVNLEIDMLARYVARL 191


>gi|323141089|ref|ZP_08075994.1| riboflavin synthase, alpha subunit [Phascolarctobacterium sp. YIT
           12067]
 gi|322414465|gb|EFY05279.1| riboflavin synthase, alpha subunit [Phascolarctobacterium sp. YIT
           12067]
          Length = 216

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G +  +    +   L V        +K+G S+A  G CLTVV +      D
Sbjct: 1   MFTGLVAELGTVQKLAQQGESYHLTVAAVKVLQNLKIGDSVAVNGACLTVVSMD-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R+TNI S   G  +NLER+++L D LDGH+VSGH++G   I      G
Sbjct: 56  TAFTADVMPETVRLTNIGSLHAGDRVNLERTLRLCDGLDGHIVSGHVEGLGVIAGRRPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +M   ++ P  L ++I  KGS+ ++G+SLTV  V ++ F V LI HT +ETT     VG
Sbjct: 116 IAMVVTINTPPELLKYIIKKGSIAIDGISLTVTQVTESSFSVSLIPHTAKETTLGFKDVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ ++   N  Q
Sbjct: 176 DSVNLETDIVGKYVEQMLKFNPKQ 199


>gi|117919546|ref|YP_868738.1| riboflavin synthase subunit alpha [Shewanella sp. ANA-3]
 gi|117611878|gb|ABK47332.1| riboflavin synthase, alpha subunit [Shewanella sp. ANA-3]
          Length = 218

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLAAPTELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + RY+ RL   +T +
Sbjct: 176 GDKVNIEVDLIARYLERLMRFDTKE 200


>gi|325282060|ref|YP_004254602.1| riboflavin synthase, alpha subunit [Odoribacter splanchnicus DSM
           20712]
 gi|324313869|gb|ADY34422.1| riboflavin synthase, alpha subunit [Odoribacter splanchnicus DSM
           20712]
          Length = 212

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 117/204 (57%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGKI ++   +K + L V      +  ++G SIA  G+CLTVV        +
Sbjct: 1   MFTGIIEEIGKIKSVKRGSKSVVLEVEARKVLADTRIGDSIATNGVCLTVV-----GKGN 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +N+     G  +NLER++ L  RL GHLV+GH+DGT +I+      
Sbjct: 56  DGFSADVMPETMNRSNLGLLKPGDPVNLERALCLNSRLGGHLVAGHVDGTGKIVSKQQDE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGSV ++GVSLT+    +  F V +I HT EETT    ++G
Sbjct: 116 NAIWLTVGAAPEILRYIVEKGSVAIDGVSLTIAYADEQVFKVSVIPHTQEETTLVKKEIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++N+E D +++Y+ +L      +
Sbjct: 176 DVVNLENDMIVKYVEKLMGQGKPK 199


>gi|319784161|ref|YP_004143637.1| riboflavin synthase subunit alpha [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170049|gb|ADV13587.1| riboflavin synthase, alpha subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 205

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 97/203 (47%), Positives = 133/203 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G + ++ P+ +G+ LR+ T+Y+   + +G SI+  G+CLTV  L +  S  
Sbjct: 1   MFTGIVTDVGTVASVKPLREGVGLRIDTAYDPQTIAIGASISCGGVCLTVTALPDSVSNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T  + W  GT +NLER++K+GD L GH+VSGH+DG  EI+     G
Sbjct: 61  RWFEVEAWEEALRLTTASGWKSGTKVNLERALKIGDELGGHIVSGHVDGMAEIIERKDEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P +L +FIA KGSV L+G SLTVN V    FDVLLI H++  TTW   KVG
Sbjct: 121 DAVRFTLEAPRDLAKFIAPKGSVALDGTSLTVNKVEGARFDVLLIHHSLTVTTWGERKVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D+M RY ARL      
Sbjct: 181 DRVNLEIDTMARYAARLVEATKE 203


>gi|188996125|ref|YP_001930376.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931192|gb|ACD65822.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 210

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 117/204 (57%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GKI A+     G++++V  +     +KLG S+A  G+CLTV  + +     
Sbjct: 1   MFTGLIEEVGKISAINKKNDGLKIKVECNKILDDIKLGDSVAVNGVCLTVANIDK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  + EV  ET + +N     I  ++NLER++    RL GH+V GH+D T EI  +  +G
Sbjct: 56  NSLDFEVSNETIKRSNFKFLKINEYVNLERAMTPSSRLGGHIVQGHVDTTGEITSITNLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++  P   +  +  KGS+ ++G+SLT+N V  N  D+ +I HT E T  K  KVG
Sbjct: 116 KHTNIKIKFPSEYDYLVIEKGSIAIDGISLTINYVNDNVIDLNIIPHTWENTNLKYRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+A++  L   +
Sbjct: 176 DIVNIEFDILGKYVAKMLNLGKQK 199


>gi|85710329|ref|ZP_01041394.1| riboflavin synthase subunit alpha [Erythrobacter sp. NAP1]
 gi|85689039|gb|EAQ29043.1| riboflavin synthase subunit alpha [Erythrobacter sp. NAP1]
          Length = 207

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 83/209 (39%), Positives = 120/209 (57%), Gaps = 7/209 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG I  +      +RLRV    + +++ +G SIA +G+CLTVV    E   D
Sbjct: 1   MFTGIVTAIGTIANVDQRGD-IRLRVNAPLDPARIDIGASIACSGVCLTVVERGGEKG-D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V+V  ET   T    W  G  IN+E S+++GD L GH+V+GH+D    ++  + +G
Sbjct: 59  AWFDVDVSGETVSRTYAGMWNEGARINIEPSLRVGDELGGHIVTGHVDSVGTVVKAEEVG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
           DS    +     +  FIA KGS+ +NGVSLTVN V     G   F + +I HT E TT  
Sbjct: 119 DSWRIAIRARAEMSPFIAEKGSITVNGVSLTVNDVRDRSDGTCDFMLNIIPHTAEVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTSQ 204
             K GD +N+E+D + RY+ R+  L  ++
Sbjct: 179 DLKEGDEVNLEIDVLARYLKRMQGLAATR 207


>gi|169659018|dbj|BAG12718.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 101/203 (49%), Positives = 134/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIPFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+ L   
Sbjct: 181 DRVNLEIDQLARYAAKLFTLKRE 203


>gi|104779849|ref|YP_606347.1| riboflavin synthase subunit alpha [Pseudomonas entomophila L48]
 gi|95108836|emb|CAK13532.1| riboflavin synthase alpha chain [Pseudomonas entomophila L48]
          Length = 221

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I +MTP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGTIRSMTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + T +     G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSVETLKRTAMVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVDGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|257055602|ref|YP_003133434.1| riboflavin synthase, alpha subunit [Saccharomonospora viridis DSM
           43017]
 gi|256585474|gb|ACU96607.1| riboflavin synthase, alpha subunit [Saccharomonospora viridis DSM
           43017]
          Length = 208

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  + P A+  RL V     T   + G SIA  G+CLTVV  +     D
Sbjct: 1   MFTGIVEELGEVTRVEPNAEATRLTVRGPVVTQDARHGDSIAVNGVCLTVVDTT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET + T++     G  +NLER++    R  GH+V GH+DGT   L  D  G
Sbjct: 56  DEFTVDVVPETLQRTSLNGIEPGRLVNLERAMSADGRFGGHVVQGHVDGTGTFLSRDHDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +     P +L +++  KGS+ ++GVSLTV  V    F V LI  T+  TT   ++ G
Sbjct: 116 LAHFA---YPPSLSRYLVEKGSIAVDGVSLTVARVTDQEFAVALIPTTLRATTLGRNQPG 172

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + +Y+ +L A++ ++
Sbjct: 173 DSVNLEVDVLAKYVEKLAAVHLTR 196


>gi|170719754|ref|YP_001747442.1| riboflavin synthase subunit alpha [Pseudomonas putida W619]
 gi|169757757|gb|ACA71073.1| riboflavin synthase, alpha subunit [Pseudomonas putida W619]
 gi|313496882|gb|ADR58248.1| Riboflavin synthase subunit alpha [Pseudomonas putida BIRD-1]
          Length = 221

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I ++TP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVDGVGEIISRSDS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|26987253|ref|NP_742678.1| riboflavin synthase subunit alpha [Pseudomonas putida KT2440]
 gi|148545800|ref|YP_001265902.1| riboflavin synthase subunit alpha [Pseudomonas putida F1]
 gi|167031577|ref|YP_001666808.1| riboflavin synthase subunit alpha [Pseudomonas putida GB-1]
 gi|24981895|gb|AAN66142.1|AE016242_10 riboflavin synthase, alpha subunit [Pseudomonas putida KT2440]
 gi|148509858|gb|ABQ76718.1| riboflavin synthase, alpha subunit [Pseudomonas putida F1]
 gi|166858065|gb|ABY96472.1| riboflavin synthase, alpha subunit [Pseudomonas putida GB-1]
          Length = 221

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I ++TP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVDGVGEIISRSDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|262072892|dbj|BAI47755.1| riboflavin synthase [Bartonella sp. Okinawa 19-1]
          Length = 205

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 99/203 (48%), Positives = 135/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+R ++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGVRFKISTRYAAESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEEALRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V ++ FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVPKGSVALNGTSLTVNGVEESVFDVLIIRHTLEMTTWGHAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+N+E+D + RY A+L++L   
Sbjct: 181 DLVNLEIDQLARYAAKLFSLKKE 203


>gi|39996789|ref|NP_952740.1| riboflavin synthase subunit alpha [Geobacter sulfurreducens PCA]
 gi|39983677|gb|AAR35067.1| riboflavin synthase, alpha subunit [Geobacter sulfurreducens PCA]
 gi|298505800|gb|ADI84523.1| riboflavin synthase [Geobacter sulfurreducens KN400]
          Length = 217

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 106/203 (52%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D+G    +    +  RL V T+     + LG S+A  G CLTVV         
Sbjct: 1   MFTGLIEDVGTARRLERRGEAARLAVATALPLESVNLGDSVAVNGACLTVVAKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  E+   T I S   G  +NLER+++LGDRL GHLV+GH+D    +     + 
Sbjct: 56  GELTFDVSPESLERTTIGSLATGAPVNLERALRLGDRLGGHLVTGHVDLVATVEGRREVS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++     +     +++  KGSV ++G+SLTVN V  + F V +I HT  +TT +  + G
Sbjct: 116 GNILFTFRMASGFSRYLVAKGSVAVDGISLTVNRVDADSFSVNVIPHTAVKTTLEHLRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + +YI RL    T 
Sbjct: 176 DRVNIETDILGKYIERLLGGGTE 198


>gi|240850689|ref|YP_002972089.1| riboflavin synthase subunit alpha [Bartonella grahamii as4aup]
 gi|169659034|dbj|BAG12726.1| riboflavin synthase [Bartonella grahamii]
 gi|240267812|gb|ACS51400.1| riboflavin synthase subunit alpha [Bartonella grahamii as4aup]
          Length = 205

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 98/203 (48%), Positives = 135/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLDISTRYDIQSLEIGASIACSGICLTIVERGVKQATA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEIGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAIRFYLKVVRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQARIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+AL   
Sbjct: 181 DWVNLEIDQLARYAAKLFALKRE 203


>gi|110835034|ref|YP_693893.1| riboflavin synthase subunit alpha [Alcanivorax borkumensis SK2]
 gi|110648145|emb|CAL17621.1| riboflavin synthase, alpha subunit [Alcanivorax borkumensis SK2]
          Length = 221

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 117/199 (58%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ AMTP    + L + +   + + +KLG SIA  G+CLT   L      
Sbjct: 1   MFTGIIESMGKVAAMTPKGGDVTLLIKSEGLDFADVKLGDSIAVNGVCLTATAL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E +V  ET  +T++A   +G+ +NLE+++    RL GHLVSGH+DG  +I+ +   
Sbjct: 56  GGAFEADVSGETLSLTSLAQISVGSTVNLEKALTPSSRLGGHLVSGHVDGLGKIVEMKQD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P  L ++IA KGS+ ++G+SLTVN V    F + +I HT E TT    KV
Sbjct: 116 ARSVRIDIEAPAELAKYIAHKGSITVDGISLTVNSVAGAVFSLNIIPHTQEVTTIGQWKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTPVNLEVDIIARYLERLL 194


>gi|254451762|ref|ZP_05065199.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 238]
 gi|198266168|gb|EDY90438.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 238]
          Length = 202

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 95/199 (47%), Positives = 129/199 (64%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVR--LSEEHS 58
           MFTGIVTD+G+++A+      +R R+ T Y+ S + +G SIA  G+CLTVV   +  +  
Sbjct: 1   MFTGIVTDVGRVLALENRGD-LRARIATRYDISGIDIGASIASDGVCLTVVAKGVDLDRD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WY+V++ AET   T++A+W +G  +NLERS+K+GD L GH+VSGH+DG   I+ +  
Sbjct: 60  SQGWYDVDISAETVSKTSLAAWAVGKRVNLERSLKVGDELGGHIVSGHVDGVAMIVGMVD 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            G S    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT   TTW   K
Sbjct: 120 DGASTRVTLQAPDDLGRFIAPKGSVALNGTSLTVNEVDGARFGINFIPHTKSVTTWGDAK 179

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD+M RY+ARL
Sbjct: 180 VGDPVNLEVDTMARYVARL 198


>gi|119502841|ref|ZP_01624926.1| riboflavin synthase subunit alpha [marine gamma proteobacterium
           HTCC2080]
 gi|119461187|gb|EAW42277.1| riboflavin synthase subunit alpha [marine gamma proteobacterium
           HTCC2080]
          Length = 218

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  M      +RLRV+T   + S ++LG SIA +G+CLTV  L      
Sbjct: 1   MFTGIIQAVGEIATMETRGGDLRLRVLTGKLDLSDVQLGDSIATSGVCLTVTGL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  E+  +T +     G  +NLE+S+    RL GH+VSGH+DG   ++ +   
Sbjct: 56  GDGYWADVSIESLNLTTLGDRKPGDHVNLEKSLTPTSRLGGHIVSGHVDGVGSVVSVAQE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    +S P  L ++IA KGS+ ++G SLTVN V    FD+ +I  T EET +  ++ 
Sbjct: 116 GRSWRYIISAPPELARYIAHKGSITVDGTSLTVNSVDGAEFDLNIIPQTFEETVFGEYRA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  IN+EVD + RY+ RL   +++
Sbjct: 176 GSRINLEVDVIARYLERLLQGDSA 199


>gi|295399033|ref|ZP_06809015.1| riboflavin synthase, alpha subunit [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110362|ref|YP_003988678.1| riboflavin synthase subunit alpha [Geobacillus sp. Y4.1MC1]
 gi|294978499|gb|EFG54095.1| riboflavin synthase, alpha subunit [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215463|gb|ADP74067.1| riboflavin synthase, alpha subunit [Geobacillus sp. Y4.1MC1]
          Length = 215

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 64/204 (31%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I  M    + + + +        + LG SIA  G+CLTV   ++     
Sbjct: 1   MFTGIIEEVGTIEQMRQSGEAIVMTIGAEKILEDIHLGDSIAVNGVCLTVTSFTQRS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T++ +   G+ +NLER++    R  GH VSGH+DG  EI+    + 
Sbjct: 58  --FTVDVMPETVKATSLRTLTRGSKVNLERAMPASGRFGGHFVSGHVDGVGEIIRKWPVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P  L +++ +KGSV ++G SLT+  +  + F + LI HT   T     + G
Sbjct: 116 NAVYYEIQIPKELRKYMILKGSVAVDGTSLTIFGLTDDTFTISLIPHTRAATILGDKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+A+       +
Sbjct: 176 DIVNIECDVIGKYVAQFMEGQKEE 199


>gi|148264236|ref|YP_001230942.1| riboflavin synthase subunit alpha [Geobacter uraniireducens Rf4]
 gi|146397736|gb|ABQ26369.1| riboflavin synthase, alpha subunit [Geobacter uraniireducens Rf4]
          Length = 215

 Score =  181 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GK++ +        L V  ++   ++ LG SIA  G+CLTV +        
Sbjct: 1   MFTGLIEEVGKVVKLEVTGAAGILTVAAAFPQDEVALGDSIAINGVCLTVTQKG-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + + S   G+ +NLER++ L  RLDGH+VSGH+D    I     I 
Sbjct: 56  GTFGFDVSPETIERSALRSMKNGSPVNLERALPLSGRLDGHIVSGHVDCVATIGDRREIS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      + H   +++A KGSV ++G+SLTVN V ++ F V +I HT   TT K  +VG
Sbjct: 116 GNTVFSFRMAHEYLKYVATKGSVAIDGISLTVNAVAEDGFSVNIIPHTTANTTLKYRQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + +Y+ RL      
Sbjct: 176 DQVNIETDILAKYVERLLTGRGE 198


>gi|119896611|ref|YP_931824.1| riboflavin synthase subunit alpha [Azoarcus sp. BH72]
 gi|119669024|emb|CAL92937.1| riboflavin synthase [Azoarcus sp. BH72]
          Length = 204

 Score =  181 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV   G+I  + P+A G+RL V T   + + +++G SIA++G+CLTV+        
Sbjct: 1   MFSGIVAACGRIERIEPLADGLRLTVDTAGLDLADVQIGDSIANSGVCLTVIERDGPRV- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +V  ET   T +     G  +NLE++++L DRL GHLV+GH+DG  E+L    I
Sbjct: 60  ----RFDVSRETLNCT-VGLDVEGGEVNLEKALQLSDRLGGHLVTGHVDGVGEVLKFAPI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  +  +IA KGSV +NGVSLTVN V    F + LI HT+  T  K  K 
Sbjct: 115 GESHELVIRAPGAIAGYIAKKGSVTVNGVSLTVNRVEGPDFSINLIPHTVAVTNLKHLKA 174

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+E+D + RY+ R+ A    +
Sbjct: 175 GSRVNLEIDLIARYVERMLAWREEE 199


>gi|313673618|ref|YP_004051729.1| riboflavin synthase, alpha subunit [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940374|gb|ADR19566.1| riboflavin synthase, alpha subunit [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 211

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  +    +   L++  S     +++G SIA  G+CLTV +     +  
Sbjct: 1   MFTGIIEEVGTLSRIIRKGENAELQINCSLILEDVRVGDSIAVDGVCLTVTK-----NNG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   T ++S      +NLER++ L  RL GHLV GH+D    +  +   G
Sbjct: 56  NSFIADVSYETISKTTLSSLKNNDKVNLERALTLNSRLGGHLVLGHVDCVGFVKQIKPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S+   +     ++Q+IA KGS+ +NG+SLTV  + + +F V +I HT E TT K  K G
Sbjct: 116 ESIELSIGGFDPIKQYIAKKGSIAINGISLTVADLVEEYFTVAVIPHTFEVTTLKYKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D IN+EVD + RY+ RL     +
Sbjct: 176 DRINLEVDVIARYVERLLQNREN 198


>gi|255325039|ref|ZP_05366145.1| riboflavin synthase, alpha subunit [Corynebacterium
           tuberculostearicum SK141]
 gi|255297604|gb|EET76915.1| riboflavin synthase, alpha subunit [Corynebacterium
           tuberculostearicum SK141]
          Length = 204

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + AM P A  +RL +      ++  LG SIA  G+CLTV  LS      
Sbjct: 1   MFTGLVQELGTVEAMEPHADALRLSIRAPRTVAEAALGDSIAINGVCLTVADLS-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  E+   T +     G  +N+E ++    RL GH++ GH+DGT  +       
Sbjct: 56  DTFCADVMQESLDRTALGRLAEGDPVNVEPALLPTTRLGGHIMQGHVDGTATLQSRTNSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R SLP  L +++  KGS+ ++G SLTV+ VG ++F+V LI  T+ +T      VG
Sbjct: 116 NWDVLRFSLPSELSRYVVEKGSIAVSGTSLTVSAVGPDWFEVSLIPTTLRDTIHGALPVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + +Y+ ++      
Sbjct: 176 GEVNLEVDVLAKYVEKMLHPEAQ 198


>gi|87307878|ref|ZP_01090021.1| riboflavin synthase alpha chain [Blastopirellula marina DSM 3645]
 gi|87289492|gb|EAQ81383.1| riboflavin synthase alpha chain [Blastopirellula marina DSM 3645]
          Length = 200

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 70/198 (35%), Positives = 102/198 (51%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G I+A+T    G+ + V          +G S+A  G CLTV+ +S      
Sbjct: 1   MFTGLVETLGSIVAVTRQGPGVLMLVECGLVAEGAAIGDSVAINGCCLTVIEMS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +    E   ET   TN+     G  +NLER+++ GDRL GH V+GH+DG  ++       
Sbjct: 56  SQLAFEAGEETLSKTNLGRLAGGDAVNLERALRAGDRLGGHYVTGHVDGVGQVDQRQDDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +       +   L   +A KGSV ++GVSLT+  V    F V LI HT+  TT    +VG
Sbjct: 116 EWSKFWFRVAPELALQMAAKGSVAVDGVSLTLVDVEDERFSVALIPHTLSVTTLGGRQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +NIE D + +Y+ R  
Sbjct: 176 DAVNIETDLLAKYVERQL 193


>gi|300781125|ref|ZP_07090979.1| riboflavin synthase subunit alpha [Corynebacterium genitalium ATCC
           33030]
 gi|300532832|gb|EFK53893.1| riboflavin synthase subunit alpha [Corynebacterium genitalium ATCC
           33030]
          Length = 197

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 117/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G +  +  + + +RL V     T+  + G SIA  G+CLTVV      +  
Sbjct: 1   MFTGLVEEVGSVEKLERLDEAVRLTVRGPKVTADAQPGDSIAVDGVCLTVVE-----AAG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   + + S+ +G+ +NLER++  G R+ GH+V GH+DG  E++  +   
Sbjct: 56  DVFTADVMQETLNRSRLGSYEVGSNVNLERALAAGARMGGHIVQGHVDGVGELISRESSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R SLP  L ++I  KGS+ LNG SLTV+ V  ++ +V LI  T+ ETT+    VG
Sbjct: 116 HWDVLRFSLPEQLTRYIVEKGSIALNGTSLTVSAVSADYVEVSLIPTTLAETTFGELAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           + +N+EVD + +Y+ ++ A
Sbjct: 176 EPVNMEVDVVAKYVEKMVA 194


>gi|326773584|ref|ZP_08232867.1| riboflavin synthase, alpha subunit [Actinomyces viscosus C505]
 gi|326636814|gb|EGE37717.1| riboflavin synthase, alpha subunit [Actinomyces viscosus C505]
          Length = 216

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 76/215 (35%), Positives = 111/215 (51%), Gaps = 16/215 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++I +  I    RL V     T  + LG S++  G CLTV  +       
Sbjct: 1   MFTGIVEELGRVIRLETIEDSARLTVEAPTVTQDVSLGDSVSVNGCCLTVTAV-----HG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++ AET   T + S   G  +NLER+++ GDRL GH+V GH+D T E+L      
Sbjct: 56  STFTADLMAETLTRTTLGSQAPGDPVNLERALRAGDRLGGHIVQGHVDATAEVLDHHRGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----------FFDVLLIRHTI 169
                R+ LP  + +++A+KGSV L+GVSLTV  V                 V LI  T+
Sbjct: 116 HWDLLRIGLPQEIARYVAIKGSVALDGVSLTVVDVVDASDVTPVPGAGASLSVGLIPETL 175

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
             TT    + G+ +N+EVD + +Y  RL     SQ
Sbjct: 176 RRTTLGSRRPGERVNLEVDVLAKYAERLLGARPSQ 210


>gi|307825580|ref|ZP_07655798.1| riboflavin synthase, alpha subunit [Methylobacter tundripaludum
           SV96]
 gi|307733466|gb|EFO04325.1| riboflavin synthase, alpha subunit [Methylobacter tundripaludum
           SV96]
          Length = 218

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GKI A+   +   RL + T     + + LG SIA  G+CLT V L +    
Sbjct: 1   MFTGIILAVGKISAIERKSGDCRLTIATGKLPLNDVVLGDSIAVNGVCLTAVELGK---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +++  +V  ET   T + +  +GT +NLE ++    RL GH+VSGH+DG   ++     
Sbjct: 57  -DYFCADVSNETLSRTLLNAATVGTPVNLELALTPTTRLGGHIVSGHVDGIGTVMEKRAD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S   +   P NL ++IA KGS+C+NG+SLTVN V    F V ++ HT++ETT     V
Sbjct: 116 GRSFRFKFKAPDNLAKYIAEKGSICINGISLTVNDVDGAVFSVNIVPHTLKETTLGDAVV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTKVNLEVDLLARYLERLIKGDAA 199


>gi|32034736|ref|ZP_00134867.1| COG0307: Riboflavin synthase alpha chain [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207867|ref|YP_001053092.1| riboflavin synthase subunit alpha [Actinobacillus pleuropneumoniae
           L20]
 gi|165975843|ref|YP_001651436.1| riboflavin synthase subunit alpha [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190149676|ref|YP_001968201.1| riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303252626|ref|ZP_07338789.1| riboflavin synthase subunit alpha [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307245213|ref|ZP_07527304.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307247385|ref|ZP_07529432.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307254159|ref|ZP_07536004.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307256428|ref|ZP_07538210.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307258622|ref|ZP_07540357.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307260858|ref|ZP_07542544.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307262984|ref|ZP_07544606.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|126096659|gb|ABN73487.1| riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165875944|gb|ABY68992.1| riboflavin synthase, alpha chain [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189914807|gb|ACE61059.1| riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648594|gb|EFL78787.1| riboflavin synthase subunit alpha [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306853857|gb|EFM86071.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856082|gb|EFM88238.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306862859|gb|EFM94808.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865058|gb|EFM96959.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306867279|gb|EFM99132.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306869425|gb|EFN01216.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871610|gb|EFN03332.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 215

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GKI  +    +   + +  +     + LG SIA  G+CLTV   S      
Sbjct: 1   MFTGIIEEVGKIAQIHKQGEFAVVTINATKVLQDVHLGDSIAVNGVCLTVTSFSS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT EI  +    
Sbjct: 56  NQFTADVMSETLKRTSLGELKSNSPVNLERAMAANGRFGGHIVSGHIDGTGEIAEITPAH 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S + R+     L ++I  KGS+ ++G+SLTV       F V +I HTI+ET     K+G
Sbjct: 116 NSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHTIKETNLGSKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +YI +      +
Sbjct: 176 SIVNLENDIVGKYIEQFLLKKPA 198


>gi|330888053|gb|EGH20714.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 220

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  ++  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFKVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|157960991|ref|YP_001501025.1| riboflavin synthase subunit alpha [Shewanella pealeana ATCC 700345]
 gi|157845991|gb|ABV86490.1| riboflavin synthase, alpha subunit [Shewanella pealeana ATCC
           700345]
          Length = 221

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV L     +
Sbjct: 1   MFTGIIESVGHLRKVERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVEL-----M 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  + + +G  +NLE++V    RL GH+VSGH+DG   +    F 
Sbjct: 56  SDGYVADISAETVTLTGFSHYQVGKAVNLEKAVTPTTRLGGHMVSGHVDGIAHVDDRQFR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLSPPEELGRYIAHKGSITIDGVSLTVNEVQGHRFRLTIVPHTAGETTLVNLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL +  + +
Sbjct: 176 GDSVNIEVDLIARHLERLMSYGSQE 200


>gi|303249745|ref|ZP_07335949.1| riboflavin synthase subunit alpha [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307251933|ref|ZP_07533834.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302651312|gb|EFL81464.1| riboflavin synthase subunit alpha [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860625|gb|EFM92637.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 215

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GKI  +    +   + +  +     + LG SIA  G+CLTV   S      
Sbjct: 1   MFTGIIEEVGKIAQINKQGEFAVVTINATKVLQDVHLGDSIAVNGVCLTVTSFSS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT EI  +    
Sbjct: 56  NQFTADVMSETLKRTSLGELKSNSPVNLERAMAANGRFGGHIVSGHIDGTGEIAEITPAH 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S + R+     L ++I  KGS+ ++G+SLTV       F V +I HTI+ET     K+G
Sbjct: 116 NSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHTIKETNLGSKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +YI +      +
Sbjct: 176 SIVNLENDIVGKYIEQFLLKKPA 198


>gi|221135085|ref|ZP_03561388.1| riboflavin synthase subunit alpha [Glaciecola sp. HTCC2999]
          Length = 223

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 72/200 (36%), Positives = 113/200 (56%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +      +RL V     + + + LG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGEISQLHNNGSDIRLTVQCHDLDMTDVALGDSIATNGVCLTVVEFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           DN+Y  +V  ET + T  + +  G  +NLE+++    R  GH+VSGH+DG   +  +   
Sbjct: 56  DNYYCADVSQETIKYTGFSDYCTGAKVNLEKAMLPTSRFGGHIVSGHVDGVGHVTKIIDQ 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
              +   + +P  +  +IA KGS+ ++GVSLTVN + ++ F + LI HT+E+T    +KV
Sbjct: 116 QKYIEVWVHMPPEIRHYIAHKGSITVDGVSLTVNEITEDEFMLWLIPHTLEKTVISTYKV 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ RL  
Sbjct: 176 GTRVNLEVDVIARYLERLMQ 195


>gi|24374974|ref|NP_719017.1| riboflavin synthase subunit alpha [Shewanella oneidensis MR-1]
 gi|24349700|gb|AAN56461.1|AE015783_4 riboflavin synthase, alpha subunit [Shewanella oneidensis MR-1]
          Length = 218

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLTDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLAAPTELARYIAHKGSITIDGVSLTVNEVDGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + RY+ RL   ++ +
Sbjct: 176 GDKVNIEVDLIARYLERLMRFDSKE 200


>gi|260575724|ref|ZP_05843721.1| riboflavin synthase, alpha subunit [Rhodobacter sp. SW2]
 gi|259022122|gb|EEW25421.1| riboflavin synthase, alpha subunit [Rhodobacter sp. SW2]
          Length = 200

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 125/197 (63%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG+++A       +R R+ T Y+ + + +G SIA  G+CLTVV +  +    
Sbjct: 1   MFTGIITDIGQVLACDRKGD-LRARIGTRYDVAGIDIGASIACDGVCLTVVAVGSDPQ-- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EV++  ET   TN+  W  G+ +NLER+++LGD L GH+VSGH+DG  E++ L   G
Sbjct: 58  GWFEVQISGETVSKTNLGGWQAGSRVNLERALRLGDELGGHIVSGHVDGLAEVVGLHPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F V  I HT   TTW    +G
Sbjct: 118 DSLRVTFRAPEALAKFIAPKGSVALNGTSLTVNEVEGCDFGVNFIPHTRSATTWGSVALG 177

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD+M RY+ARL
Sbjct: 178 DRVNLEVDTMARYVARL 194


>gi|78043525|ref|YP_360306.1| riboflavin synthase subunit alpha [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995640|gb|ABB14539.1| riboflavin synthase, alpha subunit [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 213

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 64/201 (31%), Positives = 104/201 (51%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  +    + + L V        +KLG SIA  G CLTVV        +
Sbjct: 1   MFTGLVEELGRVREIKKSGESLTLTVEAKTILEDIKLGDSIAVNGTCLTVVNFG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++E +V  ET   TN+     G  +NLER+++  DRL GH+V GH+D    I+ +    
Sbjct: 56  DYFEADVMPETYTKTNLKFLSPGDRVNLERTLRPTDRLGGHIVQGHVDEVGWIVEIRAKE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   ++       Q++  KGSV ++G+SLTV  V  + F V +I HT + TT     +G
Sbjct: 116 IAKIIKIKASEGFLQYLVPKGSVAVDGISLTVVDVYNDSFTVSIIPHTFKNTTLGYKTIG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+E D + +Y+       
Sbjct: 176 SPVNLEADILAKYVFSFIKKQ 196


>gi|257483268|ref|ZP_05637309.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331012490|gb|EGH92546.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 220

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGMGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|313793373|gb|EFS41431.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL110PA1]
 gi|327451700|gb|EGE98354.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL092PA1]
          Length = 204

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL GH+V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGHIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD++ +Y+  L     S
Sbjct: 181 DEVNVEVDTIAKYLEALTNKERS 203


>gi|83593159|ref|YP_426911.1| riboflavin synthase subunit alpha [Rhodospirillum rubrum ATCC
           11170]
 gi|83576073|gb|ABC22624.1| Lumazine-binding protein [Rhodospirillum rubrum ATCC 11170]
          Length = 196

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 81/198 (40%), Positives = 119/198 (60%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI++D+G +  +T      RL   T+Y T  + +G SIA +G CLTV+         
Sbjct: 1   MFTGIISDLGAVREITQAGDT-RLTFSTAYETEGVAIGASIACSGCCLTVIDKGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+   ET   T +  W +G+ +N ER++ +GD L GH+VSGH+DG  E+L +   G
Sbjct: 55  GWFAVQASGETLSKTTLGLWTVGSPVNFERALAVGDELGGHIVSGHVDGVAEVLEVAPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   R  +P +L++FIA KGSV ++GVSLTVN V    F V +I HT + TT+     G
Sbjct: 115 ESHRFRFRVPEDLKKFIAPKGSVAIDGVSLTVNEVEGAVFGVNIIPHTFQATTFGRLAPG 174

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E+D + RY+ARL 
Sbjct: 175 SRVNMEIDMLARYVARLL 192


>gi|329946975|ref|ZP_08294387.1| riboflavin synthase, alpha subunit [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328526786|gb|EGF53799.1| riboflavin synthase, alpha subunit [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 224

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 75/223 (33%), Positives = 109/223 (48%), Gaps = 24/223 (10%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +  +    RL V     T  + LG S++  G CLTV  +       
Sbjct: 1   MFTGIVEELGRVAQLETVEDSARLTVEAPTVTQDVSLGDSVSVNGCCLTVAAVHR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  ++ AET   T + S   G  +NLER+++  DRL GH+V GH+D T E+L      
Sbjct: 56  NTFTADLMAETLTRTTLGSQAPGDPVNLERALRATDRLGGHIVQGHVDATAEVLGRHHGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-------------------FFD 161
                R+ LP  + +++AVKGSV L+GVSLTV  V                         
Sbjct: 116 HWDLLRIGLPQEIARYVAVKGSVTLDGVSLTVVDVDDANEARHDAAPDVSPTLGAGASLS 175

Query: 162 VLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           V LI  T+  TT    + G+ +N+EVD M +Y  RL     S+
Sbjct: 176 VGLIPETLRRTTLGTRRPGERVNLEVDVMAKYAERLLGARLSE 218


>gi|192361915|ref|YP_001983155.1| riboflavin synthase subunit alpha [Cellvibrio japonicus Ueda107]
 gi|190688080|gb|ACE85758.1| riboflavin synthase, alpha subunit [Cellvibrio japonicus Ueda107]
          Length = 219

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG+++A+ P    +RLR+ T   N + + LG SIA  G+CLTVV L      
Sbjct: 1   MFTGIIEAIGEVVALQPQNGDLRLRIKTHHLNLADVHLGDSIATNGVCLTVVDL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  ET   T +  W +G  +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  GDGYWADVSRETLDNTTLPGWKLGQRVNLEKALTPQTRLGGHIVSGHVDGVGEVVKRFPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT++ T    ++ 
Sbjct: 116 ARSERFHIRAPKELAKYIAHKGSITVDGTSLTVNKVDGAVFELNIVPHTLQWTIMDTYQT 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTNVNLEVDVLARYLERLMLGDKA 199


>gi|25028271|ref|NP_738325.1| riboflavin synthase subunit alpha [Corynebacterium efficiens
           YS-314]
 gi|259506814|ref|ZP_05749714.1| riboflavin synthase, alpha subunit [Corynebacterium efficiens
           YS-314]
 gi|23493555|dbj|BAC18525.1| putative riboflavin synthase alpha chain [Corynebacterium efficiens
           YS-314]
 gi|259165600|gb|EEW50154.1| riboflavin synthase, alpha subunit [Corynebacterium efficiens
           YS-314]
          Length = 205

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 71/198 (35%), Positives = 118/198 (59%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +  +   +RL +  +     + LG SI+  G+CLTV    E H   
Sbjct: 1   MFTGIVEELGSVSGVENLGDSVRLTIAATRVLEDVNLGDSISVNGVCLTVATFEEGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +   ET   +++ S  +G+ +NLER++    RL GH++ GH+DGT  +L  +   
Sbjct: 58  --FTADCMQETLDRSSLGSLTVGSPVNLERAMAANGRLGGHIMQGHVDGTTTLLSRESSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R +LP +L +++  KGS+ LNG SLTV+ +G+++F+V LI  T+ ETT    +VG
Sbjct: 116 NWDVLRFALPADLARYVVEKGSIALNGTSLTVSSLGEDWFEVSLIPTTLRETTHGHLQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++NIEVD + +Y+ R+ 
Sbjct: 176 DVVNIEVDVIAKYVERMM 193


>gi|90023097|ref|YP_528924.1| riboflavin synthase subunit alpha [Saccharophagus degradans 2-40]
 gi|89952697|gb|ABD82712.1| Riboflavin synthase, alpha subunit RibE [Saccharophagus degradans
           2-40]
          Length = 220

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 113/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   G I  + P    +RL V     + S + LG SIA  G+CLT V+L      
Sbjct: 1   MFTGIVEAKGTIAKLEPRDGDVRLWVTAPDLDYSDVALGDSIATNGVCLTAVQL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET  +T + +W  GT +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  GNGFAADVSRETLSLTTLVNWQPGTVVNLEKALTPQTRLGGHIVSGHVDGVGEVVSRHPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++IA KGS+ ++G SLTVN V  + F++ ++ HT++ T    +  
Sbjct: 116 ARSERFTIRAPKELAKYIAHKGSITVDGTSLTVNAVNGDLFELNIVPHTLQWTIIDSYTA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTKVNLEVDVIARYLERLLLGDKA 199


>gi|71736279|ref|YP_276622.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|289629166|ref|ZP_06462120.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289647765|ref|ZP_06479108.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|298488890|ref|ZP_07006914.1| Riboflavin synthase alpha chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|71556832|gb|AAZ36043.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|298156565|gb|EFH97661.1| Riboflavin synthase alpha chain [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322800|gb|EFW78893.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330414|gb|EFW86393.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330869909|gb|EGH04618.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330874036|gb|EGH08185.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330988220|gb|EGH86323.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 220

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVHVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|315109262|gb|EFT81238.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL030PA2]
          Length = 204

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 107/203 (52%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLTV  L E     
Sbjct: 6   MFTGIIEEIGEVLAIEKGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTVTDLDEAS--- 62

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T +     G+ +NLER V +GDRL G +V GH+DG  +++F     
Sbjct: 63  --FGCDVMAETLNRTALGGLAPGSRVNLERPVPVGDRLGGQIVQGHVDGLAKLVFRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R +LP  + +++  KGS+ +NG SLTV  V   +F+V LI  T+  T       G
Sbjct: 121 HWEVFRFALPAAVSRYVVEKGSIAINGTSLTVCAVAPEWFEVSLIPATLTGTVLGALSPG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 181 DEVNVEVDIIAKYLEALTNKERS 203


>gi|302561768|ref|ZP_07314110.1| riboflavin synthase, alpha subunit [Streptomyces griseoflavus
           Tu4000]
 gi|302479386|gb|EFL42479.1| riboflavin synthase, alpha subunit [Streptomyces griseoflavus
           Tu4000]
          Length = 240

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 75/200 (37%), Positives = 115/200 (57%), Gaps = 5/200 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G+I A+  +    R R+     T   K G SIA  G+CLTVV         +
Sbjct: 38  FTGIVEELGEITAVETLDDACRFRLRGPVVTEGAKHGDSIAVNGVCLTVVE-----HEGD 92

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V AET + +++    +G+ +NLER   +G RL GH+V GH+DGT EIL  +   +
Sbjct: 93  EFTADVMAETLKRSSLGVLAVGSRVNLERPTAVGSRLGGHIVQGHVDGTGEILGREPSEN 152

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
               R+SLP  L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + GD
Sbjct: 153 WEIVRISLPAGLSRYVVEKGSITVDGISLTVVDAGSDFFTVSLIPTTLALTTLGIKQPGD 212

Query: 182 LINIEVDSMMRYIARLYALN 201
            +N+EVD + +Y+ R+    
Sbjct: 213 PVNLEVDVIAKYVERMLGDR 232


>gi|110633490|ref|YP_673698.1| riboflavin synthase subunit alpha [Mesorhizobium sp. BNC1]
 gi|110284474|gb|ABG62533.1| riboflavin synthase, alpha subunit [Chelativorans sp. BNC1]
          Length = 204

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 102/203 (50%), Positives = 135/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G I  + P+ KG+RLR+ T+Y+   + +G SIA AG+CLTVV L E  S  
Sbjct: 1   MFTGIVTDVGAIQRIVPLPKGLRLRIGTNYDPQSIDIGASIACAGVCLTVVALPEGGSNQ 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W EVE W E  ++T ++ W  GT INLER++K+GD L GH+VSGH+DGT  I+     G
Sbjct: 61  RWCEVEAWDEALQLTTVSEWHDGTRINLERALKIGDELGGHIVSGHVDGTATIVERREEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   L  P  L +FIA KGSV L+G SLTVN V  N F+VLLI H+++ TTW   +VG
Sbjct: 121 EAVRFVLEAPRELAKFIAPKGSVALDGTSLTVNRVDGNRFNVLLIHHSLDVTTWGERQVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD+M RY ARL      
Sbjct: 181 QKVNLEVDTMARYAARLAEAAKE 203


>gi|254787585|ref|YP_003075014.1| riboflavin synthase subunit alpha [Teredinibacter turnerae T7901]
 gi|237684167|gb|ACR11431.1| riboflavin synthase, alpha subunit [Teredinibacter turnerae T7901]
          Length = 219

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I+++      +RLRV     + S + LG SIA  G+CLT V L      
Sbjct: 1   MFTGIIETVGQIVSLERRGGDVRLRVRAADMSWSDVALGDSIATNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T+I SW  GT +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  GDGFAADVSLETLSLTSIGSWKSGTAVNLEKALTPQSRLGGHIVSGHVDGLGEVVERAPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++IA KGS+ ++G SLTVN V  + F++ ++ HTIE T    +  
Sbjct: 116 ARSERFSIRAPRELAKYIAHKGSITVDGTSLTVNKVNGDVFELNIVPHTIERTIIGEYTA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL     +
Sbjct: 176 GTQVNLEVDVIARYLERLLLGEKA 199


>gi|254361994|ref|ZP_04978125.1| riboflavin synthase alpha subunit [Mannheimia haemolytica PHL213]
 gi|261493710|ref|ZP_05990229.1| riboflavin synthase alpha subunit [Mannheimia haemolytica serotype
           A2 str. BOVINE]
 gi|261494377|ref|ZP_05990871.1| riboflavin synthase alpha subunit [Mannheimia haemolytica serotype
           A2 str. OVINE]
 gi|153093541|gb|EDN74521.1| riboflavin synthase alpha subunit [Mannheimia haemolytica PHL213]
 gi|261310026|gb|EEY11235.1| riboflavin synthase alpha subunit [Mannheimia haemolytica serotype
           A2 str. OVINE]
 gi|261310710|gb|EEY11894.1| riboflavin synthase alpha subunit [Mannheimia haemolytica serotype
           A2 str. BOVINE]
          Length = 215

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 112/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I  +    + + + V      + + LG SIA  G+CLTV   ++E    
Sbjct: 1   MFTGIIEEVGQIAQIKKQGEFVVVTVKAKKILTDVHLGDSIAVNGVCLTVTSFTQEQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V +ET + T++    I + +NLER++    R  GH+VSGHIDGT  +  +    
Sbjct: 58  --FTADVMSETLKRTSLGELSINSSVNLERAMAANGRFGGHIVSGHIDGTGVVAEITPAD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S + R+     L ++I  KGS+ ++G+SLTV  V    F V +I HTI+ET     K+G
Sbjct: 116 NSTWYRIKAEPKLMRYIIEKGSITIDGISLTVVDVDAESFRVSIIPHTIKETNLGTKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            L+N+E D + +YI +       +
Sbjct: 176 SLVNLENDIVGKYIEQFLLKKEPE 199


>gi|307249605|ref|ZP_07531591.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858303|gb|EFM90373.1| Riboflavin synthase alpha chain [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 215

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GKI  +    +   + +  +     + LG SIA  G CLTV   S      
Sbjct: 1   MFTGIIEEVGKIAQINKQGEFAVVTINATKVLQDVHLGDSIAVNGACLTVTSFSS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT EI  +    
Sbjct: 56  NQFTADVMSETLKRTSLGELKSNSPVNLERAMAANGRFGGHIVSGHIDGTGEIAEITPAH 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S + R+     L ++I  KGS+ ++G+SLTV       F V +I HTI+ET     K+G
Sbjct: 116 NSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHTIKETNLGSKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +YI +      +
Sbjct: 176 SIVNLENDIVGKYIEQFLLKKPA 198


>gi|89067935|ref|ZP_01155379.1| riboflavin synthase subunit alpha [Oceanicola granulosus HTCC2516]
 gi|89046533|gb|EAR52589.1| riboflavin synthase subunit alpha [Oceanicola granulosus HTCC2516]
          Length = 203

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 99/199 (49%), Positives = 126/199 (63%), Gaps = 4/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++IA+      +R R+ T+Y    M +G SIA  G+CLTVV    E    
Sbjct: 1   MFTGIVTDVGEVIALERRGD-LRARIATAYPAETMDIGASIACDGVCLTVVARGTEAGR- 58

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +W++V++ AET   TNI    W  G  INLER++K+GD L GH+VSGH+DG  E++    
Sbjct: 59  DWFDVDISAETVAKTNIGRNGWAAGKRINLERALKVGDELGGHIVSGHVDGVAEVVASAR 118

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P  L +FIA KGSV LNG SLTVN V    F + LI HT E TTW    
Sbjct: 119 EGDSTRLTLRAPEALARFIAPKGSVALNGTSLTVNDVDGRDFGINLIPHTQEVTTWGEAG 178

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD+M RY+ARL
Sbjct: 179 VGDAVNLEVDTMARYVARL 197


>gi|169659014|dbj|BAG12716.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 102/203 (50%), Positives = 134/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWIKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSREFMPFIVNKGSIALNGTSLTVNGVENCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D IN+E+D + RY A+L+ L   
Sbjct: 181 DRINLEIDQLARYAAKLFTLKRE 203


>gi|325276596|ref|ZP_08142338.1| riboflavin synthase subunit alpha [Pseudomonas sp. TJI-51]
 gi|324098275|gb|EGB96379.1| riboflavin synthase subunit alpha [Pseudomonas sp. TJI-51]
          Length = 221

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I ++TP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVDGVGEIISRSDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPHTLSETIMADYRA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|302517923|ref|ZP_07270265.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB78]
 gi|302426818|gb|EFK98633.1| riboflavin synthase, alpha subunit [Streptomyces sp. SPB78]
          Length = 230

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 112/202 (55%), Gaps = 5/202 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G+++A+  +A   R R+     T   + G SIA  G+CLTVV          
Sbjct: 26  FTGIVEELGEVVAVEELADASRFRLRGPVVTEGARHGDSIAVNGVCLTVVE-----HEGA 80

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V AET + +++ +   G+ +NLER   +G RL GHLV GH+DGT  IL  +    
Sbjct: 81  EFTADVMAETLKRSSLGALAAGSRVNLERPTPVGGRLGGHLVQGHVDGTGTILRREPSEH 140

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
                +SLP +L +++  KGS+ ++G+SLTV     + F V LI  T+  TT    + G 
Sbjct: 141 WELVTVSLPGDLARYVVEKGSITVDGISLTVVEATDDTFSVSLIPTTLALTTLGHKQPGA 200

Query: 182 LINIEVDSMMRYIARLYALNTS 203
            +N+EVD + +Y+ R+    T+
Sbjct: 201 PVNLEVDVLAKYVERMLRYGTA 222


>gi|27262366|gb|AAN87464.1| Riboflavin synthase alpha chain [Heliobacillus mobilis]
          Length = 228

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 71/200 (35%), Positives = 111/200 (55%), Gaps = 5/200 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G + A+   A+  +L +        +KLG SIA  G+CLTVV          
Sbjct: 13  FTGIVEELGVMRAIRRGARSAQLIIEAKKVVEDVKLGDSIAVNGVCLTVVEYD-----GR 67

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V AET + T+++    G  +NLER+++L DRL GH+VSGH+D    I     +  
Sbjct: 68  GFTADVMAETLQRTSLSELQPGHRVNLERALRLSDRLGGHIVSGHVDAVGIIRKQTRVDI 127

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           ++   +S P  L +++  KGS+ ++G+SLTV  V +  F V LI HT   TT  + K G+
Sbjct: 128 AVVTEISAPPELLRYVIPKGSIAIDGISLTVVDVLEQGFTVSLIPHTAGLTTLGLKKSGE 187

Query: 182 LINIEVDSMMRYIARLYALN 201
            +N+E D + +Y+ RL    
Sbjct: 188 KVNLEADVIGKYVERLLTGR 207


>gi|319407321|emb|CBI80962.1| Riboflavin synthase alpha chain [Bartonella sp. 1-1C]
          Length = 205

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 105/204 (51%), Positives = 136/204 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  + P+ +GMRL + T Y+   +++G SIA +GICLT+V  + +    
Sbjct: 1   MFTGIVTDIGCIEDIQPLKQGMRLNISTHYDVESLEIGASIACSGICLTIVERALKPIDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  HWFIVEAWEEALRLTNLAQWTKGTLINLERSLRLGDEMGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   RL +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E TTW    VG
Sbjct: 121 GATRFRLQVPMQLAPFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTTWGHADVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + RY+ARL     ++
Sbjct: 181 DQVNLEVDQLARYVARLSNFKMNK 204


>gi|268611448|ref|ZP_06145175.1| riboflavin synthase subunit alpha [Ruminococcus flavefaciens FD-1]
          Length = 214

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 66/198 (33%), Positives = 107/198 (54%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G + A+        +R+        + LG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGTVKAVQHSGSNSFIRIEAKKILEDIHLGDSIAVNGVCLTVTHFDS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ +V  ET   +++ S   G+ +NLER++  G R  GH+VSGHIDGT  +  +   G
Sbjct: 56  TTFQADVMNETLSRSSLGSLKNGSPVNLERAMAAGGRFGGHIVSGHIDGTGTVSDIRNDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +++  +S    + ++I  KGS+ ++G+SLTV  V  N F V +I HT   T     K G
Sbjct: 116 IAVWYTVSAKPEILRYIVEKGSIAIDGISLTVAKVTDNSFSVSIIPHTASVTILGTKKTG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++N+E D + +Y+ +L 
Sbjct: 176 DIVNLENDIVGKYVEKLM 193


>gi|169629881|ref|YP_001703530.1| riboflavin synthase subunit alpha [Mycobacterium abscessus ATCC
           19977]
 gi|169241848|emb|CAM62876.1| Putative riboflavin synthase alpha chain [Mycobacterium abscessus]
          Length = 197

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 112/201 (55%), Gaps = 4/201 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+    +    RL V+        K G SIA  G+CLTVV + E     
Sbjct: 1   MFTGIVEELGEILGREDLGDSARLTVLGPLVVEDAKHGDSIAVNGVCLTVVDVRE----G 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++     G  +NLER+  +  RL GH+V GH+DGT  +L      
Sbjct: 57  GVFTTDVMGETLARSSLDKIEAGAKVNLERAAAVNSRLGGHIVQGHVDGTGNVLSRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R+SLP  + +++  KGS+ ++GVSLTV+ +G ++F+V LI  T++ TT     VG
Sbjct: 117 NWEVVRVSLPSAVARYVVEKGSITVDGVSLTVSGLGPDWFEVSLIPTTLDLTTLGAAAVG 176

Query: 181 DLINIEVDSMMRYIARLYALN 201
             +N+EVD + +Y+ RL    
Sbjct: 177 TTVNLEVDVIAKYVERLLEHR 197


>gi|114798806|ref|YP_760755.1| riboflavin synthase subunit alpha [Hyphomonas neptunium ATCC 15444]
 gi|114738980|gb|ABI77105.1| riboflavin synthase, alpha subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 206

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 114/205 (55%), Gaps = 2/205 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTD+G +          R  V + Y  +++ +G SI H+G+CLTVV   E     
Sbjct: 1   MFTGLVTDVGTVRKAEHRNGLTRFEVESGYPLAQIAMGASILHSGVCLTVVDKGEAER-G 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE   ET   T +  W  GT +NLE+S+KLGD L GH V GH+DG  EI+ ++  G
Sbjct: 60  AWFAVEAVPETLSKTILGGWQEGTRVNLEQSLKLGDELGGHFVFGHVDGVGEIVSVEAEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNL-VGKNFFDVLLIRHTIEETTWKMHKV 179
            S    +  P  + ++ A KGS  ++GVSLTV   +    F V +I HT E TT    K 
Sbjct: 120 QSFRVTIRPPAAISRYFATKGSAAVDGVSLTVAAALENGDFQVAIIPHTWEVTTLAALKP 179

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+E+D + RY+AR+   +  Q
Sbjct: 180 GTKVNLEIDMLARYVARMIGADAPQ 204


>gi|89055908|ref|YP_511359.1| riboflavin synthase subunit alpha [Jannaschia sp. CCS1]
 gi|88865457|gb|ABD56334.1| riboflavin synthase alpha subunit [Jannaschia sp. CCS1]
          Length = 196

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 93/197 (47%), Positives = 129/197 (65%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++ A+      +R R+ T Y+ + + LG SIA  G+CLTVV +       
Sbjct: 1   MFTGIVTDLGEVRALEHRGD-LRARIGTGYDMATVDLGASIACDGVCLTVVAMG-----A 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AE+   TNI +W +G  +NLER++K+GD L GH+VSGH+DG  EIL +   G
Sbjct: 55  DWFDVDISAESVSRTNIGAWEVGARLNLERALKVGDELGGHIVSGHVDGVAEILSVVDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS       P  L +F+A KGSV LNG SLTVN V  + F V +I HT E TTW + K G
Sbjct: 115 DSTRFTFRAPGELGRFVAPKGSVALNGTSLTVNEVDGSEFGVNIIPHTKEVTTWGVAKAG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N E+D++ RY+ARL
Sbjct: 175 DRVNFEIDTLARYVARL 191


>gi|239827588|ref|YP_002950212.1| riboflavin synthase subunit alpha [Geobacillus sp. WCH70]
 gi|239807881|gb|ACS24946.1| riboflavin synthase, alpha subunit [Geobacillus sp. WCH70]
          Length = 215

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I  M    + + + +        + LG SIA  G+CLTV   +     D
Sbjct: 1   MFTGIIEEVGTIEQMRQSGEAIVMTIGAKKVLEDVHLGDSIAVNGVCLTVTSFT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R T++ +   G+ +NLER++    R  GH VSGH+DG  EI+      
Sbjct: 56  RSFTVDVMPETVRATSLRTLTKGSKVNLERAMAANGRFGGHFVSGHVDGIGEIIRKWPSA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P  L +++ +KGSV ++G SLT+  +  + F + LI HT  ET     + G
Sbjct: 116 NAVYYEIKIPQELRKYMILKGSVAVDGTSLTIFGLTDDTFTISLIPHTRTETILGDKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+A+       +
Sbjct: 176 DIVNIECDVIGKYVAQFMEGKKEE 199


>gi|237797513|ref|ZP_04585974.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331020363|gb|EGI00420.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 220

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT  ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTWSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|159044795|ref|YP_001533589.1| riboflavin synthase subunit alpha [Dinoroseobacter shibae DFL 12]
 gi|157912555|gb|ABV93988.1| riboflavin synthase, alpha subunit [Dinoroseobacter shibae DFL 12]
          Length = 200

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 91/202 (45%), Positives = 120/202 (59%), Gaps = 2/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG + A+      +  R+  SY    + LG SIA  G+CLTVV   ++ +  
Sbjct: 1   MFTGIITDIGTVRALEQAGD-LHARIGCSYAPGSIALGASIACNGVCLTVVDKGQDDTSP 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V + AE+   TNI  W  G  +NLER++K+GD L GH+VSGH+DG  EI  +   G
Sbjct: 60  -WFDVTISAESVDKTNIGDWRPGARVNLERALKVGDELGGHIVSGHVDGVAEITAMAQEG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S       P  L +FIA KGSV L+G SLTVN V    F V  I HT   TTW   KVG
Sbjct: 119 ESTRVTFRAPEALARFIAPKGSVALDGTSLTVNEVDGAEFGVNFIPHTKSATTWGGVKVG 178

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D IN+E+D++ RY+ARL     
Sbjct: 179 DRINLEIDTLARYVARLQEWQP 200


>gi|311030746|ref|ZP_07708836.1| riboflavin synthase subunit alpha [Bacillus sp. m3-13]
          Length = 217

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 110/202 (54%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  +    + + L +        +KLG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEIGTIKQIIRGDQAIILEIEAEKVLEDVKLGDSIAVNGVCLTVTTFTS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R T++ +   G+ +NLER++    R  GH VSGH+DG   I     +G
Sbjct: 56  NRFTVDVMPETIRATSLKTLNAGSKVNLERAMIANGRFGGHFVSGHVDGIGTIQDKKRMG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  ++    + ++  +KGSV ++G SLT+  V +N F + LI HT+ ET       G
Sbjct: 116 NAVYYTITAEDTISRYFMLKGSVTVDGTSLTIFGVSENNFTISLIPHTLNETILGGKGKG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIEVD + +Y+  L     
Sbjct: 176 DLVNIEVDMLAKYMEHLLKQQN 197


>gi|225028185|ref|ZP_03717377.1| hypothetical protein EUBHAL_02457 [Eubacterium hallii DSM 3353]
 gi|224954497|gb|EEG35706.1| hypothetical protein EUBHAL_02457 [Eubacterium hallii DSM 3353]
          Length = 235

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/202 (32%), Positives = 110/202 (54%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I ++   A    + +  +     + LG S+A  G+CLT   + +     
Sbjct: 14  MFTGIIEEVGEIQSIKKGANSAVITIKANTVLGDLHLGDSVALNGVCLTATSIGK----- 68

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V+V  ET R TN+     G+ +NLER++    R  GH+V+GH+DGT  I  +    
Sbjct: 69  NNYSVDVMHETLRRTNLGELKSGSKVNLERAMAANGRFGGHIVAGHVDGTGTISSMKKDD 128

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGS+ ++GVSLTV  V    F V +I HT + TT    K G
Sbjct: 129 NAVWITIDTSAAILKYIISKGSITIDGVSLTVAKVDNKSFAVSVIPHTGQNTTLLDKKPG 188

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ +L    +
Sbjct: 189 DTVNLENDMVGKYVEKLLQYGS 210


>gi|83951491|ref|ZP_00960223.1| riboflavin synthase subunit alpha [Roseovarius nubinhibens ISM]
 gi|83836497|gb|EAP75794.1| riboflavin synthase subunit alpha [Roseovarius nubinhibens ISM]
          Length = 195

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 90/201 (44%), Positives = 125/201 (62%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD G+I  +      +R R+   Y+   + +G SIA  G+CLTVV +       
Sbjct: 1   MFTGIITDQGEIRDLEQRGD-LRARIGCHYDMDGVDMGASIACDGVCLTVVAMG-----A 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V+V AET   TN+ +W  G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWFDVDVSAETVSKTNLDTWAKGRTVNLERALKVGDELGGHIVSGHVDGVAEVISVKDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPKALARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKEVTTWGRVAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D++ RY+ARL+  +
Sbjct: 175 DRVNLEIDTLARYVARLHEAD 195


>gi|163868465|ref|YP_001609674.1| riboflavin synthase subunit alpha [Bartonella tribocorum CIP
           105476]
 gi|125213043|dbj|BAF46398.1| riboflavin synthase [Bartonella tribocorum]
 gi|161018121|emb|CAK01679.1| Riboflavin synthase alpha chain [Bartonella tribocorum CIP 105476]
          Length = 205

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 100/203 (49%), Positives = 132/203 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGIRLKISTRYAVESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+A W  GTFINLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFIVEAWEEALRLTNLAQWKKGTFINLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVPKGSVALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGHAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L+A    
Sbjct: 181 DWVNLEIDQLARYAAKLFAFKGE 203


>gi|95929566|ref|ZP_01312308.1| riboflavin synthase, alpha subunit [Desulfuromonas acetoxidans DSM
           684]
 gi|95134263|gb|EAT15920.1| riboflavin synthase, alpha subunit [Desulfuromonas acetoxidans DSM
           684]
          Length = 215

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 119/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ DIG +  +   A  ++L V T+    ++ LG SIA  GICLTV+R        
Sbjct: 1   MFTGLIEDIGTVRELRHGASSVQLTVATTLPMDEIALGDSIAVNGICLTVIRYGS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   TN+ +   G+ +NLER+++L DRL GHLVSGH+D    ++     G
Sbjct: 56  GVFVADVSPETLECTNLGAVSPGSQVNLERALQLSDRLGGHLVSGHVDDVATVVERRRDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++     L  +  +++  KGS+ ++G+SLTVN V +  F V +I H++E+TT K  +VG
Sbjct: 116 NAIRFTFRLAAHTLRYVVAKGSITIDGISLTVNEVTEETFSVAIIPHSLEKTTLKNVQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +NIE D + RY+ +L    ++
Sbjct: 176 GRVNIETDIIARYVEKLLGQGSA 198


>gi|330721630|gb|EGG99647.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC2047]
          Length = 218

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 113/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  + P    +RL V T   + S + LG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAVGEIHTIQPRDGDVRLYVKTGKLDLSDVALGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G  +NLE+++    RL GHLVSGH+DG  E++     
Sbjct: 56  GDGFWADVSRETINLTCFEFIKQGARVNLEKALTPQTRLGGHLVSGHVDGLGEVISRHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    +  P  L ++I+ KGS+C++G SLTVN V    F++ ++ HTI+ET    +K 
Sbjct: 116 ARSERFTIRAPDELAKYISHKGSICIDGTSLTVNAVNGAEFELNIVPHTIQETIIGGYKQ 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTKVNLEVDQIARYLERLMLGDKA 199


>gi|46204083|ref|ZP_00209251.1| COG0307: Riboflavin synthase alpha chain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 207

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 104/201 (51%), Gaps = 7/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTP---IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIV +IG++  +     + +   L V      S   LG SIA  G+CLTV  L    
Sbjct: 1   MFTGIVEEIGRVRGIAFPGGVGEDAVLTVEGPLAASDAGLGDSIAVNGVCLTVTSLG--- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D  +  +V  E+ R T +     G+ +NLER+V+   RL GH+V GH+DG   ++   
Sbjct: 58  -GDGSFTADVMPESLRRTALGDLVAGSPVNLERAVRADARLGGHVVQGHVDGVGTLVSRT 116

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                    LS P  L +++A KGS+ ++GVSLTV  V    F V LI  T+E T     
Sbjct: 117 PGERWDDLVLSAPAGLTRYVAEKGSIAVSGVSLTVTHVDDETFGVSLIPTTLEATILGRL 176

Query: 178 KVGDLINIEVDSMMRYIARLY 198
             GD +N+EVD + +Y+ RL 
Sbjct: 177 VPGDRVNLEVDVLAKYVERLL 197


>gi|262072899|dbj|BAI47758.1| riboflavin synthase [Bartonella sp. Shimane 84-1]
          Length = 206

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 99/203 (48%), Positives = 134/203 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+R +V T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGVRFKVSTRYAVESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEEALRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V ++ FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKISRQFMPFIVPKGSVALNGTSLTVNGVEESVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D + RY A+L++L   
Sbjct: 181 DWVNLEIDQLARYAAKLFSLKKE 203


>gi|167623140|ref|YP_001673434.1| riboflavin synthase subunit alpha [Shewanella halifaxensis HAW-EB4]
 gi|167353162|gb|ABZ75775.1| riboflavin synthase, alpha subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 221

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + S +KLG SIA  G+CLTVV+L     +
Sbjct: 1   MFTGIIESVGHLRKVERRGDDIRLTVASGKLDLSDVKLGDSIATNGVCLTVVQL-----M 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  + + +G  +NLE++V    RL GH+VSGH+DG   +    F 
Sbjct: 56  ADGYVADISAETVSLTGFSHYPVGKAVNLEKAVTPTTRLGGHMVSGHVDGIAHVDDRQFR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    K 
Sbjct: 116 GQAIEFWLTPPVELGRYIAHKGSITIDGVSLTVNEVQGHRFRLTIVPHTAGETTLVDLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL +  + +
Sbjct: 176 GDSVNIEVDLIARHLERLMSYPSQE 200


>gi|311894588|dbj|BAJ26996.1| putative riboflavin synthase alpha chain [Kitasatospora setae
           KM-6054]
          Length = 219

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 70/210 (33%), Positives = 118/210 (56%), Gaps = 8/210 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEE-HSV 59
           MFTGI+ ++G+++++  I +  R+R+     T+  + G SIA  G+CLTV+  +E+  + 
Sbjct: 1   MFTGIIEELGEVVSIEEIGESSRIRLRGPVVTADARHGDSIAVNGVCLTVLDDNEQLAAR 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF- 118
           D  +  +V  ET + +++     G+ +NLER++ LG RL GHLV GH+D T  +L  +  
Sbjct: 61  DGEFSADVMRETLQRSSLGVLRPGSRVNLERAMALGARLGGHLVQGHVDATGTLLSREPG 120

Query: 119 ------IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
                        R +LP  + +++  KGS+ ++GVSLTV     + F V LI  T+  T
Sbjct: 121 DLDADGNPRWEVLRFTLPQPIARYLVEKGSITVDGVSLTVVEAALDSFTVSLIPATLALT 180

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           T    +VG+ +N+EVD + +Y+ RL     
Sbjct: 181 TLGAKQVGEPVNLEVDVLAKYVERLLDTRA 210


>gi|322514845|ref|ZP_08067863.1| riboflavin synthase subunit alpha [Actinobacillus ureae ATCC 25976]
 gi|322119149|gb|EFX91294.1| riboflavin synthase subunit alpha [Actinobacillus ureae ATCC 25976]
          Length = 215

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GKI  +   A+   + +  +     + LG SIA  G+CLTV   S     +
Sbjct: 1   MFTGIIEEVGKIAQIHKQAEFAVVTINATKVLQDVHLGDSIAVNGVCLTVTSFS-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT EI  +    
Sbjct: 56  NQFTADVMSETLKRTSLGELKPNSPVNLERAMAANGRFGGHIVSGHIDGTGEIAEITPAH 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S + R+     L ++I  KGS+ ++G+SLTV       F V +I HTI+ET      +G
Sbjct: 116 NSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHTIKETNLGSKNIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +YI +      +
Sbjct: 176 SIVNLENDIVGKYIEQFLLKKPA 198


>gi|257153189|dbj|BAI23149.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 95/204 (46%), Positives = 132/204 (64%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L++ T Y+   +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDIQSLNQGVHLKISTRYDIESLEIGASIACSGICLTIVERGLKQVTA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++LGD + GH VSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHFVSGHIDGLAEIIDKRNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNGVSLTVN V    FD+L+IRHT+E TTW   K+G
Sbjct: 121 DAIRFFLQVPKEFVPFIVNKGSIALNGVSLTVNCVEDCIFDILIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E+D + RY A+L      +
Sbjct: 181 DQVNLEIDQLARYAAKLSGFKMKE 204


>gi|260434092|ref|ZP_05788063.1| riboflavin synthase, alpha subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417920|gb|EEX11179.1| riboflavin synthase, alpha subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 195

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 97/197 (49%), Positives = 130/197 (65%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG II +      +R R+ T Y+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGTIIELEQQGD-LRARIKTGYDTAGIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVQISAETVSKTNLDGWQVGKRVNLERALKVGDELGGHIVSGHVDGVAEVIAVADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   KVG
Sbjct: 115 DSTRVTLRAPRDLARFIAPKGSVALNGTSLTVNDVDGCDFGINFIPHTKENTTWGDVKVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DRVNLEIDTLARYVARL 191


>gi|330959947|gb|EGH60207.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 220

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVSRAEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT  ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTWSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|319442107|ref|ZP_07991263.1| riboflavin synthase subunit alpha [Corynebacterium variabile DSM
           44702]
          Length = 214

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 99/202 (49%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G + A+   A   RLR+  S   +    G SIA  G+CLTV         +
Sbjct: 1   MFTGIVEETGTVAAVERTADAQRLRITCSTVIADAVHGASIAVNGVCLTVTEFD-TDGGN 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +    T   T I    +G  +NLER+   G RL GH+V GH+DGT  +       
Sbjct: 60  PGFWADCMQVTLDYTAIGDLAVGDRVNLERATATGKRLGGHIVQGHVDGTAVLESRTPGS 119

Query: 121 DSMYCRLS-LPHNLEQFIAVKGSVCLNGVSLTVNLVGK---NFFDVLLIRHTIEETTWKM 176
           +    R       L +++A KGS+ +NG SLTV  VG     +F+V LI  T+ ET    
Sbjct: 120 EWEVLRFRLEDPALARYVAKKGSIAVNGTSLTVAEVGPVGDGWFEVSLIPVTLAETVLGD 179

Query: 177 HKVGDLINIEVDSMMRYIARLY 198
             VGD +NIE D + +Y  RL 
Sbjct: 180 LTVGDRVNIECDILAKYTERLL 201


>gi|145224303|ref|YP_001134981.1| riboflavin synthase subunit alpha [Mycobacterium gilvum PYR-GCK]
 gi|315444636|ref|YP_004077515.1| riboflavin synthase, subunit alpha [Mycobacterium sp. Spyr1]
 gi|145216789|gb|ABP46193.1| riboflavin synthase, alpha subunit [Mycobacterium gilvum PYR-GCK]
 gi|315262939|gb|ADT99680.1| riboflavin synthase, alpha subunit [Mycobacterium sp. Spyr1]
          Length = 203

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/200 (35%), Positives = 113/200 (56%), Gaps = 4/200 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G+++ +  +    RL +     TS    G SIA  G+CLTVV +      D 
Sbjct: 3   FTGIVEELGEVVGVEDLGDSARLVIRGPIVTSDAGHGDSIAVNGVCLTVVDV----LADG 58

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V AET   +++    +G  +NLER+  +  RL GH+V GH+DGT  I+       
Sbjct: 59  SFSADVMAETLNRSSLRGVDVGARVNLERAAAINSRLGGHIVQGHVDGTGHIVSRTPSEH 118

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
               R++LP  L +++  KGS+ ++GVSLTV+ +G ++F+V LI  T++ TT     VG 
Sbjct: 119 WTVVRIALPETLARYVVQKGSITVDGVSLTVSGLGPDWFEVSLIPTTLDMTTLGRAAVGA 178

Query: 182 LINIEVDSMMRYIARLYALN 201
            +N+EVD + +Y+ RL    
Sbjct: 179 PVNLEVDVIAKYVERLLGQR 198


>gi|319404316|emb|CBI77909.1| Riboflavin synthase alpha chain [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 205

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 104/204 (50%), Positives = 137/204 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G I  + P+ +GMRL + T Y+   +++G SIA +GICLT+V  + + +  
Sbjct: 1   MFTGIVTDVGCIEDIQPLKQGMRLNISTHYDVESLEIGASIACSGICLTIVERALKSTDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  HWFIVEAWEEALRLTNLAQWTKGTLINLERSLRLGDEMGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   RL +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E TTW    VG
Sbjct: 121 GATRFRLQVPMQLASFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTTWGQADVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+EVD + RY+ARL     ++
Sbjct: 181 DQVNLEVDQLARYVARLSDFKMNK 204


>gi|289423249|ref|ZP_06425060.1| riboflavin synthase, alpha subunit [Peptostreptococcus anaerobius
           653-L]
 gi|289156349|gb|EFD05003.1| riboflavin synthase, alpha subunit [Peptostreptococcus anaerobius
           653-L]
          Length = 222

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  ++   K   L +        ++LG SIA  G+CLTV   +      
Sbjct: 1   MFTGIVEEIGSIKKISKGQKSAVLTIAAKKIMEDVRLGDSIAVNGVCLTVTEFTRSE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   ++++S  IG+ +N+ER++    R  GH+VSGHIDGT  I+ +    
Sbjct: 58  --FSVDVMHETLDRSSLSSLKIGSKVNMERAMPADGRFGGHIVSGHIDGTGRIVDIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ ++    N+ ++I  KGS+ ++G+SLTV  +    F V +I HT+  T      +G
Sbjct: 116 NAIWYKIEAGQNILKYIIEKGSITIDGISLTVARISDRDFSVSIIPHTLANTILAYKGLG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++N+E D + +Y+ +L  L   +
Sbjct: 176 DIVNLENDCIGKYVEKLLGLKKFE 199


>gi|288918237|ref|ZP_06412592.1| riboflavin synthase, alpha subunit [Frankia sp. EUN1f]
 gi|288350407|gb|EFC84629.1| riboflavin synthase, alpha subunit [Frankia sp. EUN1f]
          Length = 223

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 113/217 (52%), Gaps = 18/217 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+ P      L +      S +  G S+A  G+CLTV   +     D
Sbjct: 1   MFTGIVEELGVVTAIEPRQDAASLTIECRNVLSDVAHGASVAVNGVCLTVTSYAHPPDAD 60

Query: 61  NW------------YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID 108
                         +  +V  ET R +++ +  +G  +NLER V+L DRL GHLV GH+D
Sbjct: 61  GAGTAEPAADPAGVFTADVMLETLRRSSLGALSVGDRVNLERPVRLSDRLGGHLVQGHVD 120

Query: 109 GTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV------GKNFFDV 162
           G   +L           R++LP  L++++  KGSV ++GVSLTV  V          F V
Sbjct: 121 GVGVVLERAPAEHWDVVRIALPPRLDRYLVEKGSVTVDGVSLTVVDVRPAAGDEPASFTV 180

Query: 163 LLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            LI  T+ +TT  +  VG+ +NIEVD + +Y+ +L+A
Sbjct: 181 SLIPTTLADTTLGVRAVGEKVNIEVDVLAKYVEKLHA 217


>gi|254428561|ref|ZP_05042268.1| riboflavin synthase, alpha subunit [Alcanivorax sp. DG881]
 gi|196194730|gb|EDX89689.1| riboflavin synthase, alpha subunit [Alcanivorax sp. DG881]
          Length = 219

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 118/199 (59%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ AMTP    + L + +   + S ++LG SIA  G+CLT   L      
Sbjct: 1   MFTGIIESMGKVAAMTPKGGDVTLLIKSDGLDFSDVQLGDSIAVNGVCLTATAL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +E +V  ET  +T++A   +G+ +NLE+++    RL GHLVSGH+DG  +I+ +   
Sbjct: 56  GSAFEADVSGETLSLTSLAQISVGSTVNLEKALTPSSRLGGHLVSGHVDGLGKIVEMKQD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P  L ++IA KGS+ ++G+SLTVN V    F + +I HT E TT    +V
Sbjct: 116 ARSVRIDIEAPAELAKYIAHKGSITVDGISLTVNSVVGAVFSLNIIPHTQEVTTIGQWQV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTPVNLEVDIIARYLERLL 194


>gi|68536086|ref|YP_250791.1| riboflavin synthase subunit alpha [Corynebacterium jeikeium K411]
 gi|68263685|emb|CAI37173.1| ribC [Corynebacterium jeikeium K411]
          Length = 213

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 67/213 (31%), Positives = 103/213 (48%), Gaps = 14/213 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++ A+      +R+R          K G SIA  G+CLTV  LS E    
Sbjct: 1   MFTGIIEEVGRVAAIEEAGDALRMRFTAPGVLEDAKRGDSIAINGVCLTVAELSPEE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V   T   + + S  +G  +N+ER++  G R  GH+V GH+DGT  +       
Sbjct: 58  --FTADVMQVTLDYSALGSVSVGDRVNVERAMASGQRFGGHIVQGHVDGTATLQERRPSE 115

Query: 121 DSMYCRLS-LPHNLEQFIAVKGSVCLNGVSLTVNLV--------GKNFFDVLLIRHTIEE 171
                R       L +++A KGSV +NG SLTV  V         + +F+V LI  T+ +
Sbjct: 116 HWEVFRFQLEDPQLARYVAKKGSVAINGTSLTVAEVAEAGGSGSSEAWFEVSLIPTTLAD 175

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           T       GD +N+E D + +Y+ RL      +
Sbjct: 176 TMLGDLNPGDTVNVECDVLAKYVERLAQHGAQE 208


>gi|262370186|ref|ZP_06063513.1| riboflavin synthase subunit alpha [Acinetobacter johnsonii SH046]
 gi|262315225|gb|EEY96265.1| riboflavin synthase subunit alpha [Acinetobacter johnsonii SH046]
          Length = 219

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 115/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G + ++  +   +RLR+ T  + S + LG SIA  GICLTV+   E     
Sbjct: 1   MFTGIIESLGTVESVQNVGGDVRLRIGTDLDMSDVHLGDSIATNGICLTVIDWGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY  +V  E+   T +A W +G  +N+E+++    R  GH+VSGH+D   EI  +    
Sbjct: 56  HWYAADVSRESLNRTTLAHWKVGQRVNVEKAMLPTTRFGGHIVSGHVDAVGEITVVREDA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+Y  ++ P  + +++A KGS+ ++G+SLT+N +      + LI HT E T     K G
Sbjct: 116 RSLYFEVTAPAEIARYLAEKGSITVDGISLTINHLRGRILSLNLIPHTAERTNIGTWKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + RYI RL   + +
Sbjct: 176 SQVNLEVDVLARYIERLMMGDKA 198


>gi|126175360|ref|YP_001051509.1| riboflavin synthase subunit alpha [Shewanella baltica OS155]
 gi|217972397|ref|YP_002357148.1| riboflavin synthase subunit alpha [Shewanella baltica OS223]
 gi|304410190|ref|ZP_07391809.1| riboflavin synthase, alpha subunit [Shewanella baltica OS183]
 gi|307302099|ref|ZP_07581857.1| riboflavin synthase, alpha subunit [Shewanella baltica BA175]
 gi|125998565|gb|ABN62640.1| riboflavin synthase, alpha subunit [Shewanella baltica OS155]
 gi|217497532|gb|ACK45725.1| riboflavin synthase, alpha subunit [Shewanella baltica OS223]
 gi|304351599|gb|EFM15998.1| riboflavin synthase, alpha subunit [Shewanella baltica OS183]
 gi|306914137|gb|EFN44558.1| riboflavin synthase, alpha subunit [Shewanella baltica BA175]
          Length = 218

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLNDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIAMVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +NIEVD + RY+ RL   +
Sbjct: 176 GDKVNIEVDLIARYLERLMNYD 197


>gi|153001670|ref|YP_001367351.1| riboflavin synthase subunit alpha [Shewanella baltica OS185]
 gi|151366288|gb|ABS09288.1| riboflavin synthase, alpha subunit [Shewanella baltica OS185]
          Length = 218

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAIGTLRKLERKGDDIRLTVASGKLDLNDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIAMVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +NIEVD + RY+ RL   +
Sbjct: 176 GDKVNIEVDLIARYLERLMNYD 197


>gi|294678592|ref|YP_003579207.1| riboflavin synthase subunit alpha [Rhodobacter capsulatus SB 1003]
 gi|294477412|gb|ADE86800.1| riboflavin synthase, alpha subunit [Rhodobacter capsulatus SB 1003]
          Length = 196

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 90/202 (44%), Positives = 129/202 (63%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I+A+      +R R+   Y+   +++G SIAHAG+CLTV+      +  
Sbjct: 1   MFTGIVTDLGEILALENTGD-LRARIRCGYDMKTVEIGASIAHAGVCLTVIA-----TGA 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+  W +G+ INLER++K+GD L GH+VSGH+DG  EI  L   G
Sbjct: 55  DWYDVQISAETVSKTNLGGWTVGSRINLERALKVGDELGGHIVSGHVDGVAEITALRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S       P  L ++IA KGSV L+G SLTVN V    F + +I HT   TT+   +VG
Sbjct: 115 ESTRFSFRAPEALAKYIAPKGSVALDGASLTVNEVDGCTFGINIIPHTKAVTTFGTARVG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E+D++ RY+ARL     
Sbjct: 175 DKVNLEIDTLARYVARLTEWKA 196


>gi|257153163|dbj|BAI23136.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 98/201 (48%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDIQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|53804260|ref|YP_114100.1| riboflavin synthase subunit alpha [Methylococcus capsulatus str.
           Bath]
 gi|53758021|gb|AAU92312.1| riboflavin synthase, alpha subunit [Methylococcus capsulatus str.
           Bath]
          Length = 219

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++    P     RL V       S ++LG SIA  G+CLTVV   E    
Sbjct: 1   MFTGIIQAMGQLQRKEPRGGDYRLTVAAGKLAMSDVRLGDSIAVNGVCLTVVGFGE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET   T +     GT +NLE ++  G RL GH+VSGH+DG   I+  D  
Sbjct: 57  -GGFRADVSRETLSRTTLGELRTGTALNLELALTPGSRLGGHIVSGHVDGIGTIMARDED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+  +L  P +L ++IA KGS+C++G+SLTVN V  + FDV ++ HT+  TT K  + 
Sbjct: 116 GRSVRFQLDAPAHLAKYIAEKGSICIDGISLTVNRVDGSVFDVNVVPHTLAVTTLKDAQA 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ RL  
Sbjct: 176 GRRVNLEVDLLARYLERLIQ 195


>gi|146281222|ref|YP_001171375.1| riboflavin synthase subunit alpha [Pseudomonas stutzeri A1501]
 gi|145569427|gb|ABP78533.1| riboflavin synthase, alpha subunit [Pseudomonas stutzeri A1501]
 gi|327479376|gb|AEA82686.1| riboflavin synthase subunit alpha [Pseudomonas stutzeri DSM 4166]
          Length = 220

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAIGTIRALTPKGGDVRVLVETGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  E++  +  
Sbjct: 56  GNGFWADVSRETLARTAFIDLKAGSRVNLEKALTPTSRLGGHLVSGHVDGVGEVVAREDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA+KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFRIRAPRELAKYIALKGSITVDGTSLTVNAVNGAEFELTIVPHTLGETIMADYRP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRQVNLEVDLLARYLERLMMGDKA 199


>gi|254492039|ref|ZP_05105217.1| riboflavin synthase, alpha subunit [Methylophaga thiooxidans
           DMS010]
 gi|224462854|gb|EEF79125.1| riboflavin synthase, alpha subunit [Methylophaga thiooxydans
           DMS010]
          Length = 212

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 82/199 (41%), Positives = 131/199 (65%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG++ ++ P    +RL + T  ++ S +KLG SIA  G+CLTVV ++     
Sbjct: 1   MFTGIIAAIGQVDSVQPSEGDLRLNIATQKWDLSDVKLGDSIAVNGVCLTVVEMTS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +    +V  E+   T++     G+ +NLE+++ +GDRL GH+VSGH+DG  ++L ++  
Sbjct: 57  -SQLSFDVSKESLDRTSLGLAIAGSKVNLEKALAVGDRLGGHMVSGHVDGLGKVLQMETS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+  R+ +P  LE++IA KGSVC++GVSLTVN +G+ +F+V +I HT++ET    +KV
Sbjct: 116 ARSVCFRIEVPPVLERYIAEKGSVCIDGVSLTVNNIGQGWFEVNIIPHTMQETIISDYKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTQVNLEVDLIARYLERLL 194


>gi|78222834|ref|YP_384581.1| riboflavin synthase subunit alpha [Geobacter metallireducens GS-15]
 gi|78194089|gb|ABB31856.1| Lumazine-binding protein [Geobacter metallireducens GS-15]
          Length = 216

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 105/203 (51%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D+G +  +       RL   T      + LG S+A  G CLTVV         
Sbjct: 1   MFTGLIEDVGSVRRLERAGGAARLTTATKIPLDSIALGDSVAVNGACLTVVAKG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +   ET   T + + G G  +NLER+++LGDRL GH+V+GH+D   ++     + 
Sbjct: 56  GELTFDASPETLERTTLGTLGTGAPVNLERALRLGDRLGGHIVTGHVDFIADVSERREVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++     +P    +++  KGSV ++G+SLTVN V  + F V +I HT   TT    K G
Sbjct: 116 GNIVFGFRIPGQFARYLVAKGSVTIDGISLTVNTVTDSGFSVNIIPHTAAMTTLNGMKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +NIE D + +Y+ RL A  ++
Sbjct: 176 GRVNIETDILGKYVERLLAFGST 198


>gi|152984636|ref|YP_001346432.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa PA7]
 gi|150959794|gb|ABR81819.1| riboflavin synthase, alpha subunit [Pseudomonas aeruginosa PA7]
          Length = 219

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|49078224|gb|AAT49763.1| PA4055 [synthetic construct]
          Length = 220

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSVRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|15599250|ref|NP_252744.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa PAO1]
 gi|116052092|ref|YP_789064.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889664|ref|YP_002438528.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa LESB58]
 gi|254236944|ref|ZP_04930267.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa C3719]
 gi|254242737|ref|ZP_04936059.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 2192]
 gi|296387388|ref|ZP_06876887.1| riboflavin synthase subunit alpha [Pseudomonas aeruginosa PAb1]
 gi|313109498|ref|ZP_07795454.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 39016]
 gi|9950252|gb|AAG07442.1|AE004822_2 riboflavin synthase alpha chain [Pseudomonas aeruginosa PAO1]
 gi|115587313|gb|ABJ13328.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168875|gb|EAZ54386.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa C3719]
 gi|126196115|gb|EAZ60178.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 2192]
 gi|218769887|emb|CAW25648.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa LESB58]
 gi|310881956|gb|EFQ40550.1| riboflavin synthase alpha chain [Pseudomonas aeruginosa 39016]
          Length = 219

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSVRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVNGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|167768614|ref|ZP_02440667.1| hypothetical protein CLOSS21_03173 [Clostridium sp. SS2/1]
 gi|317497908|ref|ZP_07956218.1| riboflavin synthase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710138|gb|EDS20717.1| hypothetical protein CLOSS21_03173 [Clostridium sp. SS2/1]
 gi|291560564|emb|CBL39364.1| riboflavin synthase, alpha subunit [butyrate-producing bacterium
           SSC/2]
 gi|316894889|gb|EFV17061.1| riboflavin synthase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 219

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 116/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +I++   +K   L +  +     +KLG S+A  G+CLT   +S      
Sbjct: 1   MFTGIVEELGTVISLKRGSKAAVLTIKANVIFEDLKLGDSVAVNGVCLTATHIS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N ++ +V  ET   +++ S   G+ +NLER++    R  GH+V+GH+D T E++ +    
Sbjct: 56  NTFQADVMNETFNRSSLGSLKKGSVVNLERAMAANGRFGGHMVAGHVDDTGELVSVKQDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +  P N+ ++   KGS+ L+G+SLT+  +  +   V +I HTI+ T +   K G
Sbjct: 116 NAVWFTIKAPENIMKYCIEKGSIALDGISLTIAKLSDDTISVSMIPHTIKNTNFGYKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D IN+E D + +YI +L   +  +
Sbjct: 176 DKINLENDMVGKYIDKLLHFDQQE 199


>gi|85858028|ref|YP_460230.1| riboflavin synthase subunit alpha [Syntrophus aciditrophicus SB]
 gi|85721119|gb|ABC76062.1| riboflavin synthase alpha chain [Syntrophus aciditrophicus SB]
          Length = 215

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  IG ++ ++   +   L + T  N   +++G SIA  G CLT    S      
Sbjct: 1   MFTGLVQGIGTVLRLSRRGEDALLEIETDMNLEDVRIGDSIAVNGACLTATSYSRRS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T++     G  +NLE+S++L D + GH+V GH+DG  +I+      
Sbjct: 58  --FTADVSAETLSRTDLGFLQPGQRVNLEKSLRLTDFMGGHIVLGHVDGLGKIVERSVKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S+  R+ +   L ++I  KGSV ++GVSLTVN   +N F V +I HT E TT    K G
Sbjct: 116 GSIIFRIEVEPELSRYIVSKGSVAVDGVSLTVNRCEENVFYVNMISHTAERTTLGFKKKG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIE D + +Y+ RL      +
Sbjct: 176 DWVNIETDILGKYVDRLLNPEQKK 199


>gi|145295717|ref|YP_001138538.1| riboflavin synthase subunit alpha [Corynebacterium glutamicum R]
 gi|140845637|dbj|BAF54636.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 211

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 67/198 (33%), Positives = 114/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +  +   +R+++  S     + LG SI+  G+CLTV    E H   
Sbjct: 1   MFTGIVEELGSVAGVEHLGDSIRMQISASTVLEGVHLGDSISVNGVCLTVASFDEGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  ET   +++ +   G+ +NLER++    RL GH++ GH+D T  ++      
Sbjct: 58  --FTADLMQETLDRSSLGALSTGSKVNLERAMAADGRLGGHIMQGHVDATTTLIKRTSSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R  LP +L +++  KGS+ LNG SLTV+ +G ++F+V LI  T+ +TT     VG
Sbjct: 116 NWDVLRFELPADLARYVVEKGSIALNGTSLTVSSLGDDWFEVSLIPTTLRDTTHGELAVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++NIEVD + +Y+ R+ 
Sbjct: 176 DIVNIEVDVIAKYVERMM 193


>gi|114566747|ref|YP_753901.1| riboflavin synthase subunit alpha [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337682|gb|ABI68530.1| riboflavin synthase alpha chain [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 226

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 63/203 (31%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTG++ +IG I  +    + ++LR+      S +K+G SIA  G+CLTV   ++      
Sbjct: 12  FTGLIEEIGSIKQIIRGKRSIQLRIEAEKVLSDVKIGDSIAVNGVCLTVTDFTKTD---- 67

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  ++  ET   +++      + +NLER+++L DRL GHLV GH+D    I   + +  
Sbjct: 68  -FTCDLMPETMDKSSLKFLQSASPVNLERALQLSDRLGGHLVQGHVDALGRIKQKEQLDI 126

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           ++  R+  P ++ ++   KGS+ ++G+SLTV  V  + F V LI H+ + TT     +GD
Sbjct: 127 AIIFRIEAPSSVLKYTVPKGSIAIDGISLTVIDVFPDSFTVSLIPHSAQNTTLAQKNIGD 186

Query: 182 LINIEVDSMMRYIARLYALNTSQ 204
           ++N+E D + RY+ +L     ++
Sbjct: 187 MVNLESDIIGRYVEKLMCSEKNE 209


>gi|163750013|ref|ZP_02157257.1| riboflavin synthase subunit alpha [Shewanella benthica KT99]
 gi|161330287|gb|EDQ01268.1| riboflavin synthase subunit alpha [Shewanella benthica KT99]
          Length = 220

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +  +   +RL V ++  + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERLGDDIRLNVASNKLDLSDVRLGDSIATNGVCLTVVEC-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +    + 
Sbjct: 56  SDGYVADISAETVSLTGFAKYQVGTRVNLEKAVTPTTRLGGHMVSGHVDGVATVDDRQYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS P  L ++IA KGS+ L+GVSLTVN V  N F + ++ HT  ETT +  K 
Sbjct: 116 GKAIEFWLSAPAELARYIAHKGSITLDGVSLTVNEVQDNRFRLTIVPHTATETTLESLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL      +
Sbjct: 176 GDKVNIEVDLIARHLERLMTYTNKE 200


>gi|83955705|ref|ZP_00964285.1| riboflavin synthase subunit alpha [Sulfitobacter sp. NAS-14.1]
 gi|83839999|gb|EAP79175.1| riboflavin synthase subunit alpha [Sulfitobacter sp. NAS-14.1]
          Length = 195

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 98/201 (48%), Positives = 131/201 (65%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGKI  +      +R R+ T Y+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDIGKITKLEQQGD-LRARIETGYDTSGIDMGASIASDGVCLTVVDLG-----A 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV++ AET   TN+ +W +G  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWYEVQISAETVDKTNLGAWEVGRRLNLERALKVGDELGGHIVSGHVDGVAEVVALRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    +G
Sbjct: 115 DSTRVTLRAPEDLARFIAPKGSVALNGTSLTVNEVDGCDFGINFIPHTKEVTTWGDVAIG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D++ RY+ARL  ++
Sbjct: 175 DRINLEIDTLARYVARLAEMS 195


>gi|292492825|ref|YP_003528264.1| riboflavin synthase, subunit alpha [Nitrosococcus halophilus Nc4]
 gi|291581420|gb|ADE15877.1| riboflavin synthase, alpha subunit [Nitrosococcus halophilus Nc4]
          Length = 218

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/199 (36%), Positives = 117/199 (58%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G ++A+        LR+ +   + +++ +G SIA +G+CLTV RL+ +   
Sbjct: 1   MFTGIIRAVGTVVALQRKGSEAALRIDSGKLDLAEVGIGDSIAVSGVCLTVARLANQ--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +V  ET   T +     G  +NLE ++ L D L GHL SGH DG   ++    +
Sbjct: 58  --VFDFDVSQETLSRTVLGKLQPGEGVNLEPALTLKDHLGGHLTSGHCDGVGRVVERTSV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S+   +  P  L ++IA KGS+ ++GVSLTVN V  N F+V +I HT++ TT   ++ 
Sbjct: 116 GESVRFSIRAPAGLAKYIAEKGSIGVDGVSLTVNGVKGNLFEVNIIPHTLQATTLNEYRP 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GREVNLEVDLLARYLERLL 194


>gi|1710403|sp|P50854|RISA_ACTPL RecName: Full=Riboflavin synthase alpha chain
 gi|1173517|gb|AAA86523.1| riboflavin synthase alpha subunit [Actinobacillus pleuropneumoniae]
          Length = 215

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GKI  +    +   + +  +     + LG +IA  G+CLTV   S      
Sbjct: 1   MFTGIIEEVGKIAQIHKQGEFAVVTINATKVLQDVHLGDTIAVNGVCLTVTSFSS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT EI  +    
Sbjct: 56  NQFTADVMSETLKRTSLGELKSNSPVNLERAMAANGRFGGHIVSGHIDGTGEIAEITPAH 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S + R+     L ++I  KGS+ ++G+SLTV       F V +I HTI+ET     K+G
Sbjct: 116 NSTWYRIKTSPKLMRYIIEKGSITIDGISLTVVDTDDESFRVSIIPHTIKETNLGSKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +YI +      +
Sbjct: 176 SIVNLENDIVGKYIEQFLLKKPA 198


>gi|291295638|ref|YP_003507036.1| riboflavin synthase subunit alpha [Meiothermus ruber DSM 1279]
 gi|290470597|gb|ADD28016.1| riboflavin synthase, alpha subunit [Meiothermus ruber DSM 1279]
          Length = 209

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 84/199 (42%), Positives = 115/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV + G I     +    RL +         +LG S+A +G+CLTVV L  E    
Sbjct: 1   MFSGIVEETGVIREAREMGGLRRLFIEAQRALEGTRLGDSVAVSGVCLTVVELGSE---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T    W +G  +NLER++ LGDRL GHLV+GH+DG   ++ ++   
Sbjct: 57  -GFAVELAQETLRRT-ARRWEVGQRVNLERALALGDRLGGHLVTGHVDGRARVVRINREM 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    L +P  L ++IA KGSV L+GVSLTV  V  N F V LI HT+E TT K    G
Sbjct: 115 GAWDVWLEVPQELTRYIAPKGSVALDGVSLTVAGVEGNRFWVTLIPHTLEVTTLKELAEG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY+ RL +
Sbjct: 175 DEVNLEVDLLARYLERLVS 193


>gi|225849240|ref|YP_002729404.1| riboflavin synthase subunit alpha [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643682|gb|ACN98732.1| riboflavin synthase, alpha subunit [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 210

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 115/199 (57%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GK+ ++   + GMRL V          LG SI+  G+CLTVV + +E +  
Sbjct: 1   MFTGLIEEVGKVKSVIKNSDGMRLVVSCRKVLDGTVLGDSISVNGVCLTVVDMDKESA-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET + +N +    G ++NLERS+    RL GH+V GH+D T  I+    +G
Sbjct: 59  ---SFDVSQETIKRSNFSFLKTGDYVNLERSLTPQSRLGGHIVQGHVDTTGSIVSKTSLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                ++S     +  +  KGS+ ++G+SLTVN + +N  D+ +I HT+E T  K  KVG
Sbjct: 116 SHTNFKISFSPEYKNLVIEKGSIAIDGISLTVNYINENIIDLNIIPHTLENTNLKYRKVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D++NIE D + +Y+A++  
Sbjct: 176 DVVNIEFDILGKYVAKMIG 194


>gi|302343808|ref|YP_003808337.1| riboflavin synthase, subunit alpha [Desulfarculus baarsii DSM 2075]
 gi|301640421|gb|ADK85743.1| riboflavin synthase, alpha subunit [Desulfarculus baarsii DSM 2075]
          Length = 219

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 75/203 (36%), Positives = 116/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G I  +        LR+   ++ ++  LG SIA  G CLTV  L       
Sbjct: 1   MFTGLVEGLGAIGRIERKGPDAVLRIRPPWDAARTVLGESIAVLGACLTVTGLG-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++V+V AE+   T +     G  +NLER+++LGDRL GHLVSGH+D    +  +   G
Sbjct: 56  DGFDVDVSAESLARTKLGGLRAGDAVNLERAMQLGDRLGGHLVSGHVDCLGRVTLIAPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S +  +++P    + +  KGSV ++GVSLTVN V  + F + +I HT  ETT  + + G
Sbjct: 116 GSQHLEIAIPAEHMRLVVEKGSVTVDGVSLTVNQVWDDRFALNIIPHTWRETTLSLLRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++NIE D + +Y+ARL   + +
Sbjct: 176 DVVNIETDLIGKYVARLMGRDAA 198


>gi|257153165|dbj|BAI23137.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 98/201 (48%), Positives = 135/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V+   + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVKRGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDCIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|91792503|ref|YP_562154.1| riboflavin synthase subunit alpha [Shewanella denitrificans OS217]
 gi|91714505|gb|ABE54431.1| riboflavin synthase, alpha subunit [Shewanella denitrificans OS217]
          Length = 217

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 79/203 (38%), Positives = 116/203 (57%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +    + +RL V +   + S +KLG SIA  G+CLTVV      S+
Sbjct: 1   MFTGIIEALGTLTKIERHGQDIRLTVDSGKLDLSDVKLGDSIATNGVCLTVV-----QSL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V AET  +T  A + +G  +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  KQGYMADVSAETVALTGFARYKVGQKVNLEKALTATTRLGGHMVSGHVDGMAEVMQRQAR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L  P  L ++IA KGSV ++GVSLTVN V  + F + ++ HT  ETT      
Sbjct: 116 GKAIEFWLKAPSELARYIAHKGSVTIDGVSLTVNEVDGDNFRLTIVPHTAGETTLLDLNT 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           GD +N+EVD + RY+ RL     
Sbjct: 176 GDRVNLEVDLIARYLERLMGAKA 198


>gi|34391418|gb|AAM77480.1| riboflavin synthase [Bartonella elizabethae]
          Length = 205

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 100/202 (49%), Positives = 133/202 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +GMR+++ T Y    + +G SIA +GICLTVV    +    
Sbjct: 1   MFTGIITDIGCVEDVQFLKQGMRVKISTRYAIESLAIGASIACSGICLTVVERGFKQEDF 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWKKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIEQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVSKGSVALNGTSLTVNSVEDCVFDVLIIRHTLEVTTWGEAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E+D + RY A+L++   
Sbjct: 181 DWVNLEIDQLARYAAKLFSFKR 202


>gi|329889481|ref|ZP_08267824.1| riboflavin synthase, alpha subunit [Brevundimonas diminuta ATCC
           11568]
 gi|328844782|gb|EGF94346.1| riboflavin synthase, alpha subunit [Brevundimonas diminuta ATCC
           11568]
          Length = 196

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 89/196 (45%), Positives = 122/196 (62%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG++ ++    +  R  V T ++T+ + LG SI+HAG CLTV    E     
Sbjct: 1   MFTGIVTDIGRVRSVRETNRDRRYEVETVWDTATIDLGASISHAGCCLTVTEKGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VEV  ET   T +  W   T +NLER+ KLGD L GH+VSGH+DG  E++ +   G
Sbjct: 56  GWFAVEVSGETLSKTKLGDWTENTRVNLERAAKLGDELGGHIVSGHVDGLGEVVSITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    +  P  L +FIA KGS+ ++GVSLTVN V +  FDV +I HT + TT    KVG
Sbjct: 116 GSHRIVIEAPAPLHRFIAPKGSITVDGVSLTVNGVHERRFDVNIIPHTWDATTLGGLKVG 175

Query: 181 DLINIEVDSMMRYIAR 196
           + +N+E+D + RY+AR
Sbjct: 176 ERVNLEIDMLARYLAR 191


>gi|294055300|ref|YP_003548958.1| riboflavin synthase, alpha subunit [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614633|gb|ADE54788.1| riboflavin synthase, alpha subunit [Coraliomargarita akajimensis
           DSM 45221]
          Length = 197

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 73/202 (36%), Positives = 113/202 (55%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK+++        RL +     T  +++G S+A  G CLT V  SE     
Sbjct: 1   MFTGIVEETGKVLSFEEQESAWRLVLEAHVVTQGLQMGDSVAVNGCCLTAVAFSE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +  E ++ AE+ R+T+I   G+G  +NLER++    R+ GH VSGH+DGT  I  ++  G
Sbjct: 56  DRIEFDLLAESVRLTSIGEVGVGGVVNLERALLPSTRMGGHFVSGHVDGTGVIDTIEPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
             +Y R+       ++I  KG V ++G+SLTV  V +  F + LI HT+E T     K G
Sbjct: 116 KDVYLRIQPDAESLRYIVHKGCVSIDGISLTVAEVDETGFSIWLIPHTMEATNLHSKKNG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ +L+A   
Sbjct: 176 DRVNLEFDLIAKYVEKLFAPKA 197


>gi|288941491|ref|YP_003443731.1| riboflavin synthase subunit alpha [Allochromatium vinosum DSM 180]
 gi|288896863|gb|ADC62699.1| riboflavin synthase, alpha subunit [Allochromatium vinosum DSM 180]
          Length = 219

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 113/199 (56%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  + P    +RL + T   +   + LG SIA  G+CLT V L+E    
Sbjct: 1   MFTGIIQSVGLIQRLEPRGGDVRLSIDTGKLSLDGVVLGDSIAVNGVCLTAVALTE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET  +T + +   G+ +NLE+++ L   L GHLVSGH+DG   +L     
Sbjct: 57  -CGFAADVSRETLTLTTLGALKPGSRVNLEKALTLSTPLGGHLVSGHVDGVGTLLERHED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   R+  P  L ++IA KGS+C++G SLTVN V    F++ ++ HTI+ET    ++ 
Sbjct: 116 ARSWRLRIQAPDELARYIAHKGSICVDGTSLTVNRVEGAVFELNIVPHTIQETIIGDYRP 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GSRVNLEVDLIARYLERLL 194


>gi|120403677|ref|YP_953506.1| riboflavin synthase subunit alpha [Mycobacterium vanbaalenii PYR-1]
 gi|119956495|gb|ABM13500.1| riboflavin synthase, alpha subunit [Mycobacterium vanbaalenii
           PYR-1]
          Length = 205

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 114/203 (56%), Gaps = 4/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++    +   +RL +     TS    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGEVVGKEDLGDSVRLVIRGPVVTSDAGHGDSIAVNGVCLTVVDV----LAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++    +G  +NLER+  +  RL GH+V GH+DGT  ++      
Sbjct: 57  GAFTADVMDETLNRSSLRGVDVGAKVNLERAAAVSSRLGGHIVQGHVDGTGHVISRTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R++LP  L +++  KGS+ ++GVSLTV+ +G ++F+V LI  T+  TT    +VG
Sbjct: 117 HWTVVRIALPAALARYVVQKGSITVDGVSLTVSGLGHDWFEVSLIPTTLGLTTLGHAEVG 176

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD + +Y+ RL     +
Sbjct: 177 AHVNLEVDVIAKYVERLLEKKDA 199


>gi|66047688|ref|YP_237529.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           syringae B728a]
 gi|302189351|ref|ZP_07266024.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           syringae 642]
 gi|63258395|gb|AAY39491.1| Lumazine-binding protein [Pseudomonas syringae pv. syringae B728a]
 gi|330899665|gb|EGH31084.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330944973|gb|EGH46765.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330953125|gb|EGH53385.1| riboflavin synthase subunit alpha [Pseudomonas syringae Cit 7]
 gi|330969740|gb|EGH69806.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330976722|gb|EGH76763.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 220

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + + +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLTDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT  ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTWSETIMADYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|227821533|ref|YP_002825503.1| riboflavin synthase subunit alpha [Sinorhizobium fredii NGR234]
 gi|227340532|gb|ACP24750.1| riboflavin synthase alpha chain [Sinorhizobium fredii NGR234]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 106/204 (51%), Positives = 138/204 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G +  +  + +G++LRV TSY+   + LG SIAHAG+CLTV  L E  S +
Sbjct: 1   MFTGIITDVGTVEKVAALREGVKLRVATSYDPKTIDLGASIAHAGVCLTVTALPEAGSNE 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EVE W E  R+T I+ W  G  INLERS+K+GD L GH+VSGH+DG  EIL ++  G
Sbjct: 61  RWFEVEAWEEALRLTTISGWREGVRINLERSLKIGDELGGHIVSGHVDGQAEILAVEPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++  RL  P  L +F+A KGSV L+G SLTVN V    FDVLLIRH++E TTW   + G
Sbjct: 121 DAVRFRLRAPEQLARFVAPKGSVALDGTSLTVNRVDGAEFDVLLIRHSLEVTTWGERRAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N EVD+M RY ARL      +
Sbjct: 181 DFVNFEVDTMARYAARLAEFPAPK 204


>gi|323357081|ref|YP_004223477.1| riboflavin synthase alpha chain [Microbacterium testaceum StLB037]
 gi|323273452|dbj|BAJ73597.1| riboflavin synthase alpha chain [Microbacterium testaceum StLB037]
          Length = 218

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 113/209 (54%), Gaps = 10/209 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I A+ P   G+R+ V    + S    G SI+ +G+CLTVV   E     
Sbjct: 1   MFTGIVEEMGAITAVEPSGDGVRVTVRAPLSVSDAGHGDSISVSGVCLTVVDQGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+  +V  +T  ++ +A    G  +NLER+     RL GH+V GHIDGT  +  +    
Sbjct: 56  DWFTADVMKQTLDMSTLADVAPGRAVNLERATAAHGRLGGHIVQGHIDGTGVVREVRPGA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
                R+ +P++L   +  KGS+ ++GVSLTV+ V      + + +V LI  T+  TT  
Sbjct: 116 QWSVVRIGIPNHLAPLVVDKGSIAIDGVSLTVSAVSDPAETEQWLEVSLIPETLAATTLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTSQ 204
             + G  +N+E D + R++ R+ A   S+
Sbjct: 176 GAEAGTPVNLETDILARHVQRMLAFRVSE 204


>gi|257153169|dbj|BAI23139.1| riboflavin synthase [Bartonella washoensis]
 gi|257153173|dbj|BAI23141.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 99/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCIEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRFMPFIINKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGRAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|107103569|ref|ZP_01367487.1| hypothetical protein PaerPA_01004639 [Pseudomonas aeruginosa PACS2]
          Length = 219

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG + AMTP    +R+ + T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSVRAMTPKGGDLRVYIATGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  E+   T      +G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRESLARTAFQHLKVGSRVNLEKALTPTTRLGGHLVSGHVDGVGEVLKREEN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAIQFTVRAPRELARYIAHKGSITVDGTSLTVNAVSGAEFELTIVPHTLSETIMAEYQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRRVNLEVDLLARYLERLLLGDKA 199


>gi|19552808|ref|NP_600810.1| riboflavin synthase subunit alpha [Corynebacterium glutamicum ATCC
           13032]
 gi|62390478|ref|YP_225880.1| riboflavin synthase subunit alpha [Corynebacterium glutamicum ATCC
           13032]
 gi|21324365|dbj|BAB98989.1| Riboflavin synthase alpha chain [Corynebacterium glutamicum ATCC
           13032]
 gi|41325815|emb|CAF21604.1| PUTATIVE RIBOFLAVIN SYNTHASE [Corynebacterium glutamicum ATCC
           13032]
          Length = 211

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 67/198 (33%), Positives = 114/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +  +   +R+++  S     + LG SI+  G+CLTV    E H   
Sbjct: 1   MFTGIVEELGSVAGVEHLGDSIRMQISASTVLEGVHLGDSISVNGVCLTVASFGEGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  ET   +++ +   G+ +NLER++    RL GH++ GH+D T  ++      
Sbjct: 58  --FTADLMQETLDRSSLGALSTGSKVNLERAMAADGRLGGHIMQGHVDATTSLIKRTSSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R  LP +L +++  KGS+ LNG SLTV+ +G ++F+V LI  T+ +TT     VG
Sbjct: 116 NWDVLRFELPADLARYVVEKGSIALNGTSLTVSSLGDDWFEVSLIPTTLRDTTHGELAVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++NIEVD + +Y+ R+ 
Sbjct: 176 DIVNIEVDVIAKYVERMM 193


>gi|257153175|dbj|BAI23142.1| riboflavin synthase [Bartonella washoensis]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGVRLDISTRYDIESLEIGASIACSGICLTIVERGLKQATT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++ G+ + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRFGNEMGGHLVSGHIDGLAEIIDKRNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNGVSLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPKQFVPFIVNKGSIALNGVSLTVNCVENYIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|257153157|dbj|BAI23133.1| riboflavin synthase [Bartonella washoensis]
 gi|257153161|dbj|BAI23135.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 98/201 (48%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|257153171|dbj|BAI23140.1| riboflavin synthase [Bartonella washoensis]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 99/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCIEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRFMPFIINKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGRAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFE 201


>gi|240949070|ref|ZP_04753421.1| riboflavin synthase subunit alpha [Actinobacillus minor NM305]
 gi|240296543|gb|EER47168.1| riboflavin synthase subunit alpha [Actinobacillus minor NM305]
          Length = 215

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I  +    +   + +  +   S + LG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEVGSIAQIHKQGEFAVVTINANKVLSDVHLGDSIAVNGVCLTVTSFT-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT E++ +    
Sbjct: 56  SQFTADVMSETLKRTSLGELKPSSPVNLERAMAANGRFGGHIVSGHIDGTGEVVEITPAN 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S + R+     L ++I  KGS+ ++G+SLTV    ++ F V +I HTI+ET     K+G
Sbjct: 116 HSTWYRIKTSAKLMRYIIEKGSITIDGISLTVVDTDESSFRVSIIPHTIKETNLGTKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            L+N+E D + +YI +       +
Sbjct: 176 SLVNLENDIVGKYIEQFLLKKEPE 199


>gi|294141968|ref|YP_003557946.1| riboflavin synthase subunit alpha [Shewanella violacea DSS12]
 gi|293328437|dbj|BAJ03168.1| riboflavin synthase, alpha subunit [Shewanella violacea DSS12]
          Length = 220

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 80/205 (39%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +  +   +RL V ++  + S ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERLGDDIRLNVASNKLDLSDVRLGDSIATNGVCLTVVEC-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +    + 
Sbjct: 56  SDGYVADISAETVSLTGFAKYQVGTKVNLEKAVTPTTRLGGHMVSGHVDGVASVDVRQYR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   LS P +L ++IA KGS+ ++GVSLTVN V  N F + ++ HT  ETT +  K 
Sbjct: 116 GKSIEFWLSAPVDLARYIAHKGSITIDGVSLTVNEVKDNRFRLTIVPHTAGETTLESLKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           GD +NIEVD + R++ RL      +
Sbjct: 176 GDKVNIEVDLIARHLERLMTYTNKE 200


>gi|114570084|ref|YP_756764.1| riboflavin synthase subunit alpha [Maricaulis maris MCS10]
 gi|114340546|gb|ABI65826.1| riboflavin synthase, alpha subunit [Maricaulis maris MCS10]
          Length = 201

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 84/203 (41%), Positives = 122/203 (60%), Gaps = 2/203 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT  G++ +++  ++  R  +   Y+   + +G SIAHAG CLTVV         
Sbjct: 1   MFTGIVTAKGRVRSISGDSQ-RRFEIEAPYDPDGIAMGASIAHAGACLTVVGKGRT-GEG 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V  ET  +T + SW  G  INLER++ LG+ L GHLV+GH+DG  E++     G
Sbjct: 59  CWFAVDVSPETLSLTTLGSWREGDAINLERALALGEELGGHLVTGHVDGIGELVGRRDDG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D +   +  P  L +FIA KGS+ ++GVSLTVN V    FD+++I HT + TT    ++G
Sbjct: 119 DWIVLTVKPPATLNKFIARKGSITVDGVSLTVNGVTDETFDLMIIPHTADVTTLGALQIG 178

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+EVD M RY ARL   + +
Sbjct: 179 AHVNLEVDLMARYAARLSEFSPT 201


>gi|50954247|ref|YP_061535.1| riboflavin synthase subunit alpha [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50950729|gb|AAT88430.1| riboflavin synthase, alpha chain [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 207

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 115/208 (55%), Gaps = 9/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I A+       R+ V      S    G SI+ +G+CLTV+         
Sbjct: 1   MFTGIIEELGEIAAVDRTTDAARITVRGPLAVSDANHGDSISVSGVCLTVIGWD-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET  ++ +     G  +NLER+ ++GDRL GH+V GHIDGT  +L  +   
Sbjct: 56  DGFTADVMAETLAMSTLGDVAPGRRVNLERAARVGDRLGGHIVQGHIDGTATVLSAEEGS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
                RLSL   +   +A KGS+ ++GVSLTV+ VG +    +F+V LI  T+  TT   
Sbjct: 116 AWRVVRLSLDPGIASLVARKGSIAIDGVSLTVSAVGGDRDDSWFEVSLIPETLTATTLGE 175

Query: 177 HKVGDLINIEVDSMMRYIARLYALNTSQ 204
              GD +NIE D + R++ ++ AL  ++
Sbjct: 176 RVPGDRVNIETDILARHVEQMLALAPTE 203


>gi|154248199|ref|YP_001419157.1| riboflavin synthase, alpha subunit [Xanthobacter autotrophicus Py2]
 gi|154162284|gb|ABS69500.1| riboflavin synthase, alpha subunit [Xanthobacter autotrophicus Py2]
          Length = 203

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 91/203 (44%), Positives = 122/203 (60%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G ++A+    +   L + T+Y  + + +G SIAHAG+CLTV  ++      
Sbjct: 1   MFTGIVTDMGDLVAVETKGEVKTLTIATAYEAAGIDVGASIAHAGVCLTVTSVTAGGPRG 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET  IT +  W  G  INLERS+KLGD L GH+VSGH+D T  ++  + +G
Sbjct: 61  TLFTVDAGPETLAITTVGGWTPGQRINLERSLKLGDELGGHMVSGHVDSTARVVSREDLG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      +P  L +F+AVKGSV L+G SLTVN V  N F  LLI HT+  TTW   K G
Sbjct: 121 STTRFVFEVPEQLARFVAVKGSVGLDGTSLTVNTVEGNTFSCLLIPHTLAVTTWGGVKAG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N EVD M RY ARL     +
Sbjct: 181 DTVNFEVDLMARYAARLAEFPRA 203


>gi|329898130|ref|ZP_08272332.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC3088]
 gi|328920910|gb|EGG28342.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC3088]
          Length = 218

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 79/199 (39%), Positives = 116/199 (58%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I A+ P    +R+RV +       ++LG SI  +G+CLTVV L      
Sbjct: 1   MFTGIIEAVGEIAAIEPRGGDVRIRVKSGKLPLHGVQLGDSICTSGVCLTVVDL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V  ET  +T + +W  GT +NLER++    RL GH+VSGH+DG   ++     
Sbjct: 56  GDGYWADVSNETLSLTTVGTWSNGTKVNLERALTPESRLGGHIVSGHVDGIGTVVERYEE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S    +  P  L ++IA KGS+C++G SLTVN V  + FD+ +I  T+ ET    + V
Sbjct: 116 GRSWRFLIEAPAELAKYIAHKGSICIDGTSLTVNSVNGSRFDLNIIPQTMAETVIGGYHV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  IN+EVD + RY+ RL 
Sbjct: 176 GTSINLEVDVIARYLERLL 194


>gi|34391406|gb|AAM77474.1| riboflavin synthase [Bartonella doshiae]
          Length = 205

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 103/201 (51%), Positives = 136/201 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ KG+RL++ T Y+   +++G SIA +GICLTVV    +H   
Sbjct: 1   MFTGIITDIGCVEDVQPLKKGVRLKISTHYDIESLEIGASIACSGICLTVVERGLKHGDT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+A W  GTF+NLERS++LGD L GHLV GHIDG  EI+     G
Sbjct: 61  NWFTVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDELGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L  P  L  FI  KGS+ LNG SLT+N +    FDVL+IRHT+E TTW   +VG
Sbjct: 121 DAVRFHLQAPARLTSFIVNKGSIALNGTSLTINCIEDRIFDVLIIRHTLEMTTWGQARVG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DLIN+E+D + RY+A+L    
Sbjct: 181 DLINVEIDQLARYVAKLSNFK 201


>gi|83941146|ref|ZP_00953608.1| riboflavin synthase subunit alpha [Sulfitobacter sp. EE-36]
 gi|83846966|gb|EAP84841.1| riboflavin synthase subunit alpha [Sulfitobacter sp. EE-36]
          Length = 195

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 99/201 (49%), Positives = 130/201 (64%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGKI  +      +R R+ T Y+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDIGKITKLEQQGD-LRARIETGYDTSGIDMGASIASDGVCLTVVDLG-----A 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV++ AET   TN+ +W +G  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWYEVQISAETVDKTNLGAWEVGRRLNLERALKVGDELGGHIVSGHVDGVAEVVALRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPEVLARFIAPKGSVALNGTSLTVNEVDGCDFGINFIPHTKEVTTWGDVAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D++ RY+ARL  ++
Sbjct: 175 DRINLEIDTLARYVARLAEMS 195


>gi|257153167|dbj|BAI23138.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 98/201 (48%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLTPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|169659020|dbj|BAG12719.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 100/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +GMRL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGMRLKISTRYAIESLAIGASIACSGICLTIVERGLKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN++ W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLSQWTTGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIPFYLKVSRQFMPFIVNKGSIALNGTSLTVNGVEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L  L 
Sbjct: 181 DQVNLEIDQLSRYAAKLLTLK 201


>gi|160876408|ref|YP_001555724.1| riboflavin synthase subunit alpha [Shewanella baltica OS195]
 gi|160861930|gb|ABX50464.1| riboflavin synthase, alpha subunit [Shewanella baltica OS195]
 gi|315268598|gb|ADT95451.1| riboflavin synthase, alpha subunit [Shewanella baltica OS678]
          Length = 218

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +    + +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGEDIRLTVASGKLDLNDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFAHYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIAMVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +NIEVD + RY+ RL   +
Sbjct: 176 GDKVNIEVDLIARYLERLMNYD 197


>gi|34391408|gb|AAM77475.1| riboflavin synthase [Bartonella schoenbuchensis]
 gi|319408449|emb|CBI82104.1| Riboflavin synthase alpha chain [Bartonella schoenbuchensis R1]
          Length = 205

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 100/201 (49%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTV+    + +  
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIERELKQANA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W E   +TNIA W  GTF+NLERS++LGD + GHLV GH+DG  EI+     G
Sbjct: 61  NCFVVEAWKEALCLTNIAQWTKGTFVNLERSLRLGDEIGGHLVFGHVDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKASMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + RY+ARL    
Sbjct: 181 DQVNLEVDQLARYVARLSNFK 201


>gi|89894409|ref|YP_517896.1| riboflavin synthase subunit alpha [Desulfitobacterium hafniense
           Y51]
 gi|89333857|dbj|BAE83452.1| riboflavin synthase alpha chain [Desulfitobacterium hafniense Y51]
          Length = 214

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +  +    +L +  +      ++G SIA  GICLTVV++       
Sbjct: 1   MFTGIIEELGKVADLKVLPDSAQLTLEGTKVLEGTQIGDSIAVNGICLTVVKM-----QG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V AET   TN+      T +NLER+++L  RL GHLVSGH+DG   I  +  +G
Sbjct: 56  NLFTVDVMAETLNKTNLKECSRETRVNLERALQLSTRLGGHLVSGHVDGVGTIQKITPVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     L  ++  KGS+ ++G+SLTV  +    F + LI HT +ETT     VG
Sbjct: 116 IARVFTIKAAPELLTYVLPKGSIAIDGISLTVVDLLPQAFTISLIPHTRQETTLGFKGVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+AR      +
Sbjct: 176 DMVNLETDLIGKYVARFMEKKEA 198


>gi|325963045|ref|YP_004240951.1| riboflavin synthase, subunit alpha [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469132|gb|ADX72817.1| riboflavin synthase, alpha subunit [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 213

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 77/207 (37%), Positives = 114/207 (55%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G ++++       R+R+     T  + LG SIA  G+CLT   ++ +    
Sbjct: 1   MFTGIIAEQGHVLSVERDGDSARVRLHAPGTTEGLALGGSIAVNGVCLTATEIAGKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   + I     G  +NLER V+ G RLDGH+V GH+DG  E+L  + +G
Sbjct: 58  --FSVDVMGETLVRSTIGELAPGDSVNLERCVQAGGRLDGHVVQGHVDGVGELLEREPLG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG-----KNFFDVLLIRHTIEETTWK 175
           +    R  +P NL ++IA KGS+ ++GVSLTV  V        +F+V LI  T+ ET   
Sbjct: 116 NWERLRFGVPANLARYIAEKGSIAIDGVSLTVTAVSDAAEVNPWFEVGLIPTTLAETGLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNT 202
               G  +N+EVD + +Y  RL A NT
Sbjct: 176 TKTTGSRVNLEVDVLAKYTERLLAFNT 202


>gi|82701144|ref|YP_410710.1| riboflavin synthase subunit alpha [Nitrosospira multiformis ATCC
           25196]
 gi|82409209|gb|ABB73318.1| riboflavin synthase, alpha subunit [Nitrosospira multiformis ATCC
           25196]
          Length = 208

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 86/199 (43%), Positives = 120/199 (60%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G+I    P   G+ LR+     + ++ K+G SIA  G+CLTV  L      
Sbjct: 1   MFTGIVEAVGEIKTANPQKNGLSLRIAPGKLSLAETKVGDSIAVNGVCLTVTGL-----A 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           DN   V+V  ET + T       G  +NLE+S++L D LDGHLVSGH+DG  E+     +
Sbjct: 56  DNLLSVDVSGETLQCTQ-GLDKPGGKVNLEKSLRLSDGLDGHLVSGHVDGVGEVTKFQPL 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    + LP +L ++IA KGS+ +NGVSLTVN V ++  ++ LI HT+ ETT K  K 
Sbjct: 115 GESSLLAIRLPDSLLKYIAKKGSITVNGVSLTVNRVERDELEINLIPHTLAETTLKELKA 174

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 175 GARVNVEVDMLARYVERLL 193


>gi|297569248|ref|YP_003690592.1| riboflavin synthase, alpha subunit [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925163|gb|ADH85973.1| riboflavin synthase, alpha subunit [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 222

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GK+ A  P   GM L + T +       G SIA  G+CLT   +   H   
Sbjct: 1   MFTGIILGKGKVKAKRPAGGGMTLALETDFPLPDPVEGESIAVNGVCLTARDIRGRH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   TN+   G+G  +NLER+++L DRL GH+VSGH+D    +L    +G
Sbjct: 58  --FLADVSPESLTRTNLGRLGVGGVVNLERALRLSDRLGGHMVSGHVDAVTTVLARRALG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                  ++P  L ++I  KGSV L+G+SLTVN V +  F V +I HT+E TT     VG
Sbjct: 116 TFTLFDFAVPPGLGRYIIAKGSVALDGISLTVNEVDEERFSVSIIPHTLEITTLGEVAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ +L +
Sbjct: 176 DGVNLEVDLIGKYVEKLLS 194


>gi|226942826|ref|YP_002797899.1| riboflavin synthase subunit alpha [Azotobacter vinelandii DJ]
 gi|226717753|gb|ACO76924.1| riboflavin synthase, alpha subunit [Azotobacter vinelandii DJ]
          Length = 219

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP     R+ V T   + S +KLG SIA  GICLT V L      
Sbjct: 1   MFTGIIEAIGTIRALTPKGGDARVYVHTGKLDLSDVKLGDSIAVNGICLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  E+L  +  
Sbjct: 56  GDGFWADVSRETLARTAFIDLKAGSRVNLEKALTPTSRLGGHLVSGHVDGVGEVLSREDN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA+KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFRIHAPRELARYIALKGSITVDGTSLTVNGVNGAEFELTIVPHTLGETIMADYRP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRQVNLEVDLLARYLERLMLGDKA 199


>gi|219668834|ref|YP_002459269.1| riboflavin synthase subunit alpha [Desulfitobacterium hafniense
           DCB-2]
 gi|219539094|gb|ACL20833.1| riboflavin synthase, alpha subunit [Desulfitobacterium hafniense
           DCB-2]
          Length = 214

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +  +    +L +  +      ++G SIA  GICLTVV++       
Sbjct: 1   MFTGIIEELGKVTDLKVLPDSAQLTLEGTKVLESTQIGDSIAVNGICLTVVKM-----QG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V AET   TN+     GT +NLER+++L  RL GHLVSGH+DG   I  +  +G
Sbjct: 56  NLFTVDVMAETLHKTNLKECSRGTQVNLERALQLSTRLGGHLVSGHVDGVGTIQKITPVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     L  ++  KGS+ ++G+SLTV  +    F V LI HT +ETT     VG
Sbjct: 116 IARVFTIKATPELLNYVLPKGSIAIDGISLTVVELLPQAFTVSLIPHTRQETTLGFKGVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+AR      +
Sbjct: 176 DVVNLETDLIGKYVARFMEKKEA 198


>gi|254465336|ref|ZP_05078747.1| riboflavin synthase, alpha subunit [Rhodobacterales bacterium Y4I]
 gi|206686244|gb|EDZ46726.1| riboflavin synthase, alpha subunit [Rhodobacterales bacterium Y4I]
          Length = 195

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 96/197 (48%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I  +      +R R+ T Y+T+ + +G SIA  G+CLTVV L      D
Sbjct: 1   MFTGIITDVGTIAELEQQGD-LRARIRTGYDTATIDIGASIASDGVCLTVVALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V+V AET   TN+ +W +G  +NLER++K+GD L GH+VSGH+DG   ++ +   G
Sbjct: 55  DWYDVQVSAETVSKTNLGAWTVGKRVNLERALKVGDELGGHIVSGHVDGVAGVVAMTDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   KVG
Sbjct: 115 DSTRVTLRAPEALARFIAPKGSVALNGTSLTVNDVDGCDFGINFIPHTKEVTTWGDVKVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+E+D++ RY+ARL
Sbjct: 175 DQINLEIDTLARYVARL 191


>gi|146293871|ref|YP_001184295.1| riboflavin synthase subunit alpha [Shewanella putrefaciens CN-32]
 gi|145565561|gb|ABP76496.1| riboflavin synthase, alpha subunit [Shewanella putrefaciens CN-32]
 gi|319427243|gb|ADV55317.1| riboflavin synthase, alpha subunit [Shewanella putrefaciens 200]
          Length = 218

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGTLRKLERKGDDIRLTVASGKLDLTDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +NIEVD + RY+ RL   +
Sbjct: 176 GDKVNIEVDLIARYLERLMNYD 197


>gi|296129705|ref|YP_003636955.1| riboflavin synthase, alpha subunit [Cellulomonas flavigena DSM
           20109]
 gi|296021520|gb|ADG74756.1| riboflavin synthase, alpha subunit [Cellulomonas flavigena DSM
           20109]
          Length = 204

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 107/204 (52%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTP---IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIV ++G ++A+ P        RL+V     TS  +LG SIA +G+CLTV  L    
Sbjct: 1   MFTGIVEEMGTVVALVPGVGDEADARLQVRGPLVTSDARLGDSIAVSGVCLTVAEL---- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D  +  +V  ET R + +     G  +NLER++ +G R  GH+V GH+DG   +    
Sbjct: 57  PGDGTFVADVMPETLRRSALGELREGDAVNLERALAVGGRYGGHVVQGHVDGVGVVRARR 116

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
                    + L   L +++A KGS+ + GVSLTV  V  + F V LI  T+E TT    
Sbjct: 117 PGPRWDDVEIGLDPALARYVAEKGSITVQGVSLTVTHVSDDAFGVSLIPTTLEVTTLGSL 176

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
             G  +N+EVD + +Y  RL A +
Sbjct: 177 APGARVNLEVDVLAKYTERLLAAS 200


>gi|254441128|ref|ZP_05054621.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 307]
 gi|198251206|gb|EDY75521.1| riboflavin synthase, alpha subunit [Octadecabacter antarcticus 307]
          Length = 202

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 93/199 (46%), Positives = 129/199 (64%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+++A+  +   +R R+ T Y+ S + +G SIA  G+CLTVV        D
Sbjct: 1   MFTGIITDVGRVLALEDLGD-LRARIATRYDISGIDIGASIASDGVCLTVVAKGTSLDCD 59

Query: 61  --NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WY+V++ AET   T++ +W +G  +NLERS+K+GD L GH+VSGH+DG   I+ +  
Sbjct: 60  PQGWYDVDISAETVSKTSLVAWVVGKRVNLERSLKVGDELGGHIVSGHVDGVAMIVDMVD 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            G S    L  P++L +FIA KGSV LNG S+TVN V    F +  I HT   TTW   K
Sbjct: 120 DGASTRVTLEAPNDLGRFIAPKGSVALNGTSVTVNEVDGARFGINFIPHTKSVTTWGDTK 179

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD +N+EVD+M RY+ARL
Sbjct: 180 VGDPVNLEVDTMARYVARL 198


>gi|34391426|gb|AAM77484.1| riboflavin synthase [Bartonella bovis]
          Length = 205

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 100/197 (50%), Positives = 133/197 (67%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTVV    + +  
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVVERELKQTNI 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W ET  +TN+A W  GTF+NLERS++LGD + GHLVSGH+D   EI+     G
Sbjct: 61  NCFVVEAWKETLYLTNLAKWTKGTFVNLERSLRLGDEIGGHLVSGHVDDLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLT+N +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKTSMRLAPFIAEKGSIALNGTSLTINSIEDNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|261417868|ref|YP_003251550.1| riboflavin synthase subunit alpha [Geobacillus sp. Y412MC61]
 gi|261374325|gb|ACX77068.1| riboflavin synthase, alpha subunit [Geobacillus sp. Y412MC61]
          Length = 214

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  M      + + +        ++LG SIA  G+CLTV   +E     
Sbjct: 1   MFTGIIEEIGTIEQMKQTGDAIVMTIGAKRVLEDVRLGDSIAVNGVCLTVTSFTERQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T + +   G+ +NLER++  G R  GH V+GH+DG   I+      
Sbjct: 58  --FTVDVMPETVKATALKTLKPGSKVNLERAMAAGGRFGGHFVTGHVDGVGRIIRQWPKA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P +L  ++  KGSV ++G SLT+  + +  F V LI HT E T     + G
Sbjct: 116 NAVYYEIEVPASLRAYMIEKGSVAVDGTSLTIFGLSERTFIVSLIPHTREATILGEKRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+NIE D + +Y+A       +
Sbjct: 176 DLVNIECDMIGKYVAAFLNAKAT 198


>gi|330830922|ref|YP_004393874.1| riboflavin synthase subunit alpha [Aeromonas veronii B565]
 gi|328806058|gb|AEB51257.1| Riboflavin synthase, alpha subunit [Aeromonas veronii B565]
          Length = 217

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      M L V     + S +KLG SIA  G+CLTVV L ++   
Sbjct: 1   MFTGIIEAVGTLAELRRQGDDMALTVHAPGLDFSDVKLGDSIATNGVCLTVVALGDKS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V  ET   T  A+  +G  +NLE+++    RL GHLVSGH+DG  E+  +   
Sbjct: 59  ---YTADVSLETLSRTGFAAARVGDRVNLEKALMPTSRLGGHLVSGHVDGVGEVKSVSSS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P  L ++IA KGS+ ++G+SLTVN V  + F + ++ HT +ETT    K 
Sbjct: 116 GRAIEYWIKAPGELSRYIAEKGSIAVDGISLTVNAVQGDLFRLTIVPHTAQETTIASWKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL    + +
Sbjct: 176 GHKVNLEVDQIARYLERLMMGKSQE 200


>gi|210621235|ref|ZP_03292541.1| hypothetical protein CLOHIR_00484 [Clostridium hiranonis DSM 13275]
 gi|210154846|gb|EEA85852.1| hypothetical protein CLOHIR_00484 [Clostridium hiranonis DSM 13275]
          Length = 212

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I+++       +L +        +  G SIA  GICLTV   S     D
Sbjct: 1   MFTGIIEEIGNIVSIKVNGDSRKLFIKADKILEDVHRGDSIAVNGICLTVTEFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET + T++      + +NLER++    R  GH+VSGHIDGT  +  ++   
Sbjct: 56  SEFSVDVMHETMKRTSLNKLKTNSKVNLERAMAANGRFGGHIVSGHIDGTGIVKNINKDS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + +++  KGS+ ++G+SLTV  V  N FDV +I HT+E T     K+ 
Sbjct: 116 NAIWYTIEADLKIMKYVVEKGSITIDGISLTVANVRTNSFDVSIIPHTLENTILAFKKIN 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+ +L   N  +
Sbjct: 176 DIVNIENDCIGKYVEKLMNKNKKE 199


>gi|319898991|ref|YP_004159084.1| Riboflavin synthase alpha chain [Bartonella clarridgeiae 73]
 gi|6572095|emb|CAB63088.1| riboflavin synthase alpha chain [Bartonella clarridgeiae]
 gi|125213054|dbj|BAF46401.1| riboflavin synthase [Bartonella clarridgeiae]
 gi|319402955|emb|CBI76506.1| Riboflavin synthase alpha chain [Bartonella clarridgeiae 73]
          Length = 205

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 101/197 (51%), Positives = 134/197 (68%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  + P+ +G+RL + T Y+   +K+G SIA +GICLT+V  + + +  
Sbjct: 1   MFTGIITDIGCIEDIQPLKQGIRLNISTHYDVESLKIGASIACSGICLTIVERALKSTAT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E   +TN+  W  GTF+NLERS++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  HWFAVEAWEEALCLTNLTQWTKGTFVNLERSLRLGDEIGGHLVFGHIDGLAEIIEKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L +P  L  FIA KGS+ LNG SLTVN V  N FDVL+IRHT+E T W   +VG
Sbjct: 121 DATRFHLQVPMQLAPFIAEKGSIALNGTSLTVNYVENNIFDVLIIRHTLEMTIWGQAEVG 180

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+EVD + RY+ARL
Sbjct: 181 DQVNLEVDQLARYVARL 197


>gi|223041906|ref|ZP_03612091.1| riboflavin synthase alpha chain [Actinobacillus minor 202]
 gi|223017260|gb|EEF15687.1| riboflavin synthase alpha chain [Actinobacillus minor 202]
          Length = 215

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I  +    +   + +  +   S + LG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEVGSIAQIHKQGEFAVVTINANKVLSDVHLGDSIAVNGVCLTVTSFT-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V +ET + T++      + +NLER++    R  GH+VSGHIDGT EI+ +    
Sbjct: 56  SQFTADVMSETLKRTSLGELKPSSPVNLERAMAANGRFGGHIVSGHIDGTGEIVEITPAN 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S + R+     L ++I  KGS+ ++G+SLTV    ++ F V +I HTI+ET     K+G
Sbjct: 116 HSTWYRIKTSAKLMRYIIEKGSITIDGISLTVVDTDESSFRVSIIPHTIKETNLGTKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            L+N+E D + +YI +       +
Sbjct: 176 SLVNLENDIVGKYIEQFLLKKEPE 199


>gi|54025571|ref|YP_119813.1| riboflavin synthase subunit alpha [Nocardia farcinica IFM 10152]
 gi|54017079|dbj|BAD58449.1| putative riboflavin synthase alpha subunit [Nocardia farcinica IFM
           10152]
          Length = 207

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 112/209 (53%), Gaps = 14/209 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A+  +A   RL +     TS    G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEELGEIVAVARLADAARLTIRGKLVTSDAGHGDSIAVNGVCLTVVDV----LDG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET   ++I     G  +NLER+  L  RL GHLV GH+DGT  +L      
Sbjct: 57  DSFTVDVMQETLDRSSIGGLEAGARVNLERAAALNSRLGGHLVQGHVDGTGTVLARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV----------NLVGKNFFDVLLIRHTIE 170
           +    R+SLP  + +++  KGS+ ++G+SLTV              +++F+V LI  T+ 
Sbjct: 117 NWEVVRISLPDAIARYVVEKGSITVDGISLTVSGLGRSEQPATDGNRDWFEVSLIPTTLS 176

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            T      VG  +N+EVD + +Y+ RL  
Sbjct: 177 LTNLGSAAVGTRVNLEVDVIAKYVERLQQ 205


>gi|159037491|ref|YP_001536744.1| riboflavin synthase subunit alpha [Salinispora arenicola CNS-205]
 gi|157916326|gb|ABV97753.1| riboflavin synthase, alpha subunit [Salinispora arenicola CNS-205]
          Length = 220

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 78/200 (39%), Positives = 114/200 (57%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLR-VMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++ +T  A+   L  +  S   +  + G SIA  G+CLTVV L      
Sbjct: 1   MFTGIVEELGEVVQVTQTAEDSALVAIRGSVVVADARHGDSIAVNGVCLTVVDL-----A 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D  +  +V  ET R + +     G  +NLER+  LG RL GHLV GH+DG  E+L  +  
Sbjct: 56  DGAFTADVMGETLRRSALGGLRPGDRVNLERAATLGSRLGGHLVQGHVDGIGEVLAREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP +L +++  KGS+ ++GVSLTV  VG ++F+V LI  T+  TT     V
Sbjct: 116 ARWETVRFRLPTDLARYVVTKGSITVDGVSLTVAGVGSDWFEVGLIPTTLGLTTLGSRGV 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           GD +N+EVD + +Y+ RL  
Sbjct: 176 GDAVNVEVDVLAKYVERLLG 195


>gi|299135083|ref|ZP_07028274.1| riboflavin synthase, alpha subunit [Afipia sp. 1NLS2]
 gi|298590060|gb|EFI50264.1| riboflavin synthase, alpha subunit [Afipia sp. 1NLS2]
          Length = 202

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 93/203 (45%), Positives = 133/203 (65%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+T+IG I+++ P A+G   RLR+  +Y+ + +  G SIA  G+CLTVVR S   +
Sbjct: 1   MFTGIITEIGDILSIKPSAQGQLHRLRIGCAYDQTTIADGASIACNGVCLTVVR-SGVEA 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+  AET R+T+  +W  G  +NLER++K+GD L GH+VSGH+DG   I+  + 
Sbjct: 60  GRTWFEVDAAAETLRMTSAKNWREGGRLNLERALKIGDELGGHIVSGHVDGIATIVVREN 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L  P  L +FIA KGSV L+GVSLTVN   ++ F VL+I HT++ TT +  +
Sbjct: 120 LPDMACFELRAPRELAKFIAAKGSVTLDGVSLTVNKAVEDIFSVLIIPHTLQVTTLQGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG  +N+E+D M RY ARL  + 
Sbjct: 180 VGSEVNLEIDVMARYAARLSEMR 202


>gi|126738751|ref|ZP_01754447.1| riboflavin synthase subunit alpha [Roseobacter sp. SK209-2-6]
 gi|126719932|gb|EBA16639.1| riboflavin synthase subunit alpha [Roseobacter sp. SK209-2-6]
          Length = 195

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 99/199 (49%), Positives = 130/199 (65%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ TSY+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIVTDIGTITHLEQQGD-LRARIKTSYDTSGIDMGASIASDGVCLTVVELGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TNI +W  G  +NLER++K+GD L GH+VSGH+DG  E++ L+  G
Sbjct: 55  DWYDVQISAETVSKTNIGAWEAGKRVNLERALKVGDELGGHIVSGHVDGVAEVVKLEDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   K+G
Sbjct: 115 DSTRVTLRAPEELARFIASKGSVALNGTSLTVNDVAGCDFGINFIPHTKEVTTWGDVKLG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E+D++ RY+ARL+ 
Sbjct: 175 DQVNLEIDTLARYVARLHE 193


>gi|213969283|ref|ZP_03397421.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|301381787|ref|ZP_07230205.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061013|ref|ZP_07252554.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           K40]
 gi|302130535|ref|ZP_07256525.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213925961|gb|EEB59518.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv. tomato
           T1]
 gi|330964922|gb|EGH65182.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331018227|gb|EGH98283.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 220

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    +  
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYLP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|166710622|ref|ZP_02241829.1| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 200

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 73/202 (36%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  +  ++A KGS+C++GVSLTVN V +  F+V LI HTI  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLHYVAKKGSICVDGVSLTVNEVDEEGFEVALIPHTIANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GATVNLEIDLVARYVERLLGTR 197


>gi|257153177|dbj|BAI23143.1| riboflavin synthase [Bartonella washoensis]
          Length = 206

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGVRLDISTRYDIESLEIGASIACSGICLTIVERGLKQATT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ VE W E  R+TN+A W  GTF+NLERS++ G+ + GHLVSGHIDG  EI+     G
Sbjct: 61  GWFVVEAWEEALRLTNLAQWTKGTFVNLERSLRFGNEMGGHLVSGHIDGLAEIIDKRNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNGVSLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPKQFVPFIVNKGSIALNGVSLTVNCVENYIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|161579025|ref|NP_870472.2| riboflavin synthase subunit alpha [Rhodopirellula baltica SH 1]
          Length = 224

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 109/208 (52%), Gaps = 10/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-----NTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTG+V  +G++ A+     G RL +             +KLG SIA  G CLTVV +  
Sbjct: 1   MFTGLVESVGQLSAVVEQPPGRRLVITAPSFRDDDPARDVKLGDSIAINGCCLTVVEID- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                +    E   ET   TN+      + +NLERS+ +GDR+ GH V+GH+D   +++ 
Sbjct: 60  ----GDKLSFEAGEETLSRTNLGELTAESTVNLERSLAVGDRMGGHYVTGHVDCVGQLIE 115

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
                     + S+P    + I  KGS+ ++G+SLTV  VG+++F V LI HT++ TT  
Sbjct: 116 RIDDPPWANLKFSVPAPYPRQIVAKGSITVDGISLTVVDVGEDYFTVALIPHTLDATTLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
             +VGD IN+E D + +Y+ R      +
Sbjct: 176 RRRVGDHINLETDLLAKYVQRTLQFGNA 203


>gi|125213039|dbj|BAF46397.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 102/201 (50%), Positives = 134/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLTVV    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLNKGVHLNISTRYDIDSLEIGASIACSGICLTVVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L LP  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQLPTRLTPFIVNKGSIALNGTSLTVNSVEDRIFDVLIIRHTLQMTTWGQVKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D + RY A+L    
Sbjct: 181 DQINLEIDQLARYAAKLSGFK 201


>gi|85372856|ref|YP_456918.1| riboflavin synthase subunit alpha [Erythrobacter litoralis
           HTCC2594]
 gi|84785939|gb|ABC62121.1| riboflavin synthase alpha chain [Erythrobacter litoralis HTCC2594]
          Length = 206

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 119/208 (57%), Gaps = 7/208 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG I +   ++  +R+RV   Y+ + + +G SIA +G C+TVV        D
Sbjct: 1   MFTGIVTAIGTIESAEQLSD-LRVRVRCPYDPADIAIGASIACSGACMTVVDRGGREG-D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V  E+   T    W +G  +NLE ++KLGD L GH+V+GH+D    +     +G
Sbjct: 59  AWFAVDVSGESVSKTASDMWQVGGALNLETALKLGDELGGHIVTGHVDAVGTVESAVEVG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
            S   ++  P +L  +IA KGS+ ++GVSLTVN V     G   F + +I HT E TT  
Sbjct: 119 GSHTVKIRAPKDLAPYIAPKGSITVDGVSLTVNEVTDHDDGSCTFSLNIIPHTWEVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
             + G  +N+E+D + RY+ R+ +L  +
Sbjct: 179 RIEAGSEVNLEIDVLARYLRRMESLRAA 206


>gi|32448032|emb|CAD77549.1| riboflavin synthase alpha chain [Rhodopirellula baltica SH 1]
          Length = 240

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 109/208 (52%), Gaps = 10/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-----NTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTG+V  +G++ A+     G RL +             +KLG SIA  G CLTVV +  
Sbjct: 17  MFTGLVESVGQLSAVVEQPPGRRLVITAPSFRDDDPARDVKLGDSIAINGCCLTVVEID- 75

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                +    E   ET   TN+      + +NLERS+ +GDR+ GH V+GH+D   +++ 
Sbjct: 76  ----GDKLSFEAGEETLSRTNLGELTAESTVNLERSLAVGDRMGGHYVTGHVDCVGQLIE 131

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
                     + S+P    + I  KGS+ ++G+SLTV  VG+++F V LI HT++ TT  
Sbjct: 132 RIDDPPWANLKFSVPAPYPRQIVAKGSITVDGISLTVVDVGEDYFTVALIPHTLDATTLG 191

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
             +VGD IN+E D + +Y+ R      +
Sbjct: 192 RRRVGDHINLETDLLAKYVQRTLQFGNA 219


>gi|297627299|ref|YP_003689062.1| riboflavin synthase alpha chain [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296923064|emb|CBL57648.1| Riboflavin synthase alpha chain [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 220

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 79/200 (39%), Positives = 106/200 (53%), Gaps = 5/200 (2%)

Query: 1   MFTGIVTDIGKI-IAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ +IG I  +      G RL +      S    GCSIA  G CLTVV L      
Sbjct: 1   MFTGIIEEIGTIDTSAPAEGGGARLAIRGPLAVSDATPGCSIAVNGTCLTVVDL----PG 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ + V++  ET R T++     G+ +NLER+++   RLDGH V GH+DG   +L     
Sbjct: 57  DDSFVVDLMPETLRRTSLGRLSQGSQVNLERAMRADARLDGHQVQGHVDGLATLLERTDA 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
              +     +P  L   IA KG+V L+GVSLTV  VG     V LI  T+  TT    +V
Sbjct: 117 DGWVELEFGVPDALGPLIAEKGAVALDGVSLTVTHVGPASLGVALIPETLRMTTLGGLEV 176

Query: 180 GDLINIEVDSMMRYIARLYA 199
           GD++NIEVD + RY+ R   
Sbjct: 177 GDVVNIEVDPVARYVERQLQ 196


>gi|170783176|ref|YP_001711510.1| riboflavin synthase subunit alpha [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169157746|emb|CAQ02948.1| riboflavin synthase alpha chain [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 224

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 71/211 (33%), Positives = 115/211 (54%), Gaps = 12/211 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G+++A+       R+ V      S  + G SI+  G+CLTVV  + E    
Sbjct: 2   MFTGIIEERGRVLALDAEGDSARITVEAPLAVSDARHGDSISVDGVCLTVVAQTPE---- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  +T  ++++   G+G  +NLER+ ++GDRL GH+V GH+DGT  +L      
Sbjct: 58  -GFTADVMRQTLVMSSLGRLGVGDRVNLERAARVGDRLGGHIVQGHVDGTGRLLATTPGE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-------FFDVLLIRHTIEETT 173
                R SLP  L   +  +GS+ + GVSLTV+ V          +F+V LI  T+  TT
Sbjct: 117 AWRILRFSLPAELSPLVVDRGSITVQGVSLTVSAVSPTDTPDADAWFEVSLIPETLAATT 176

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
               ++GD +N+E D + R++ R+ AL+  +
Sbjct: 177 LGALELGDEVNLETDVLARHVQRMLALDARR 207


>gi|125624335|ref|YP_001032818.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|44662841|gb|AAS47501.1| riboflavin synthase alpha subunit [Lactococcus lactis subsp.
           cremoris NZ9000]
 gi|124493143|emb|CAL98107.1| RibB protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|300071119|gb|ADJ60519.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 215

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 116/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG++  +    K  +L +  S     +KLG SI+  G+CLTV   + +    
Sbjct: 1   MFTGIIEEIGEVTQIQKRDKSSKLIIRASSILEDLKLGDSISTNGLCLTVSAFNHKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ + +N+    +G+ +NLER+V L  R  GH+VSGHIDGT +IL +    
Sbjct: 58  --FTADVMPESFKRSNLGELTVGSKVNLERAVALNGRFGGHIVSGHIDGTGKILSIKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++       +L +++  KGS+ ++G+SLTV  V    F V +I HTI+ET     KVG
Sbjct: 116 NAVWFEFQTTVDLMKYVVEKGSITIDGISLTVAHVTSKSFSVSIIPHTIKETILSAKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +YI +L     S
Sbjct: 176 DKVNLENDILGKYIEKLLTGKDS 198


>gi|310642613|ref|YP_003947371.1| riboflavin synthase alpha chain-like protein [Paenibacillus
           polymyxa SC2]
 gi|309247563|gb|ADO57130.1| Riboflavin synthase alpha chain-like protein [Paenibacillus
           polymyxa SC2]
          Length = 221

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 63/204 (30%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+I +++   + M L +  S     +K+G S++  G+CLT +++  +    
Sbjct: 1   MFTGLVEEVGRIQSISKSGEAMVLGISGSVVLGDLKIGDSVSVNGVCLTAIQIGTKD--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++V+V  ET R +N+     G+ +NLER++    R  GH+V GH+DGT  I  +    
Sbjct: 58  --FKVDVMPETFRSSNLRELRSGSRVNLERAMAANGRFGGHIVQGHVDGTGTIRGVTSDQ 115

Query: 121 D-SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +  ++        L +++ +KGS+ ++G+SLTV    ++ F V +I HT+ ET  +  + 
Sbjct: 116 NAVVFEVEPSDQALFKYVLLKGSITIDGISLTVAQRTRDSFAVSIIPHTLAETALQAKRE 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +NIE D + +Y+ +L     S
Sbjct: 176 GDTVNIECDILGKYVEQLLHYRGS 199


>gi|291518543|emb|CBK73764.1| riboflavin synthase, alpha subunit [Butyrivibrio fibrisolvens 16/4]
          Length = 210

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +T  +K  RL +        M +G SIA  G+CLTVV  +      
Sbjct: 1   MFTGIIEELGKVQRITRGSKEQRLVINCKKILEDMHIGDSIAVNGVCLTVVEFN-----I 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   + +    +G+ +NLER++    R  GH+VSGHIDGT +I  +   G
Sbjct: 56  NSFSADVMNETFSRSGLGELTLGSVVNLERAMAANGRFGGHIVSGHIDGTGKIKSVRQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +S+   + + I  KGS+ ++G+SLTV  VG++ F V +I HT++ T     +VG
Sbjct: 116 NAVWFEISVDSKILRGIVEKGSIAIDGISLTVAAVGRDSFKVSIIPHTLKVTVLGSKRVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +YI++   
Sbjct: 176 DRVNLENDVIGKYISKFLG 194


>gi|261856454|ref|YP_003263737.1| riboflavin synthase, subunit alpha [Halothiobacillus neapolitanus
           c2]
 gi|261836923|gb|ACX96690.1| riboflavin synthase, alpha subunit [Halothiobacillus neapolitanus
           c2]
          Length = 216

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 110/203 (54%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  + P    ++L +     + +K+ LG SIA  G+CLTV         
Sbjct: 1   MFTGIIQSVGSMQTLAPKGGDIQLTIDAGKLDMNKIALGDSIAVNGVCLTVTAFD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + + V+   ET + T +     G+ +NLE ++ L   L GHLVSGH+DG  E+      
Sbjct: 56  AHSFTVDCSRETLKFTTLGHLKPGSPVNLETALTLSTPLGGHLVSGHVDGLAEVESRSED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L  P +L ++IA KGSV ++GVSLTVN V    F + +I HT+E+T    ++ 
Sbjct: 116 ARATSFWLRAPDDLSKYIAKKGSVTIDGVSLTVNDVDGARFRLTIIPHTLEQTIMGRYQA 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           G  +N+E+D + RY+ RL A   
Sbjct: 176 GGSVNLEIDVVARYLERLLAGQA 198


>gi|257153185|dbj|BAI23147.1| riboflavin synthase [Bartonella washoensis]
 gi|257153187|dbj|BAI23148.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 99/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVENVQSLNQGVHLNISTRYDIESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPRQLTPFIVNKGSIALNGTSLTVNSVEDRIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D + RY A+L    
Sbjct: 181 DQINLEIDQLARYAAKLSGFK 201


>gi|283795227|ref|ZP_06344380.1| riboflavin synthase, alpha subunit [Clostridium sp. M62/1]
 gi|309778324|ref|ZP_07673251.1| riboflavin synthase, alpha subunit [Erysipelotrichaceae bacterium
           3_1_53]
 gi|313898830|ref|ZP_07832364.1| riboflavin synthase, alpha subunit [Clostridium sp. HGF2]
 gi|319935116|ref|ZP_08009556.1| riboflavin synthase subunit alpha [Coprobacillus sp. 29_1]
 gi|291076873|gb|EFE14237.1| riboflavin synthase, alpha subunit [Clostridium sp. M62/1]
 gi|295098853|emb|CBK87942.1| riboflavin synthase, alpha subunit [Eubacterium cylindroides T2-87]
 gi|308913920|gb|EFP59733.1| riboflavin synthase, alpha subunit [Erysipelotrichaceae bacterium
           3_1_53]
 gi|312956412|gb|EFR38046.1| riboflavin synthase, alpha subunit [Clostridium sp. HGF2]
 gi|319809941|gb|EFW06324.1| riboflavin synthase subunit alpha [Coprobacillus sp. 29_1]
          Length = 211

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 115/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +       +L +  S     + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDTCNCKLSIKASKILEDIHLGDSIAVNGICLTVTCFTRQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T ++    G+ +NLER++ +  RL GH+V+GHIDGT  I  +    
Sbjct: 58  --FTVDVMNETWNRTALSLLRHGSLVNLERAMPMNGRLGGHIVTGHIDGTGRISSVRRDK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQREILNLIVEKGSIAIDGISLTVAKVSKADFSVSVIPHTLEQTILKNKQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+ +L   +  
Sbjct: 176 DMVNLENDILGKYVQKLIDNSNE 198


>gi|34391416|gb|AAM77479.1| riboflavin synthase [Bartonella birtlesii]
 gi|124358780|dbj|BAF46059.1| riboflavin synthase [Bartonella capreoli]
          Length = 205

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 101/201 (50%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTV+    +    
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIERELKQVNA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W E   +TNIA W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  NCFVVEAWKEALCLTNIAQWTKGTFVNLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKASMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + RY+ARL    
Sbjct: 181 DQVNLEVDQLARYVARLSNFK 201


>gi|86137882|ref|ZP_01056458.1| riboflavin synthase subunit alpha [Roseobacter sp. MED193]
 gi|85825474|gb|EAQ45673.1| riboflavin synthase subunit alpha [Roseobacter sp. MED193]
          Length = 195

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 98/199 (49%), Positives = 130/199 (65%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ T+Y TS + LG SIA  G+CLTV+ L +     
Sbjct: 1   MFTGIVTDIGTIAQLDQQGD-LRARIATNYETSGIDLGASIASDGVCLTVIELGK----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+ +W IG  +NLER++K+GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWYDVQISAETVSKTNVGAWKIGKRVNLERALKVGDELGGHIVSGHVDGVAEVVELQDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   K+G
Sbjct: 115 DSTRVTLRAPKELARFIAPKGSVALNGTSLTVNDVQGCDFGINFIPHTKEVTTWGDVKLG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E+D++ RY+ARL+ 
Sbjct: 175 DQVNLEIDTLARYVARLHE 193


>gi|332307439|ref|YP_004435290.1| riboflavin synthase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174768|gb|AEE24022.1| riboflavin synthase, alpha subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 221

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 126/204 (61%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ D+G I ++TP    +RLR+  +  + S + LG SIA+ G+CLTVV +S     
Sbjct: 1   MFTGIIEDVGHIESLTPTGDDIRLRIRVNKLDMSDVALGDSIANNGVCLTVVDMS----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + +  A +  G+ +NLE+++    R  GH+VSGH+DG  E++ ++ +
Sbjct: 56  ASGFSADVSHETIKRSGFADYKAGSKVNLEKAMLPSSRFGGHIVSGHVDGVGEVISVNPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G  +   +  P++L +++A KGS+ ++GVSLTVN V    F + LI H+++ET    +K 
Sbjct: 116 GRYVEIWVQAPNDLARYLAEKGSITVDGVSLTVNAVDGAKFLITLIPHSLQETIIGGYKK 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  IN+EVD + RY+ RL   + +
Sbjct: 176 GTKINLEVDVVARYLERLMLGDKA 199


>gi|332992367|gb|AEF02422.1| riboflavin synthase subunit alpha [Alteromonas sp. SN2]
          Length = 220

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 124/204 (60%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVM-TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GKI  +      +RL V  T+ + + + LG SIA  G+CLTV  +      
Sbjct: 1   MFTGIIQALGKITKLDNRGSDIRLTVSSTTLDMADVALGDSIATNGVCLTVTDMGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  +V AET ++T  A +G G+ +NLE++++  DRL GH+VSGH+DG  EI  +   
Sbjct: 57  -DYYCADVSAETIKLTGFAHYGTGSTVNLEKAMRPTDRLGGHIVSGHVDGVGEISKIIKH 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D +   +  P +L ++IA KGS+ ++GVSLTVN V    F + +I HT++ET    ++V
Sbjct: 116 TDYVEFWVKAPTSLAKYIAHKGSITVDGVSLTVNEVNGAEFMLWIIPHTLKETVMGHYEV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTAVNLEVDVIARYLERLMMGDKA 199


>gi|28867919|ref|NP_790538.1| riboflavin synthase subunit alpha [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851155|gb|AAO54233.1| riboflavin synthase, alpha subunit [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 220

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    +R+ V T   + S +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIESIGSIRALTPKGGDVRVYVETGKLDLSDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLTVTAFVDLKSGSRVNLEKALTPTTRLGGHLVSGHVDGVGEIVARADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++   +  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    +  
Sbjct: 116 ARAIQFTVRAPRELAKYIAHKGSITVDGTSLTVNSVNGAEFELTIVPHTLSETIMADYLP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|72161482|ref|YP_289139.1| riboflavin synthase subunit alpha [Thermobifida fusca YX]
 gi|71915214|gb|AAZ55116.1| Lumazine-binding protein [Thermobifida fusca YX]
          Length = 205

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/205 (36%), Positives = 112/205 (54%), Gaps = 9/205 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV ++G ++ +TP+       +RL +     TS    G SIA  G+CLTV  L   
Sbjct: 1   MFTGIVEELGTVVEVTPVGSDSADAIRLTIHGPDVTSDASPGDSIAVNGVCLTVTEL--- 57

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
              D  +  +V  ET   +N+ +  +G+ +NLER++K+  RL GH+V GH+DGT  +   
Sbjct: 58  --ADGRFSADVMKETLDRSNLGALTVGSPVNLERALKVSSRLGGHIVQGHVDGTGVVTER 115

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
               D      SLP  L +++  KGS+ ++GVSLTV     + F V LI  T++ TT   
Sbjct: 116 VPGTDWETVTFSLPARLSRYVVEKGSIAVDGVSLTVAACTDSSFTVSLIPTTLQATTLGF 175

Query: 177 HKVGDLINIEVDSMMRYIARLYALN 201
             VG  +NIEVD++ +Y+ RL    
Sbjct: 176 ATVGTKVNIEVDTLAKYVERLLGDR 200


>gi|291522093|emb|CBK80386.1| riboflavin synthase, alpha subunit [Coprococcus catus GD/7]
          Length = 218

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  + P     RL V  +      ++G SIA  GICLTV  +       
Sbjct: 1   MFTGIIEEIGIVKQLVPGKVSYRLTVSANKVLEGTQVGDSIATNGICLTVTAI-----HG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N ++ +V AET R TN +S   G+ +NLER++    RL GH+VSGHIDGT  I  +    
Sbjct: 56  NNFDADVMAETVRRTNFSSLHAGSRVNLERALTPMSRLGGHIVSGHIDGTGTISDMTRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    +L +++  KGS+ ++GVSLT+  V    F V +I HT EET     K G
Sbjct: 116 NAVWVTVQTKPDLLKYMIEKGSIAIDGVSLTIAYVDDGCFKVSVIPHTGEETILLKKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L      +
Sbjct: 176 DTVNLECDLIGKYVEKLLFGKAEE 199


>gi|258546001|ref|ZP_05706235.1| riboflavin synthase, alpha subunit [Cardiobacterium hominis ATCC
           15826]
 gi|258518730|gb|EEV87589.1| riboflavin synthase, alpha subunit [Cardiobacterium hominis ATCC
           15826]
          Length = 214

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G +           L + +  ++ S+  LG SIA  G+CLT V L+     
Sbjct: 1   MFTGIIETTGSLQRRDDHGDDCTLTIASDTFDFSRCALGDSIAVNGVCLTAVALTP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET R+T + S   G  +NLE ++ L   L GHLVSGH+DG  E+L  +  
Sbjct: 57  -HSFSADVSHETLRLTTLGSLQSGDAVNLEYALTLATPLGGHLVSGHVDGVGELLAREAD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S     + P  L ++IA KGS+ +NGVSLTVN V  N F V ++ HT+  TT    + 
Sbjct: 116 ARSERLTFAAPAPLARYIAAKGSITINGVSLTVNTVDANRFSVNIVPHTMSRTTLGALQP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +N+EVD + RY+ RL      
Sbjct: 176 GDAVNLEVDLVARYLERLLTAPQE 199


>gi|288555992|ref|YP_003427927.1| riboflavin synthase subunit alpha [Bacillus pseudofirmus OF4]
 gi|288547152|gb|ADC51035.1| riboflavin synthase subunit alpha [Bacillus pseudofirmus OF4]
          Length = 223

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+I  +    + + + +      S + LG SIA  G+CLTV   +     +
Sbjct: 1   MFTGIIEEIGRIDQVRQSGEAIVMNIAAKKVLSDVALGDSIAVNGVCLTVTSYT-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V++  ET R T++   G G  +NLER++    R  GH VSGH+DG  +I+  +   
Sbjct: 56  HSFTVDLMPETVRATSLNGLGRGAKVNLERAMSAEGRFGGHFVSGHVDGIGKIISKEPKD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L  ++  KGSV ++G SLT+  V +N F + +I HTIEET      VG
Sbjct: 116 NAVYYTIEVSDDLRHYMIHKGSVAVDGTSLTIFGVDENSFTISIIPHTIEETIIGSKGVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++NIE D + +YI +      S
Sbjct: 176 DIVNIECDMIGKYIEQFITRKKS 198


>gi|87200871|ref|YP_498128.1| riboflavin synthase subunit alpha [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136552|gb|ABD27294.1| riboflavin synthase, alpha subunit [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 207

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 118/205 (57%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT++G I+A+        + +  + + +K+ +G SIA +G+CLTVV         
Sbjct: 1   MFTGIVTEVGNILAIEDKGD-RHVTISCAMDPAKIAIGASIACSGVCLTVVDKGGVAGEG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V+V  ET   T    W +G  +NLE ++KLGD L GH+V+GH+D   E++ +   G
Sbjct: 60  -WFAVDVSGETVSRTAPEQWTVGAPLNLEPALKLGDELGGHIVTGHVDAVGEVVGVCPEG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
            S+   +S P  L  +IA KGS+ +NGVSLTVN V     G   F + +I HT + TT  
Sbjct: 119 ASLKFGISAPKELAPYIAAKGSITVNGVSLTVNEVADQPDGSCHFALNIIPHTAQVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
               G  +N+E+D + RY+ R+ +L
Sbjct: 179 TLAPGHKVNLEIDVLARYLKRMQSL 203


>gi|254505270|ref|ZP_05117421.1| riboflavin synthase, alpha subunit [Labrenzia alexandrii DFL-11]
 gi|222441341|gb|EEE48020.1| riboflavin synthase, alpha subunit [Labrenzia alexandrii DFL-11]
          Length = 203

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 97/203 (47%), Positives = 123/203 (60%), Gaps = 1/203 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I +   I  G R R+ T Y+T    +G SI+  G+C TV    E  S  
Sbjct: 1   MFTGIVTDLGEIQSALDIPAGKRTRIKTLYDTDSFDIGASISCDGVCHTVTA-KENSSGG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EVE  AET  +TN+++W  G  +NLERS+ +G  L GHLV GH+DG  EI   +   
Sbjct: 60  NWFEVESAAETLALTNVSNWKEGQTLNLERSLTMGAELGGHLVLGHVDGVAEITKREDHP 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+Y +   P  + +FIA KGSV LNG SLTVN V    F V LI HT+E T W   K G
Sbjct: 120 DSVYFQFRAPEGVAKFIAKKGSVALNGTSLTVNEVDGLLFSVFLIPHTLEVTNWSNSKAG 179

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD M RY ARL     +
Sbjct: 180 DRVNLEVDMMARYAARLAEFTKT 202


>gi|193215777|ref|YP_001996976.1| riboflavin synthase subunit alpha [Chloroherpeton thalassium ATCC
           35110]
 gi|193089254|gb|ACF14529.1| riboflavin synthase, alpha subunit [Chloroherpeton thalassium ATCC
           35110]
          Length = 221

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/203 (33%), Positives = 111/203 (54%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV D+GKII++     G+R  V  +  + + + +  S+A  G C TVV ++ +   
Sbjct: 1   MFTGIVKDVGKIISVVKRGDGLRFSVKINSPDFADLAIDESVAINGACQTVVAVTGQA-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +EV+   ET + T + S+ IG  +NLER+++  DR+ GH+V GH+D   +IL ++  
Sbjct: 59  ---FEVDTVEETLKKTTLGSYKIGRRVNLERAIRPIDRMGGHIVQGHVDCVGQILSIEKQ 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   ++        FI   GS+ ++G+SLTV  V  + F + +I +T   TT      
Sbjct: 116 SASWKYKIRYESKFNPFIVPIGSIAVDGISLTVAEVSASVFTLAIIPYTFAHTTLAERLP 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           GD +N+E D + +YIA    LN 
Sbjct: 176 GDAVNLEFDILGKYIAHQLQLNR 198


>gi|114776394|ref|ZP_01451439.1| riboflavin synthase subunit alpha [Mariprofundus ferrooxydans PV-1]
 gi|114553224|gb|EAU55622.1| riboflavin synthase subunit alpha [Mariprofundus ferrooxydans PV-1]
          Length = 202

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 4/204 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G+I A+    + M ++V ++ +     LG S+A  G CLT+      H   
Sbjct: 1   MFTGIIQDVGRITAIASEPQQMHIQVESTLDMQGWALGDSVAVNGCCLTITAFPSAHH-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +   +  ET  +T  A   +G  +NLE ++++GD L GH+VSGH+DG   +  +  +G
Sbjct: 59  --FAATLSQETLDLTCFARAAVGDAVNLEPALRMGDALGGHMVSGHVDGVGTLCSITPVG 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +       LP  L +++ VKGSV ++GVSLTVN V    F V LI HT+  T     K G
Sbjct: 117 EHRVFEFELPVALARYVVVKGSVAVHGVSLTVNSVDGCRFSVNLIPHTLTHTCLGTLKSG 176

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +NIE D   RY+ RL      +
Sbjct: 177 GRVNIETDMYGRYVERLTQFAQQE 200


>gi|120598058|ref|YP_962632.1| riboflavin synthase subunit alpha [Shewanella sp. W3-18-1]
 gi|120558151|gb|ABM24078.1| riboflavin synthase, alpha subunit [Shewanella sp. W3-18-1]
          Length = 218

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   + + ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIEAVGILRKLERKGDDIRLTVASGKLDLTDVRLGDSIATNGVCLTVV-----QQL 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V AET  +T  A++ +GT +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  ADGYVADVSAETVSLTGFANYKVGTKVNLEKAVTPTTRLGGHMVSGHVDGIATVEQRLVR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  + F + ++ HT  ETT    + 
Sbjct: 116 GQAIEFWLAAPAELGRYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLQA 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +NIEVD + RY+ RL   +
Sbjct: 176 GDKVNIEVDLIARYLERLMNYD 197


>gi|284047736|ref|YP_003398075.1| riboflavin synthase, alpha subunit [Acidaminococcus fermentans DSM
           20731]
 gi|283951957|gb|ADB46760.1| riboflavin synthase, alpha subunit [Acidaminococcus fermentans DSM
           20731]
          Length = 212

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++GK+  +       RL +        +K+G S+   G CLTV +   +    
Sbjct: 1   MFTGLIAELGKVEDLRREQNSYRLTIAAQTIPPLLKIGESVCCNGACLTVTKFDSQR--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R T I S   G  INLER++ +GD LDGH+VSGH+DG   I+ +   G
Sbjct: 58  --FTVDVMPETARRTTIGSLKKGDRINLERTLHVGDGLDGHIVSGHVDGVGTIVKIRPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +S    L + +  KGS+ ++G+SLT+  V    F V LI  T++ TT    K G
Sbjct: 116 IAKVTTISCSPELLRGMVTKGSIAIDGISLTITEVTDTTFSVSLIPLTVQFTTLGFKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ R+     S
Sbjct: 176 DKVNLETDILGKYVERMLETRKS 198


>gi|253578466|ref|ZP_04855738.1| riboflavin synthase alpha subunit [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850784|gb|EES78742.1| riboflavin synthase alpha subunit [Ruminococcus sp. 5_1_39BFAA]
          Length = 215

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 61/204 (29%), Positives = 106/204 (51%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +   A      +        +K G S+A  GICLTV        ++
Sbjct: 1   MFTGIVEELGTVKKIKKGANSAVFTIRAEKILDDLKTGDSVAVNGICLTVTAC-----LE 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   + +    +G  +NLER++    R  GH+V+GH+DGT +I  +    
Sbjct: 56  DGFTADVMHETLNRSALIQLSLGQHVNLERAMPANGRFGGHIVAGHVDGTGKITEIRRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGSV ++G+SLTV  V +  F +  I HT++ T     K G
Sbjct: 116 NAVWYTIQASPQIMKYIVTKGSVTVDGISLTVAKVSETDFSISAIPHTVKITVLGERKEG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++N+E D + +Y+ +L      Q
Sbjct: 176 DIVNLETDIIGKYVEKLITPVKEQ 199


>gi|322370160|ref|ZP_08044722.1| riboflavin synthase subunit alpha [Haladaptatus paucihalophilus
           DX253]
 gi|320550496|gb|EFW92148.1| riboflavin synthase subunit alpha [Haladaptatus paucihalophilus
           DX253]
          Length = 197

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 106/202 (52%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I  +     G RL +      S +  G SIA  G CLTV         D
Sbjct: 1   MFTGIVAEVGEIRRVEETEGGRRLTIAADEVLSDVADGASIAVNGACLTVEEFD-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EV + AET   T +     G  +NLER+++   RLDGH V GH+D T E++ +  +G
Sbjct: 56  DSFEVFLAAETVAKTYLGEIEEGDVVNLERALRADARLDGHFVQGHVDTTTEVVDVREVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      ++P    Q+I  KGSV L+G+SLTV   G++ F V +I  T   T     + G
Sbjct: 116 EDWEYEFAVPEAFGQYIVDKGSVALDGISLTVAEKGEDTFTVAIIPTTRRVTNLSEKEPG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +++EVD + +Y   L A   
Sbjct: 176 DPVHLEVDVLAKYADELLAERR 197


>gi|23014660|ref|ZP_00054465.1| COG0307: Riboflavin synthase alpha chain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 197

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 80/202 (39%), Positives = 123/202 (60%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTP-IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIVTD+G +  +     +  R  + + Y+T+ + +G SIAH G+CLT++ +      
Sbjct: 1   MFTGIVTDLGVVRRIVRGEGREARFEIASRYDTATIAIGASIAHNGVCLTIIEVGP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +W+ VE  AET   T +  W  G+ +NLER++K+GD L GH+VSGH+DG  +++ +   
Sbjct: 57  -DWHAVEASAETLSKTTLGGWVEGSKVNLERALKVGDELGGHIVSGHVDGVAKVVDIRPE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +S+      P +L  F+A KGSV L+GVSLTVN V    F V +I HT   TT+  ++ 
Sbjct: 116 NESLRFTFETPADLACFVAPKGSVALDGVSLTVNEVDGRRFGVNIIPHTQSVTTFGTYRP 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ARL   +
Sbjct: 176 GHEVNMEIDMLARYVARLLQKD 197


>gi|148272142|ref|YP_001221703.1| riboflavin synthase subunit alpha [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830072|emb|CAN01001.1| ribC [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
          Length = 218

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/209 (33%), Positives = 114/209 (54%), Gaps = 12/209 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G+++A+       R+ V      S  + G SI+  G+CLTVV  +      
Sbjct: 1   MFTGIIEERGRVLALDAEGDSARITVEAPLAVSDARHGDSISVDGVCLTVVAQTP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  +T  ++++   G+G  +NLER+ ++GDRL GH+V GH+DGT  +L      
Sbjct: 56  DGFTADVMRQTLVMSSLGRLGVGDRVNLERAARVGDRLGGHIVQGHVDGTGRLLATTPGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-------FFDVLLIRHTIEETT 173
                R SLP  L   +  +GS+ + GVSLTV+ V          +F+V LI  T+  TT
Sbjct: 116 AWRILRFSLPAELSPLVVDRGSITVQGVSLTVSAVSPTDTADSDAWFEVSLIPETLTATT 175

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALNT 202
               ++GD +N+E D + R++ R+ AL+ 
Sbjct: 176 LGALELGDEVNLETDVLARHVQRMLALDA 204


>gi|163747440|ref|ZP_02154792.1| riboflavin synthase subunit alpha [Oceanibulbus indolifex HEL-45]
 gi|161379293|gb|EDQ03710.1| riboflavin synthase subunit alpha [Oceanibulbus indolifex HEL-45]
          Length = 195

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 97/201 (48%), Positives = 129/201 (64%), Gaps = 7/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G +  +      +R R+ T Y+T  + +G SIA  G+CLTVV L      D
Sbjct: 1   MFTGIITDVGTVTKLEQEGD-LRARIQTRYDTRGIDMGASIASDGVCLTVVGLG-----D 54

Query: 61  NWYEVEVWAETNRITNIA-SWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +WYEV++ AET   TN+   W  G  +NLER++K+GD L GH+VSGH+DG  EI+ +   
Sbjct: 55  DWYEVQISAETVGKTNLGQHWAEGRRVNLERALKVGDELGGHIVSGHVDGVAEIIEMKDE 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   KV
Sbjct: 115 GDSTRVTLRAPKDLARFIAPKGSVALNGTSLTVNDVDGCDFGINFIPHTKEVTTWGDAKV 174

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           GDL+N+E+D++ RY+ARL  +
Sbjct: 175 GDLVNLEIDTLARYVARLNEM 195


>gi|218289835|ref|ZP_03494035.1| riboflavin synthase, alpha subunit [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218240126|gb|EED07311.1| riboflavin synthase, alpha subunit [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 217

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 60/201 (29%), Positives = 101/201 (50%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V    ++ A++    G        +    +++G S+A  G+CLT      E    
Sbjct: 1   MFTGLVEGTARLAAVSRHTGGATFTFEAPFLMDDLRVGDSVAVNGVCLTA-----ETVGG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +      ET R TN+     G  +++ER+++   R  GH+V+GHIDG   +  +   G
Sbjct: 56  GLFTATAVPETLRRTNLGELQPGGRVHVERAMRADGRFGGHIVTGHIDGIGHVADVYPDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++    + +   L ++I  KGSV ++GVSLT+    K+ F V +I HT   T +   + G
Sbjct: 116 EARVLVIRVDPALARYIVDKGSVAVDGVSLTIMRAEKDRFSVSIIPHTQAVTRFGEIRSG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           + +NIE D + +Y+ RL A  
Sbjct: 176 ETVNIECDVIAKYVERLLAYR 196


>gi|51244951|ref|YP_064835.1| riboflavin synthase subunit alpha [Desulfotalea psychrophila LSv54]
 gi|50875988|emb|CAG35828.1| probable riboflavin synthase, alpha chain [Desulfotalea
           psychrophila LSv54]
          Length = 222

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 104/198 (52%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   GK++       G+   +   ++ S  + G SIA  G+CLT   +     V 
Sbjct: 4   MFTGIVQGKGKLLGKRKAGGGLSFDLEAGFDLSDPQEGESIAICGVCLTAYNI-----VG 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   T +     G  +N+ER++++ DRL GH+VSGH+D    +  L  +G
Sbjct: 59  RRFLADVSPETLSRTRLGRLNTGDAVNMERALQVTDRLGGHIVSGHVDCLASLSALKKVG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      S P     ++  KGSV ++GVSLT+N  G + F V +I  T+ ETT     VG
Sbjct: 119 NFTLLNFSFPTEYSHYMIEKGSVTIDGVSLTINDCGDDCFSVSIIPQTLRETTLGDLVVG 178

Query: 181 DLINIEVDSMMRYIARLY 198
             +NIEVD + +Y+ +L 
Sbjct: 179 SRVNIEVDIIGKYVEKLL 196


>gi|298207052|ref|YP_003715231.1| riboflavin synthase alpha chain [Croceibacter atlanticus HTCC2559]
 gi|83849686|gb|EAP87554.1| riboflavin synthase alpha chain [Croceibacter atlanticus HTCC2559]
          Length = 198

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/199 (37%), Positives = 110/199 (55%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++  +T     + + +    + S++K+  S+AH G+CLTVV ++     D
Sbjct: 1   MFTGIVEELGRVKDLTKDGDNLHIFIEAHMS-SELKIDQSVAHNGVCLTVVAVT-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   +N+ S  +   +NLER +KLG RLDGH+V GH+D   E +      
Sbjct: 55  NTYSVTAIQETLNKSNLGSLKVNDLVNLERGMKLGARLDGHIVQGHVDQVAECILAQEKD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R      L      KGS+ +NGVSLTV     N F V +I +T E TT+K  + G
Sbjct: 115 GSWEYRFKYDPALNNVTIEKGSITINGVSLTVVDSEINTFSVAIIPYTYEHTTFKQLQKG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D++N+E D + +Y+ RL  
Sbjct: 175 DVVNLEFDVIGKYVKRLLG 193


>gi|269839782|ref|YP_003324475.1| riboflavin synthase, subunit alpha [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791512|gb|ACZ43652.1| riboflavin synthase, alpha subunit [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 201

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV + G+++ +  + + +RLRV         +LG SIA  G+CLTV  L E     
Sbjct: 1   MFSGIVEETGRVLEL-HLKEPLRLRVACQRVLEGTQLGDSIAVNGVCLTVDALDE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V +  ET R TN+    +G  +NLERS++   R+ GH V GH+D T  IL     G
Sbjct: 55  GSFTVGLMPETLRRTNLGGLQLGDEVNLERSLRFDGRVGGHFVQGHVDATGTILDRCPDG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +++ ++ LP +L +++  KG + ++GVSLTV    K+ F V L+ HT ++ T    +VG
Sbjct: 115 GALWLKIGLPRDLARYVVPKGCIAVDGVSLTVVDALKDAFTVSLVYHTQQKVTLARKQVG 174

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           +L+N+EVD + +Y+ RL     S+
Sbjct: 175 ELVNLEVDMLGKYVERLLQHQWSE 198


>gi|319786234|ref|YP_004145709.1| riboflavin synthase, subunit alpha [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464746|gb|ADV26478.1| riboflavin synthase, alpha subunit [Pseudoxanthomonas suwonensis
           11-1]
          Length = 206

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/210 (35%), Positives = 117/210 (55%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT------SYNTSKMKLGCSIAHAGICLTVVRLS 54
           MFTGI+  +G++ A  P    +R    T           +++LG SIA  G+CLTV+  +
Sbjct: 1   MFTGIIEGVGRLAAREPRGGDVRFSFATGTLPWLDSGADEIRLGESIAVNGVCLTVIAFN 60

Query: 55  EEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
            +      ++ +   ET  +T +    +G  +NLER+++  DRL GH+VSGH+DG   +L
Sbjct: 61  AQ-----GFQADASTETLALTTLGELPVGAALNLERAMRPTDRLGGHMVSGHVDGIGRVL 115

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW 174
            +     +   R + P  L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T +
Sbjct: 116 SVHEDARAQRWRFAAPQQLLKYIAKKGSICVDGVSLTVNEVDGEGFEVALIPHTVAHTRF 175

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
              KVG+ +N+E+D + RY+ RL      Q
Sbjct: 176 AETKVGEAVNLEIDLVARYVERLLGERGGQ 205


>gi|258510932|ref|YP_003184366.1| riboflavin synthase, alpha subunit [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477658|gb|ACV57977.1| riboflavin synthase, alpha subunit [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 217

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 59/201 (29%), Positives = 101/201 (50%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V    ++ A++    G    +   +    +++G S+A  G+CLTV     E    
Sbjct: 1   MFTGLVEGTARLAAVSRHTGGATFTLEAPFLMDDLRVGDSVAVNGVCLTV-----ETVGG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +      ET R TN+     G   ++ER+++   R  GH+V+GHIDG   +  +   G
Sbjct: 56  GLFTATAVPETLRRTNLGGLQPGGRAHVERAMRADGRFGGHIVTGHIDGIGHVADVYPDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++    + +   L +++  KGSV ++GVSLT+    K+ F V +I HT   T +   + G
Sbjct: 116 EARVLVIRVDPALARYMVDKGSVAVDGVSLTIMRAEKDRFSVSIIPHTQAVTRFGEIRAG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           + +NIE D + +Y+ RL    
Sbjct: 176 ETVNIECDVIAKYVERLLTYR 196


>gi|284033020|ref|YP_003382951.1| riboflavin synthase subunit alpha [Kribbella flavida DSM 17836]
 gi|283812313|gb|ADB34152.1| riboflavin synthase, alpha subunit [Kribbella flavida DSM 17836]
          Length = 210

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 105/204 (51%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTP-IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G + ++        RL +     T+    G SIA  G CLTVV   E    
Sbjct: 1   MFTGIVEELGTVESLDLLDGDAARLTIRGPKVTADAGHGDSIAVNGCCLTVVETGE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET + T++     G  +NLER+V    RL GH+V GH+DG   I+  +  
Sbjct: 57  -GTFTADVMRETLQRTSLGGVAQGGAVNLERAVTAHARLGGHIVQGHVDGVGTIVSREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK--NFFDVLLIRHTIEETTWKMH 177
                 R+S    L +++A KGS+ ++GVSLTV  V      F + LI  T+E T    +
Sbjct: 116 EHWEVVRISAAPELLRYVAEKGSIAVDGVSLTVTDVDDATGTFGISLIPTTLELTVLGRN 175

Query: 178 KVGDLINIEVDSMMRYIARLYALN 201
           ++GD +N+EVD + +Y+ RL    
Sbjct: 176 RIGDTVNLEVDVIAKYVERLLTAQ 199


>gi|83589767|ref|YP_429776.1| riboflavin synthase subunit alpha [Moorella thermoacetica ATCC
           39073]
 gi|83572681|gb|ABC19233.1| riboflavin synthase, alpha subunit [Moorella thermoacetica ATCC
           39073]
          Length = 217

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 86/204 (42%), Positives = 116/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG I  +  + +G RL +      +  + G SIA  G CLTVV +  E  V 
Sbjct: 1   MFTGLIEEIGSIRRIVTVPQGARLTISAREVLAGTRRGDSIAVNGACLTVVDVEPEALVA 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                EV AET R+T + S  +G  +NLER+++LG+RL GHLVSGHIDG  EI     +G
Sbjct: 61  -----EVMAETLRVTTLGSLKVGDRVNLERALRLGERLGGHLVSGHIDGVGEIKSRRQVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    L++P  LE++IA KGS+ L+G SLTV  V  N   V LI HT   T       G
Sbjct: 116 IAWELTLAVPVGLERYIAPKGSLALDGTSLTVITVTGNQVTVGLIPHTARNTILGDKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIEVD + RY+ RL      +
Sbjct: 176 DRVNIEVDLLARYLERLLNPPVEE 199


>gi|257067229|ref|YP_003153484.1| riboflavin synthase, alpha subunit [Brachybacterium faecium DSM
           4810]
 gi|256558047|gb|ACU83894.1| riboflavin synthase, alpha subunit [Brachybacterium faecium DSM
           4810]
          Length = 204

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/199 (34%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G + ++T  A   RLR+ +      + LG SIA +G CLTV          
Sbjct: 1   MFTGIIEELGTVESLTLGADPARLRIRSPQVLEGIALGDSIAVSGCCLTVTA-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V + T   T++     G  +NLER V+   RLDGH+V GH+DG   +   +   
Sbjct: 56  GSWTADVISTTLAATSLGDLAAGDRVNLERCVRADGRLDGHIVQGHVDGVGTVTGREEAD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   RL+LP  L +++  KGS+ ++GVSLTV  +      + LI  T+  TT  +  VG
Sbjct: 116 GTTLLRLALPAGLSRYVVAKGSLAVDGVSLTVAAIDGEEVTLGLIPETLSRTTLGVRAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ +L A
Sbjct: 176 DRVNLEVDVLAKYVEKLTA 194


>gi|119963571|ref|YP_947579.1| riboflavin synthase subunit alpha [Arthrobacter aurescens TC1]
 gi|119950430|gb|ABM09341.1| riboflavin synthase, alpha subunit [Arthrobacter aurescens TC1]
          Length = 209

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 111/210 (52%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV + G ++++         LR+        + LG SIA  G+CLT  ++  +   
Sbjct: 1   MFTGIVAEQGTVLSIEHEGDASATLRLKAPTTAEGLPLGGSIAVNGVCLTATQIDGQD-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T I     G  +NLER V  G RLDGH+V GH+DG  E+L  + +
Sbjct: 59  ---FSVDVMGETLVRTTIGELTPGDAVNLERCVPAGGRLDGHVVQGHVDGVGELLEREPL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTW 174
           G+    R  +P  L ++IA KGS+ ++GVSLTV  V        +F+V LI  T+EET  
Sbjct: 116 GNWDRLRFGVPAPLARYIAEKGSIAVDGVSLTVTAVSPAAETAPWFEVGLIPTTLEETGL 175

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
               VG  +N+EVD + +Y  RL +    Q
Sbjct: 176 GAKAVGGRVNLEVDVLAKYTERLLSFAPQQ 205


>gi|332977387|gb|EGK14165.1| riboflavin synthase subunit alpha [Desmospora sp. 8437]
          Length = 213

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 71/196 (36%), Positives = 113/196 (57%), Gaps = 5/196 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+I +M      MRL +        +++G SIA  G+CLTVV         
Sbjct: 1   MFTGLVEEVGRIGSMDREGDAMRLSISCEQVLEGVQVGESIAVNGVCLTVVGFDS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +N+    +G+ +NLER++++GDRL GH V GH+DG   IL      
Sbjct: 56  DQFWTDVMPETMNRSNLGQLTLGSPVNLERALRVGDRLGGHFVQGHVDGMGRILARTPRE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+ +P  L +++  +GSV +NG+SLT+  V    F V +I HT+E T  K  + G
Sbjct: 116 NAVLFRIGVPPELTRWMVDQGSVAVNGISLTIVTVEPEAFTVSIIPHTLEHTQLKEAEPG 175

Query: 181 DLINIEVDSMMRYIAR 196
           D +NIE D + +Y A+
Sbjct: 176 DSVNIECDMIGKYAAK 191


>gi|254476472|ref|ZP_05089858.1| riboflavin synthase, alpha subunit [Ruegeria sp. R11]
 gi|214030715|gb|EEB71550.1| riboflavin synthase, alpha subunit [Ruegeria sp. R11]
          Length = 195

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 97/199 (48%), Positives = 131/199 (65%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ TSY+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGTIAELEQQGD-LRARIKTSYDTAGIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+ SW +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVQISAETVSKTNLDSWVVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVNIADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   K+G
Sbjct: 115 DSTRVTLRAPAALAKFIAPKGSVALNGTSLTVNDVEGADFGINFIPHTKEVTTWGDVKLG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E+D++ RY+ARL+ 
Sbjct: 175 DAVNLEIDTLARYVARLHE 193


>gi|331270608|ref|YP_004397100.1| riboflavin synthase subunit alpha [Clostridium botulinum BKT015925]
 gi|329127158|gb|AEB77103.1| riboflavin synthase, alpha subunit [Clostridium botulinum
           BKT015925]
          Length = 216

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  +T      R+ +        + LG SI+  G+CLTV   S      
Sbjct: 1   MFTGIVEEIGTINTITSTKDAARITIDAKKILKDVSLGDSISTNGVCLTVTEYSR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +N+ S   G  +NLER++ LG R  GH+VSGHIDG   I       
Sbjct: 56  NNFTVDVMGETIRRSNLDSLKRGDKVNLERALALGGRFGGHIVSGHIDGVGTIKNFQHEA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + + I  KGS+ ++GVSLTV  +    F V +I HT  ETT    K G
Sbjct: 116 NAIWITIEASEEILKNIVFKGSIAIDGVSLTVADIDNEIFKVCIIPHTQSETTLTSKKSG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L  +  ++
Sbjct: 176 DKVNLECDVIAKYVEKLLQVKNNE 199


>gi|296532917|ref|ZP_06895578.1| riboflavin synthase subunit alpha [Roseomonas cervicalis ATCC
           49957]
 gi|296266747|gb|EFH12711.1| riboflavin synthase subunit alpha [Roseomonas cervicalis ATCC
           49957]
          Length = 207

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 90/200 (45%), Positives = 123/200 (61%), Gaps = 8/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIA--KGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGI+T  G++  + P+   + MRL + T     +  ++G SIA +G CLTVV L E  
Sbjct: 1   MFTGIITAQGEVAEIAPLGAGQDMRLVLATPQGWLAGAEIGASIACSGCCLTVVALEE-- 58

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
              + + VEV AET   T +A W  GT +NLER++K+GD + GH+VSGH+DG  E+L + 
Sbjct: 59  ---SRFAVEVSAETLSKTTLARWRPGTVLNLERALKMGDEMGGHVVSGHVDGLGEVLSVA 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S+  ++ LP  L +F+A KGSV + GVSLTVN V    F V LI HT E TT    
Sbjct: 116 PENGSLRIQVRLPPELARFVAPKGSVTMEGVSLTVNEVQGLIFGVNLIPHTAEVTTLGRL 175

Query: 178 KVGDLINIEVDSMMRYIARL 197
             GD +NIE+D + RY+ARL
Sbjct: 176 AAGDAVNIEIDMLARYVARL 195


>gi|311739499|ref|ZP_07713334.1| riboflavin synthase subunit alpha [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311305315|gb|EFQ81383.1| riboflavin synthase subunit alpha [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 206

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/202 (32%), Positives = 108/202 (53%), Gaps = 5/202 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTG+V ++G + AM P A  +RL +      ++  LG SIA  G+CLTV  LS      +
Sbjct: 4   FTGLVQELGTVEAMEPHADALRLSIRAPRTVAEAALGDSIAINGVCLTVADLS-----AD 58

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V  E+   T +     G  +N+E ++    RL GH++ GH+DGT  +       +
Sbjct: 59  TFCADVMQESLDRTALGRLAEGDPVNVEPALLPTTRLGGHIMQGHVDGTATLQSRTNSEN 118

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
               R SLP  L +++  KGS+ ++G SLTV+ VG ++F+V LI  T+ +T      VG 
Sbjct: 119 WDVLRFSLPSELSRYVVEKGSIAVSGTSLTVSAVGPDWFEVSLIPTTLRDTIHGALPVGG 178

Query: 182 LINIEVDSMMRYIARLYALNTS 203
            +N+EVD + +Y+ ++      
Sbjct: 179 EVNLEVDVLAKYVEKMLHPEAQ 200


>gi|297529536|ref|YP_003670811.1| riboflavin synthase, subunit alpha [Geobacillus sp. C56-T3]
 gi|297252788|gb|ADI26234.1| riboflavin synthase, alpha subunit [Geobacillus sp. C56-T3]
          Length = 214

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  M      + + +        ++LG SIA  G+CLTV   +E     
Sbjct: 1   MFTGIIEEIGTIEQMKQTGDAIVMTIGAKRVLEDVRLGDSIAVNGVCLTVTSFTERQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + ++V  ET + T + +   G+ +NLER++  G R  GH V+GH+DG   I+      
Sbjct: 58  --FTIDVMPETVKATALKTLKPGSKVNLERAMAAGGRFGGHFVTGHVDGVGRIIRQWPKA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P +L  ++  KGSV ++G SLT+  + +  F V LI HT E T     + G
Sbjct: 116 NAVYYEIEVPASLRAYMIEKGSVAVDGTSLTIFGLSERTFIVSLIPHTREATILGEKRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+NIE D + +Y+A       +
Sbjct: 176 DLVNIECDMIGKYVAAFLNAKAT 198


>gi|149202383|ref|ZP_01879356.1| riboflavin synthase subunit alpha [Roseovarius sp. TM1035]
 gi|149144481|gb|EDM32512.1| riboflavin synthase subunit alpha [Roseovarius sp. TM1035]
          Length = 195

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+      +R R+ T Y+T ++ +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGRIEAVEHRGD-LRARIGTGYDTGRIDIGASIACDGVCLTVVALG-----A 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V++ AET   TN++ W  G  +NLER++++GD L GH+VSGHIDG  E++ L   G
Sbjct: 55  GWFDVDISAETLSKTNLSGWAEGRRVNLERALRVGDELGGHIVSGHIDGLAEVVGLRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    +G
Sbjct: 115 DSTRVTLRAPQALARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKSVTTWGDVAMG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D++N+E+D++ RY+ARL
Sbjct: 175 DMVNLEIDTLARYVARL 191


>gi|124358782|dbj|BAF46060.1| riboflavin synthase [Bartonella chomelii]
          Length = 205

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 101/201 (50%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +  + +G+RL + T Y+   +++G SIA +GICLTV+    + +  
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGIRLSISTHYDVETIEIGASIACSGICLTVIEHELKQANV 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + VE W E   +TNIA W  GTF+NLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  NCFVVEAWKEALCLTNIAQWTKGTFVNLERSLRLGDEIGGHLVSGHVDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L     L  FIA KGS+ LNG SLTVN +  N FDVL+IRHT+E TTW   KVG
Sbjct: 121 DAIRFYLKASMRLAPFIAEKGSIALNGTSLTVNCIENNIFDVLIIRHTLEMTTWGQAKVG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+EVD + RY+ARL    
Sbjct: 181 DQVNLEVDQLARYVARLSNFK 201


>gi|320449998|ref|YP_004202094.1| riboflavin synthase subunit alpha [Thermus scotoductus SA-01]
 gi|320150167|gb|ADW21545.1| riboflavin synthase, subunit alpha [Thermus scotoductus SA-01]
          Length = 194

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 80/198 (40%), Positives = 117/198 (59%), Gaps = 7/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G+I+ +      +R+R+      S +++G S+A  G+CLT V + E     
Sbjct: 1   MFTGLVEETGEIVEV-REGPFLRVRIAAKEVLSDLRVGDSVAVDGVCLTAVEVDE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG  E++ +    
Sbjct: 55  GGFWVELARETLRRTAP-TWRVGHRPNLERALKVGDRLGGHFVTGHVDGVAEVVAIREAP 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +      LP +L ++IA KGSV LNGVSLTV  +    F V LI HT++ T     KVG
Sbjct: 114 GAKDYFFRLPQDLARYIAEKGSVALNGVSLTVAGLKGQDFFVTLIPHTLKVTNLGSLKVG 173

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+EVD + RY+ RL 
Sbjct: 174 DGVNLEVDLIARYLERLV 191


>gi|71909704|ref|YP_287291.1| riboflavin synthase subunit alpha [Dechloromonas aromatica RCB]
 gi|71849325|gb|AAZ48821.1| Lumazine-binding protein [Dechloromonas aromatica RCB]
          Length = 197

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 111/204 (54%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GI+  +G+II +TP   G RL V         + LG SIAH G+CLTVV        
Sbjct: 1   MFSGIIAAVGRIIEITPREVGCRLHVDAGKLKLDDVALGDSIAHNGVCLTVVA-----RE 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N + V+V  ET   T          +NLE++++L D + GHLVSGH+DG  E+L  D I
Sbjct: 56  GNTFAVDVSPETLSCTVG--LAEPGPVNLEKALRLSDVIGGHLVSGHVDGVGEVLRFDAI 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD+    +  P  + ++IA KGS+ ++G SLT N V    F + LI HT+E TT    K 
Sbjct: 114 GDNRLLEIRAPKEIAKYIARKGSIVIDGTSLTTNAVNGTDFTINLIPHTLENTTLNRLKP 173

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY  RL      
Sbjct: 174 GSKVNLEVDLIARYCERLLTAERE 197


>gi|21230170|ref|NP_636087.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769840|ref|YP_244602.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21111705|gb|AAM40011.1| riboflavin synthase alpha chain [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575172|gb|AAY50582.1| riboflavin synthase alpha chain [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 200

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/202 (36%), Positives = 112/202 (55%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T S     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLAARQPQGGDVRFTFATGSLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + S   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGSLQEGAVLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V    F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPQVLRYVAKKGSICVDGVSLTVNEVDDAGFEVALIPHTVANTAFSETAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|116511815|ref|YP_809031.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116107469|gb|ABJ72609.1| Riboflavin synthase alpha chain [Lactococcus lactis subsp. cremoris
           SK11]
          Length = 215

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 117/203 (57%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++  +    K  +L +  S     +KLG SI+  G+CLTV   + +    
Sbjct: 1   MFTGIIEEVGEVTQIQKRDKSSKLSIRASSILEDLKLGDSISTNGLCLTVSAFNHKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ + +N+    +G+ +NLER+V L  R  GH+VSGHIDGT +IL +    
Sbjct: 58  --FTGDVMPESFKRSNLGELTVGSKVNLERAVALNGRFGGHIVSGHIDGTGKILSIKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    +L +++  KGS+ ++G+SLTV  V    F V +I HTI+ET     KVG
Sbjct: 116 NAVWFEVQTTVDLMKYVVEKGSITIDGISLTVAHVTSKSFSVSIIPHTIKETILSAKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +YI +L     S
Sbjct: 176 DKVNLENDILGKYIEKLLTGKDS 198


>gi|114315844|gb|ABI61904.1| riboflavin synthase alpha chain [Granulibacter bethesdensis
           CGDNIH1]
          Length = 282

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 85/200 (42%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIVT +G +  ++P+  G  MRL + T     +    G SIA +G CLTVV      
Sbjct: 76  MFTGIVTGLGSVATISPLEGGSDMRLTITTPEGFLTGAVTGASIACSGCCLTVVEF---- 131

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
           + D  +  EV AET   T + SW   + INLER++K+GD L GH+VSGH+DG  E++F+ 
Sbjct: 132 AGDTAFVAEVSAETLSKTTLGSWHQNSMINLERALKIGDELGGHIVSGHVDGVAEVIFVL 191

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S   R   P +L ++IA KGS+ ++GVSLTVN V  + F V +I HT   TT    
Sbjct: 192 PEHGSTRMRFRAPSHLARYIAQKGSIAVDGVSLTVNEVENDVFGVNVIPHTCSVTTIGTL 251

Query: 178 KVGDLINIEVDSMMRYIARL 197
             G  +NIE+D + RY+ RL
Sbjct: 252 VAGSRVNIEIDMLARYVDRL 271


>gi|312797041|ref|YP_004029963.1| riboflavin synthase alpha chain [Burkholderia rhizoxinica HKI 454]
 gi|312168816|emb|CBW75819.1| Riboflavin synthase alpha chain (EC 2.5.1.9) [Burkholderia
           rhizoxinica HKI 454]
          Length = 211

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 82/212 (38%), Positives = 123/212 (58%), Gaps = 16/212 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G RL +  S  N S + LG SIA  G CLTVV  + 
Sbjct: 1   MFTGIVAAVGRIESVTPLGASVEDGARLSIAASTLNLSDVGLGDSIAVQGACLTVVDKTS 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  +EV+V  ET   T          +NLE++++  +RL GHLVSGH+DG  ++  
Sbjct: 61  TQ-----FEVDVSRETLNCTTG--LAQPGEVNLEKALRAHERLGGHLVSGHVDGLGQVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
            + +G+S   R+  P +L ++ A KGS+ +NGVSLTVN V        F + +I HTI+ 
Sbjct: 114 FEPVGESHELRIVAPSSLAKYFAYKGSITVNGVSLTVNAVQDQDDGCEFSINVIPHTIQM 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
           TT +  +VGD +N+EVD + RY+ R+ + + +
Sbjct: 174 TTLRHLRVGDAVNLEVDMIARYVERMLSTSQN 205


>gi|190572775|ref|YP_001970620.1| riboflavin synthase subunit alpha [Stenotrophomonas maltophilia
           K279a]
 gi|190010697|emb|CAQ44306.1| putative riboflavin synthase alpha chain [Stenotrophomonas
           maltophilia K279a]
          Length = 208

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+++A  PI   +R      +     +++G SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLVAREPIGGDVRFTFNVGNLPFDNVQMGESIAINGVCLTVIAFD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N ++ +   ET  +T +   G G  INLER+++  DRL GHLVSGH+DG  ++L +   
Sbjct: 56  TNSFQADASTETLGLTTLGQLGEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVLSIHED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R   P  L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFGAPAALRRYIAKKGSICVDGVSLTVNEVDDEGFEVALIPHTVANTAFSASGV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+E+D + RY+ RL ++ T+
Sbjct: 176 GSAVNLEIDLVARYVERLISVPTN 199


>gi|257153179|dbj|BAI23144.1| riboflavin synthase [Bartonella washoensis]
 gi|257153181|dbj|BAI23145.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVENVQSLNQGVHLNISTCYDIESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W E  R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFAVEAWEEALRLTNLTQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIVDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLT+N V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTINSVEDRIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|146308870|ref|YP_001189335.1| riboflavin synthase subunit alpha [Pseudomonas mendocina ymp]
 gi|145577071|gb|ABP86603.1| riboflavin synthase, alpha subunit [Pseudomonas mendocina ymp]
          Length = 220

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +R+ V T   +   +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAIGSIRAMTPKGGDVRVYVATGKLDLGDVKLGDSIAVNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLARTAFVDLKPGSAVNLEKALTPTSRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  R+  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFRVRAPRELAKYIAHKGSITVDGTSLTVNAVDGAEFELTIVPHTLAETIMVDYQA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|290968503|ref|ZP_06560042.1| riboflavin synthase, alpha subunit [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781499|gb|EFD94088.1| riboflavin synthase, alpha subunit [Megasphaera genomosp. type_1
           str. 28L]
          Length = 216

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 83/202 (41%), Positives = 114/202 (56%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + GKI +    +  + L +      +  +LG SIA  G+CLTV  L+      
Sbjct: 1   MFTGIIEETGKIQSFKRRSDSIALTIQACKVLTDTQLGDSIAVNGVCLTVTSLT-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET R +++ + G G  +NLER+V +G RL GHLVSGHIDGT  I+ +   G
Sbjct: 56  DTFTADVMHETMRRSSLQTIGSGDTVNLERAVAVGGRLGGHLVSGHIDGTGHIMRIQPDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +S   NL  FI  KGSV L+GVSLTV  VG  +F V LI HT+  TT    K G
Sbjct: 116 IANIFTISAAANLVHFIVEKGSVALDGVSLTVTAVGDRWFSVSLIPHTLAHTTLLSKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
            ++NIE D + +YI RL     
Sbjct: 176 AVLNIETDIIGKYIDRLMHEKK 197


>gi|196248757|ref|ZP_03147457.1| riboflavin synthase, alpha subunit [Geobacillus sp. G11MC16]
 gi|196211633|gb|EDY06392.1| riboflavin synthase, alpha subunit [Geobacillus sp. G11MC16]
          Length = 214

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 107/203 (52%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  M      + + +        ++LG SIA  G+CLTV   +     D
Sbjct: 1   MFTGIIEEIGTVEQMRQTGSAIVMTIGAKRVLEDVQLGDSIAVNGVCLTVTSFT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T + +   GT +NLER+++ G R  GH V+GH+DG   I+      
Sbjct: 56  RQFTVDVMPETVKATALRTLKPGTKVNLERAMEAGGRFGGHFVTGHVDGVGRIVRQWPKA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P  L  ++  KGSV ++G SLT+  + +  F V LI HT   T     + G
Sbjct: 116 NAVYYEIEVPAPLRSYMIEKGSVAVDGTSLTIFGLSERTFTVSLIPHTRAATILGEKRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + +Y+A   A   +
Sbjct: 176 DFVNIECDMIGKYVAAFLAGKET 198


>gi|238063935|ref|ZP_04608644.1| riboflavin synthase, alpha subunit [Micromonospora sp. ATCC 39149]
 gi|237885746|gb|EEP74574.1| riboflavin synthase, alpha subunit [Micromonospora sp. ATCC 39149]
          Length = 227

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 108/197 (54%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLR-VMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV ++G+++ M        L  +     TS  + G SIA  G+CLTVV +      
Sbjct: 1   MFTGIVEELGEVVRMAETGGDYALVAIRGPLVTSDARHGDSIAVNGVCLTVVDVD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET R + + +   G  +NLER+  L  RL GHLV GH+DG  E+L  +  
Sbjct: 56  GDVFTADVMGETLRRSALGALRPGAPVNLERAAALNSRLGGHLVQGHVDGVGEVLSREPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                 R  LP  L +++  KGS+ ++GVSLTV  VG ++F V LI  T++ TT      
Sbjct: 116 EQWETVRFRLPAALSRYVVEKGSITVDGVSLTVAGVGPDWFTVGLIPTTLKLTTLGDRVA 175

Query: 180 GDLINIEVDSMMRYIAR 196
           GD +N+EVD + +Y+ R
Sbjct: 176 GDPVNLEVDVLAKYVER 192


>gi|153811506|ref|ZP_01964174.1| hypothetical protein RUMOBE_01898 [Ruminococcus obeum ATCC 29174]
 gi|153814755|ref|ZP_01967423.1| hypothetical protein RUMTOR_00970 [Ruminococcus torques ATCC 27756]
 gi|317501333|ref|ZP_07959536.1| riboflavin synthase subunit alpha [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331088369|ref|ZP_08337288.1| riboflavin synthase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847786|gb|EDK24704.1| hypothetical protein RUMTOR_00970 [Ruminococcus torques ATCC 27756]
 gi|149832247|gb|EDM87332.1| hypothetical protein RUMOBE_01898 [Ruminococcus obeum ATCC 29174]
 gi|291545681|emb|CBL18789.1| riboflavin synthase, alpha subunit [Ruminococcus sp. SR1/5]
 gi|295108674|emb|CBL22627.1| riboflavin synthase, alpha subunit [Ruminococcus obeum A2-162]
 gi|316897297|gb|EFV19365.1| riboflavin synthase subunit alpha [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330408613|gb|EGG88079.1| riboflavin synthase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 217

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK+  +    +   L V         ++G SIA  G+CLTV  +       
Sbjct: 1   MFTGIVEEKGKVRYIQLTGESGILAVKARKVLEGTRIGDSIAVNGVCLTVTSIQP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET R +++ S   G+ +NLER++    R  GH+VSGHIDGT  I  +    
Sbjct: 56  DGFTADVMAETIRRSSLGSCKAGSQVNLERAMAADGRFGGHIVSGHIDGTGVIRSMLREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     +   I  KGSVC++G+SLTV  V +  F V +I HT EETT      G
Sbjct: 116 NAIWVSIETSPQILHLIVEKGSVCIDGISLTVARVDEAGFQVSVIPHTGEETTLLEKVPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N+E D + +Y+ +L  +  ++
Sbjct: 176 DLVNLENDVIGKYVEKLLGIRKNE 199


>gi|138895865|ref|YP_001126318.1| riboflavin synthase subunit alpha [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267378|gb|ABO67573.1| Riboflavin synthase alpha subunit [Geobacillus thermodenitrificans
           NG80-2]
          Length = 214

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 67/203 (33%), Positives = 106/203 (52%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  M      + + +        ++LG SIA  G+CLTV   +     D
Sbjct: 1   MFTGIIEEIGTVEQMRQTGSAIVMTIGAKRVLEDVQLGDSIAVNGVCLTVTSFT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T + +   GT +NLER++  G R  GH V+GH+DG   I+      
Sbjct: 56  RQFTVDVMPETVKATALRTLKPGTKVNLERAMAAGGRFGGHFVTGHVDGVGRIVRQWPKA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P  L  ++  KGSV ++G SLT+  + +  F V LI HT   T     + G
Sbjct: 116 NAVYYEIEVPAPLRSYMIEKGSVAVDGTSLTIFGLSERTFTVSLIPHTRAATILGEKRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + +Y+A   A   +
Sbjct: 176 DFVNIECDMIGKYVAAFLAGKET 198


>gi|119384297|ref|YP_915353.1| riboflavin synthase subunit alpha [Paracoccus denitrificans PD1222]
 gi|119374064|gb|ABL69657.1| riboflavin synthase, alpha subunit [Paracoccus denitrificans
           PD1222]
          Length = 197

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/199 (45%), Positives = 121/199 (60%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG++  +      MR R+   Y  + + LG SIA  GICLTVV         
Sbjct: 1   MFTGIITDIGEVSRVEMRGD-MRARISCHYEMAGVDLGASIACDGICLTVVEKGS----- 54

Query: 61  NWYEVEVWAETNRITNIA--SWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +W++V++ AET   TNI    W  G  +NLER++++GD L GH+VSGH+DG   I  +  
Sbjct: 55  DWFDVDISAETISKTNIGANGWAPGRRLNLERALRVGDELGGHIVSGHVDGVAVIEEMRD 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P  L +FIA KGSV LNG SLTVN V  + F V +I HT   TTW   +
Sbjct: 115 EGDSTRITLRAPEALARFIAPKGSVALNGTSLTVNEVEGDRFGVNVIPHTQAATTWGEVQ 174

Query: 179 VGDLINIEVDSMMRYIARL 197
            GD +N+E+D++ RY+ARL
Sbjct: 175 AGDEVNLEIDTLARYVARL 193


>gi|291613123|ref|YP_003523280.1| riboflavin synthase, subunit alpha [Sideroxydans lithotrophicus
           ES-1]
 gi|291583235|gb|ADE10893.1| riboflavin synthase, alpha subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 198

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 86/203 (42%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV D+G I        G+RL V+T       ++LG SIA  G+CLTVV++      
Sbjct: 1   MFSGIVADVGLIRTAQDREGGLRLTVITETLGMDDVQLGDSIAVNGVCLTVVKID----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N + V+V  ET   T I     G  +NLE++++L DRL GHLVSGH+DG  E++  + I
Sbjct: 56  GNDFTVDVSRETLNCT-IGLERQGGHVNLEKALRLSDRLGGHLVSGHVDGVGEVVAFNDI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  L ++IAVKGS+ +NGVSLTVN V  + F+V LI HT+E TT    +V
Sbjct: 115 GESWRLVVRAPQQLAKYIAVKGSITINGVSLTVNQVSGSEFEVNLIPHTLEVTTLNELQV 174

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           G  +N+E+D + RY+ R+   + 
Sbjct: 175 GTKVNLEIDLIARYVERMLTADA 197


>gi|326388320|ref|ZP_08209916.1| riboflavin synthase subunit alpha [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207052|gb|EGD57873.1| riboflavin synthase subunit alpha [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 211

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 117/210 (55%), Gaps = 9/210 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLS---EEH 57
           MFTGIV ++GK++A+T      R+ + T      + +G SIA +G+CLTVV         
Sbjct: 1   MFTGIVVEVGKVLAVTDRGD-RRITISTDRRQDTIAIGASIACSGVCLTVVEKGTGFGGE 59

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
               W+ V+V AET   T  A W  G  INLE ++K+GD L GH+V+GH+DG   +  + 
Sbjct: 60  PGIGWFAVDVSAETISRTCPAQWLEGAEINLEPALKVGDELGGHIVTGHVDGVGAVAAIT 119

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHTIEET 172
             G S       P +L  +IA KGS+ +NGVSLTVN +         F + +I HT E T
Sbjct: 120 PEGASRRIDFFAPADLAPYIASKGSIAINGVSLTVNGITDEADGRARFGINIIPHTAEVT 179

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           T    KVGD +N+E+D + RY+ R+ +L  
Sbjct: 180 TLGALKVGDPVNLEIDVLARYLKRMQSLEQ 209


>gi|56420831|ref|YP_148149.1| riboflavin synthase subunit alpha [Geobacillus kaustophilus HTA426]
 gi|56380673|dbj|BAD76581.1| riboflavin synthasealpha subunit [Geobacillus kaustophilus HTA426]
          Length = 214

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 107/203 (52%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  M      + + +        ++LG SIA  G+CLTV   +E     
Sbjct: 1   MFTGIIEEIGTIEQMKQTGDAIVMTIGAKRVLEDVRLGDSIAVNGVCLTVTSFTERQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T + +   G  +NLER++  G R  GH V+GH+DG   I+      
Sbjct: 58  --FTVDVMPETVKATALKTLKPGAKVNLERAMAAGGRFGGHFVTGHVDGVGRIIRQWPKA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P +L  ++  KGSV ++G SLT+  + +  F V LI HT E T     + G
Sbjct: 116 NAVYYEIEVPASLRAYMIEKGSVAVDGTSLTIFGLSERTFIVSLIPHTREATILGEKRPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+NIE D + +Y+A       +
Sbjct: 176 DLVNIECDMIGKYVAAFLTAKAT 198


>gi|189424809|ref|YP_001951986.1| riboflavin synthase, subunit alpha [Geobacter lovleyi SZ]
 gi|189421068|gb|ACD95466.1| riboflavin synthase, alpha subunit [Geobacter lovleyi SZ]
          Length = 213

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/199 (37%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G+++A+    +   L V      S++ +G SIA  G CLTVV +       
Sbjct: 1   MFTGLIECTGRVVALRRGGERAVLEVSAPLPVSEVCIGDSIAVNGACLTVVAM-----QG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   T  A+   G+ +NLER+++LG RLDGHLV+GHID    +      G
Sbjct: 56  DRFSFDVSPETVTRTTFATLQPGSPVNLERALRLGGRLDGHLVTGHIDCVGRLESRTNQG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++    SLP    + +  KGSV ++G+SLTVN V  + F V +I HT+E+TT      G
Sbjct: 116 NAVVLEFSLPREQARMLVEKGSVAIDGISLTVNGVTDSGFSVSIIPHTLEKTTLAAVGPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +NIE D + +Y+ARL  
Sbjct: 176 KQVNIETDVIGKYVARLVG 194


>gi|33152275|ref|NP_873628.1| riboflavin synthase subunit alpha [Haemophilus ducreyi 35000HP]
 gi|33148498|gb|AAP96017.1| riboflavin synthase, alpha chain [Haemophilus ducreyi 35000HP]
          Length = 215

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/203 (33%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GK+  +        L +        + LG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEVGKVANIKQSGDFAVLTINACKVLKDVHLGDSIAVNGVCLTVTSFNSTQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET R T++A   + + +NLER++ +  R  GH+VSGHIDGT EI+ +    
Sbjct: 58  --FTADVMAETLRRTSLAQLHVASPVNLERAMPMNGRFGGHIVSGHIDGTGEIIQITPAN 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S + R+     L ++I  KGS+ ++G+SLTV    +  F V +I HTI +T      +G
Sbjct: 116 HSTWYRVKTSPKLMRYIVEKGSITIDGISLTVVDTDQESFRVSIIPHTINQTNLATKTIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +YI R     T+
Sbjct: 176 SIVNLENDIVGKYIERFVMKRTN 198


>gi|126463177|ref|YP_001044291.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104841|gb|ABN77519.1| riboflavin synthase, alpha subunit [Rhodobacter sphaeroides ATCC
           17029]
          Length = 198

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 88/200 (44%), Positives = 120/200 (60%), Gaps = 3/200 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV+DIG+++ +      +R R+ T+Y+   + +G SIA  G+CLTVV    E S  
Sbjct: 1   MFTGIVSDIGRVLELERTGD-LRARIATAYDVEAIDIGASIACDGVCLTVVATGTEPSA- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V +  ET   T I  W  G  +NLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 59  -WFDVNISGETLSKTVIGDWEPGRRVNLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSLRVTFRAPEALARFIAPKGSVALNGTSLTVNEVDGAEFGINFIPHTQEVTTWSGIAPG 177

Query: 181 DLINIEVDSMMRYIARLYAL 200
             +N+E+D++ RY+ARL   
Sbjct: 178 LRVNLEIDTLARYVARLNEF 197


>gi|134098692|ref|YP_001104353.1| riboflavin synthase subunit alpha [Saccharopolyspora erythraea NRRL
           2338]
 gi|133911315|emb|CAM01428.1| riboflavin synthase alpha chain [Saccharopolyspora erythraea NRRL
           2338]
          Length = 216

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 82/201 (40%), Positives = 117/201 (58%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A  P+A G RL V     TS    G SIA  G+CLTVV +     ++
Sbjct: 1   MFTGIVEELGTVTAAEPLADGSRLTVAGPVVTSDAGHGDSIAVNGVCLTVVDV-----LE 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET R +++   G+G  +NLER++ LGDRL GH+V GH+DGT  +   +  G
Sbjct: 56  GAFTVDVVAETLRRSSLKHVGVGDRVNLERAMALGDRLGGHIVQGHVDGTAVLRSAEADG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +    LP  L +++  KGS+ ++GVSLTV   G+  F V LI  T E TT      G
Sbjct: 116 LTRF---DLPARLSRYVVEKGSITVDGVSLTVVEAGEESFSVALIPTTKELTTLGFRAPG 172

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD + +++ RL    
Sbjct: 173 DEVNIEVDVLAKHVERLAQAQ 193


>gi|144897825|emb|CAM74689.1| riboflavin synthase, alpha subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 197

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 86/199 (43%), Positives = 120/199 (60%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPI-AKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIVTD+G I  +     K  R  + T+Y+ + + +G SIAH G+CLT+V        
Sbjct: 1   MFTGIVTDLGAIRRVVRNAGKETRFEINTAYDLNGIDIGASIAHNGVCLTIVDKG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +WY VEV AE+   T +  W  G  INLER++K+GD L GH+VSGH+DG   ++ +   
Sbjct: 56  ADWYAVEVSAESISKTTLGDWVEGGRINLERAMKVGDELGGHIVSGHVDGVATVVSITDE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +S       P NL +F+A KGSV L+GVSLTVN V    F + +I HT   TT+   + 
Sbjct: 116 NESKRFVFEAPENLAKFVAPKGSVALDGVSLTVNEVDGRRFGINVIPHTQAVTTFGRLRQ 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           GD +N+E+D + RY+ARL 
Sbjct: 176 GDRVNMEIDMLARYVARLL 194


>gi|49475528|ref|YP_033569.1| riboflavin synthase subunit alpha [Bartonella henselae str.
           Houston-1]
 gi|6572107|emb|CAB63091.1| riboflavin synthase [Bartonella henselae str. Houston-1]
 gi|49238334|emb|CAF27558.1| Riboflavin synthase alpha chain [Bartonella henselae str.
           Houston-1]
          Length = 206

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 100/202 (49%), Positives = 138/202 (68%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRL-SEEHSV 59
           MFTGIVTDIG +  +  + +GMR  + T Y+   +++G SIA +G+CLT+V   S++ + 
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGMRFNISTRYSIENLEIGASIACSGVCLTIVERGSKQQAK 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            NW+ VE W E  R+TN+  W  GTFINLERS++LGD + GHLVSGHIDG  EI+     
Sbjct: 61  INWFAVEAWEEALRLTNLTQWTKGTFINLERSLRLGDEMGGHLVSGHIDGLAEIIDQKSE 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD++   L +P     FI  KGS+ LNG SLTVN V ++ FDVL+IRHT+E TTW+  K+
Sbjct: 121 GDAVRFFLQVPKRFIPFIVNKGSIALNGTSLTVNCVEEHIFDVLIIRHTLEMTTWRQAKI 180

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GDL+N+E+D + RY+A+L    
Sbjct: 181 GDLVNLEIDQLARYVAKLSGFR 202


>gi|300113758|ref|YP_003760333.1| riboflavin synthase subunit alpha [Nitrosococcus watsonii C-113]
 gi|299539695|gb|ADJ28012.1| riboflavin synthase, alpha subunit [Nitrosococcus watsonii C-113]
          Length = 218

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 74/199 (37%), Positives = 114/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+++A+  +     LR+     + +++ +G SIA  G+CLTV R       
Sbjct: 1   MFTGIIRAVGRVVALQFMGSMAVLRINGGKLDFAQVSIGDSIAVNGVCLTVTR-----QE 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +N ++ +V  ET   T +     G  +NLE ++ L D L GHL SGH DG   +     +
Sbjct: 56  NNIFDADVSQETLSRTVLGRLQPGDRVNLEPALTLKDGLGGHLTSGHCDGVGTVAERKPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P +L ++IA KGS+C++GVSLTVN V  N F V +I HT+E TT   ++ 
Sbjct: 116 AGSVGFSIHAPAHLLKYIAEKGSICVDGVSLTVNEVKGNLFKVNIIPHTLEATTLSEYRS 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GREVNVEVDLLARYLERLL 194


>gi|146276469|ref|YP_001166628.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554710|gb|ABP69323.1| riboflavin synthase, alpha subunit [Rhodobacter sphaeroides ATCC
           17025]
          Length = 198

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 88/200 (44%), Positives = 120/200 (60%), Gaps = 3/200 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+++ +      +R R+ T Y    + +G SIA  G+CLTVV      + +
Sbjct: 1   MFTGIVTDIGRVLELECRGD-LRARIATGYRVETIDIGASIACDGVCLTVVATG--TAPE 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EV +  ET   T +  W +G  +NLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 58  NWFEVNISGETLSKTVLGGWQVGHRVNLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSLRVTFRAPEALARFIAPKGSVALNGTSLTVNEVEGAEFGINFIPHTQEVTTWGGIAPG 177

Query: 181 DLINIEVDSMMRYIARLYAL 200
             +N+E+D++ RY+ARL   
Sbjct: 178 LRVNLEIDTLARYVARLNEF 197


>gi|291562116|emb|CBL40932.1| riboflavin synthase, alpha subunit [butyrate-producing bacterium
           SS3/4]
          Length = 232

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 115/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A++       L V         K+G SIA  G+CLTV  +      +
Sbjct: 1   MFTGIVEELGQVKALSLRGNSGTLTVKAKKVLEGTKIGDSIAVNGVCLTVTNMK-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V AET R +++ +   G+++NLER++    R  GH+VSGHIDGT +I  +    
Sbjct: 56  NEFSADVMAETVRRSSLGALQDGSYVNLERAMAADGRFGGHIVSGHIDGTGQIESMRREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  ++    +   I  KGS+C++G+SLTV  V K  F V +I HT EETT    K G
Sbjct: 116 NAVWVTIACADKILDLIVEKGSICIDGISLTVAAVTKRNFSVSVIPHTGEETTLLKKKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +YI +   +  +
Sbjct: 176 DPVNLENDIVGKYIQKFVDIGRN 198


>gi|289663673|ref|ZP_06485254.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 200

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTV+     +  
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVIAFDAAN-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQAVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V +  F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPSVLRYVAKKGSICVDGVSLTVNEVDEEGFEVALIPHTVANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|312195562|ref|YP_004015623.1| riboflavin synthase, subunit alpha [Frankia sp. EuI1c]
 gi|311226898|gb|ADP79753.1| riboflavin synthase, alpha subunit [Frankia sp. EuI1c]
          Length = 265

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 112/210 (53%), Gaps = 11/210 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G + A+T  A    L + ++     ++ G SIA  G+CLTV   +    VD
Sbjct: 1   MFTGIVEELGTVAAVTEHATAAELTIGSTAVLEDVRHGASIAVNGVCLTVTSFTPPGEVD 60

Query: 61  -----NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  +  +V  ET R + + +   G  +NLER V+L DRL GHLV GH+DG   I  
Sbjct: 61  PRTGTRVFTADVMLETLRRSALGALTAGDRVNLERPVRLADRLGGHLVQGHVDGVGTIAD 120

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN------FFDVLLIRHTI 169
                     R++LP  L++++  KGS+ ++GVSLTV  V          F V LI  T+
Sbjct: 121 RAPDEHWEVVRIALPAGLDRYLVEKGSITVDGVSLTVVDVTPATADLPASFTVSLIPTTL 180

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARLYA 199
            +TT     VG L+N+EVD + +Y+ +L A
Sbjct: 181 ADTTLGARNVGALVNLEVDVVAKYVEKLAA 210


>gi|169342993|ref|ZP_02864021.1| riboflavin synthase, alpha subunit [Clostridium perfringens C str.
           JGS1495]
 gi|169298902|gb|EDS80976.1| riboflavin synthase, alpha subunit [Clostridium perfringens C str.
           JGS1495]
          Length = 217

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/202 (34%), Positives = 119/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE D + +Y+ +L   N 
Sbjct: 176 DLVNIECDPIGKYVEKLLGFNK 197


>gi|309775026|ref|ZP_07670040.1| riboflavin synthase, alpha subunit [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308917211|gb|EFP62937.1| riboflavin synthase, alpha subunit [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 211

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 115/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +       +L + +S     + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDTYNCKLSIKSSKILEDIHLGDSIAVNGICLTVTCFTRQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT  I  +    
Sbjct: 58  --FIVDVMNETWNRTALNLLKHGSLVNLERAMHMNGRLGGHIVTGHIDGTGRISSVRRDK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGSV ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQREILNLIVEKGSVTIDGISLTVAKVSKADFSVSVIPHTLEQTILKNKQVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+ +L   +  
Sbjct: 176 DMVNLENDILGKYVKKLIGNSNE 198


>gi|77464334|ref|YP_353838.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides 2.4.1]
 gi|221640220|ref|YP_002526482.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides KD131]
 gi|77388752|gb|ABA79937.1| Lumazine-binding protein [Rhodobacter sphaeroides 2.4.1]
 gi|221161001|gb|ACM01981.1| Riboflavin synthase, alpha subunit [Rhodobacter sphaeroides KD131]
          Length = 198

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 89/200 (44%), Positives = 120/200 (60%), Gaps = 3/200 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV+DIG+++ +      +R R+ T+Y+   + +G SIA  G+CLTVV    E S  
Sbjct: 1   MFTGIVSDIGRVLELERTGD-LRARIATAYDVEAIDIGASIACDGVCLTVVATGTEPSA- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V +  ET   T I  W  G  INLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 59  -WFDVNISGETLSKTVIGDWEPGRRINLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSLRVTFRAPEALARFIAPKGSVALNGTSLTVNEVDGAEFGINFIPHTQEVTTWSGIAPG 177

Query: 181 DLINIEVDSMMRYIARLYAL 200
             +N+E+D++ RY+ARL   
Sbjct: 178 LRVNLEIDTLARYVARLNEF 197


>gi|254293741|ref|YP_003059764.1| riboflavin synthase subunit alpha [Hirschia baltica ATCC 49814]
 gi|254042272|gb|ACT59067.1| riboflavin synthase, alpha subunit [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 82/203 (40%), Positives = 123/203 (60%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTD+G+I  +       R RV ++Y    +++G SI H+G+CLTVV    ++   
Sbjct: 1   MFTGLVTDLGRIADVKDDNGVRRFRVESAYPVDSIEMGASIMHSGVCLTVVGFD-QNDEG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++VE   ET   T +  W  GT +NLE+S+ LGD+L GH V GH+DG  E++ +   G
Sbjct: 60  CWFDVEAVQETLDRTVLGEWRGGTRVNLEQSLALGDKLGGHFVFGHVDGVGEVMSITPEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEETTWKM 176
            S   R S+P  L +++A KGS+ ++GVSLT+  VG     ++F+V +I HT E TT   
Sbjct: 120 GSRRIRFSIPAVLSKYVAEKGSIAIDGVSLTIAAVGIENGIDWFEVAVIPHTWEVTTIGE 179

Query: 177 HKVGDLINIEVDSMMRYIARLYA 199
            K G  +N+E D + RY+AR+  
Sbjct: 180 MKPGRKVNLEADMLARYVARMLG 202


>gi|294627699|ref|ZP_06706281.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598051|gb|EFF42206.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 200

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFDSVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSIHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDQDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|254488941|ref|ZP_05102146.1| riboflavin synthase, alpha subunit [Roseobacter sp. GAI101]
 gi|214045810|gb|EEB86448.1| riboflavin synthase, alpha subunit [Roseobacter sp. GAI101]
          Length = 195

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 130/201 (64%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+GKI ++      +R R+ T Y+T ++ +G SIA  G+CLTVV +       
Sbjct: 1   MFTGIITDVGKIASLAQEGD-LRARITTGYDTDRIDMGASIASDGVCLTVVDMGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV++ AET   TN+  W  G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYEVQISAETVEKTNLGGWVPGKRLNLERALKVGDELGGHIVSGHVDGVAEVVAMRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVTLRAPQALARFIAPKGSVALNGTSLTVNEVDGCDFGINFIPHTKEVTTWGDVAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DLIN+E+D++ RY+ARL  ++
Sbjct: 175 DLINLEIDTLARYVARLAEMS 195


>gi|56477455|ref|YP_159044.1| riboflavin synthase subunit alpha [Aromatoleum aromaticum EbN1]
 gi|56313498|emb|CAI08143.1| riboflavin synthase (alpha chain) [Aromatoleum aromaticum EbN1]
          Length = 201

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 115/204 (56%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV   G+I  +  +  G+RL V     + + +++G SIA++G+CLTVV L      
Sbjct: 1   MFSGIVAACGRIERIEALQDGVRLIVDADGLDLADVQIGDSIANSGVCLTVVALD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +  + +V  ET   T      +G  +NLE+++ L DRL GHLV+GH+DG  E++    +
Sbjct: 56  GSRVQFDVSRETLNCT-TGLDTVGNEVNLEKALCLADRLGGHLVTGHVDGVGEVVSFTPV 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  L  +IA KGS+ +NGVSLTVN V    F + LI HT+  T  K    
Sbjct: 115 GESHDLVIRAPAALAGYIAKKGSITVNGVSLTVNRVEAREFSINLIPHTVAVTNLKQLAA 174

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+E+D + RY+ R+ A    
Sbjct: 175 GSRVNLEIDLIARYVERMLAWREE 198


>gi|325923220|ref|ZP_08184899.1| riboflavin synthase, alpha subunit [Xanthomonas gardneri ATCC
           19865]
 gi|325546302|gb|EGD17477.1| riboflavin synthase, alpha subunit [Xanthomonas gardneri ATCC
           19865]
          Length = 200

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 113/202 (55%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +R    T S     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGHLAARQPQGGDVRFTFATGSLPFEAVQLGESIAVNGVCLTVIAFD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 56  AGSFQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEDGFEVALIPHTVANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|145298018|ref|YP_001140859.1| riboflavin synthase subunit alpha [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850790|gb|ABO89111.1| riboflavin synthase, alpha subunit [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 217

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+    + M L V     +   +KLG SIA  G+CLTV+ L ++   
Sbjct: 1   MFTGIIEAVGTLAALRRQGEDMALTVHAPTLDFGDVKLGDSIATNGVCLTVIGLGDKS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V  ET   T  A   +G  +NLE+++    RL GHLVSGH+DG  E+      
Sbjct: 59  ---YTADVSLETLSCTGFAKAKVGDPVNLEKALMPTSRLGGHLVSGHVDGVGEVKSKSSS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P  L ++IA KGS+ ++G+SLTVN V  + F + ++ HT +ETT    K 
Sbjct: 116 GRAIEYWIKAPGELSRYIAEKGSIAVDGISLTVNAVQGDLFRLTIVPHTAQETTIARWKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GHHVNLEVDQIARYLERLMQGKAQ 199


>gi|89097869|ref|ZP_01170756.1| riboflavin synthase subunit alpha [Bacillus sp. NRRL B-14911]
 gi|89087371|gb|EAR66485.1| riboflavin synthase subunit alpha [Bacillus sp. NRRL B-14911]
          Length = 216

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 61/204 (29%), Positives = 102/204 (50%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G++  +    K ++L +          +G SIA  G+CLT+   +E     
Sbjct: 1   MFTGLIEEVGRVEQIVHQGKTLKLSISAGRILEDAGIGDSIAVNGVCLTITDFTERK--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   T++A     + +NLER++K G R  GHLVSGHID    I+      
Sbjct: 58  --FSADVMPETYHSTSLAELKRNSPVNLERAMKAGGRFGGHLVSGHIDARGRIIRKRHEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P         KGS+ ++GVSLT+   G +   V LI HT   T     + G
Sbjct: 116 NAIYYEIEVPEEWSHLPVDKGSIAVDGVSLTIFEAGASSLTVSLIPHTAGHTILGGKEAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           + +N+E D + +YI        ++
Sbjct: 176 ETVNLEFDMLGKYIYSFMNKAAAK 199


>gi|188993055|ref|YP_001905065.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734815|emb|CAP53025.1| Riboflavin synthase, alpha chain [Xanthomonas campestris pv.
           campestris]
          Length = 200

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +     T S     ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLAARQPQGGDVHFTFATGSLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + S   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGSLQEGAVLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHGD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V    F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPQVLRYVAKKGSICVDGVSLTVNEVDDAGFEVALIPHTVANTAFSETAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|94264513|ref|ZP_01288300.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
 gi|93455072|gb|EAT05299.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
          Length = 222

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 75/202 (37%), Positives = 111/202 (54%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GKI    P   G+ L + T +  ++   G SIA  G+CLT  R        
Sbjct: 1   MFTGIILGKGKIYEKRPAGGGVTLGLETDFPLAEPLEGESIAINGVCLTARRF-----QG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  E+   TN+    +G  +NLER+++L DRL GHLVSGH+D   E+L     G
Sbjct: 56  NRFLADVSPESLERTNLGRLAVGGRVNLERALRLSDRLGGHLVSGHVDAVAEVLARQPHG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D      ++P  L ++I  KGS+ ++G+SLTVN V +  F V +I HT+  TT      G
Sbjct: 116 DFTIFSFAIPPGLGRYIIAKGSITIDGISLTVNEVDQRQFTVSIIPHTLAITTLGELAAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+EVD + +Y+ +L A+  
Sbjct: 176 GRVNLEVDLIGKYVEKLLAVKE 197


>gi|320538257|ref|ZP_08038143.1| riboflavin synthase, alpha subunit [Treponema phagedenis F0421]
 gi|320144884|gb|EFW36614.1| riboflavin synthase, alpha subunit [Treponema phagedenis F0421]
          Length = 217

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 64/198 (32%), Positives = 103/198 (52%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  +T       L +        +K+G S+A  GICLT    S +    
Sbjct: 1   MFTGIVEEVGTIKQITRGTHSAVLTIEAKLVLDDLKIGDSVAVNGICLTATACSPQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +A    G+ INLER++    R  GH+VSGH+DG  +IL +    
Sbjct: 57  -GFTADVMHETLNRSALAGLRQGSRINLERAMPANGRFGGHIVSGHVDGVGKILQITRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +  +    ++ ++I  KGS+ ++G+SLTV     + F +  I HTI  TT     +G
Sbjct: 116 TAAWYSIQTAPSILRYIVEKGSITIDGISLTVASTSADSFSISAIPHTIAVTTLSERHIG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +Y+ +L 
Sbjct: 176 DSVNLETDIIGKYVEKLL 193


>gi|289671053|ref|ZP_06492128.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 200

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 113/202 (55%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQAVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V +  F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPSVLRYVAKKGSICVDGVSLTVNEVDEEGFEVALIPHTVANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|294667127|ref|ZP_06732352.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603137|gb|EFF46563.1| riboflavin synthase subunit alpha [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 200

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 113/202 (55%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R            ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFAAGTLPFDSVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSIHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDQDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|94265527|ref|ZP_01289275.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
 gi|93453968|gb|EAT04314.1| Lumazine-binding protein [delta proteobacterium MLMS-1]
          Length = 222

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 75/202 (37%), Positives = 112/202 (55%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   GKI    P   G+ L + T +  ++   G SIA  G+CLT  R        
Sbjct: 1   MFTGIILGKGKIYEKRPAGGGVTLGLETDFPLAEPLEGESIAINGVCLTARRF-----QG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  E+ + TN+    +G  +NLER+++L DRL GHLVSGH+D   E+L     G
Sbjct: 56  NRFLADVSPESLKRTNLGRLAVGGRVNLERALRLSDRLGGHLVSGHVDAVAEVLARQPCG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D      ++P  L ++I  KGS+ ++G+SLTVN V +  F V +I HT+  TT      G
Sbjct: 116 DFTIFSFAIPPGLGRYIIAKGSITIDGISLTVNEVDQRQFTVSIIPHTLAITTLGELAAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+EVD + +Y+ +L A+  
Sbjct: 176 GRVNLEVDLIGKYVEKLLAVKE 197


>gi|325680438|ref|ZP_08159988.1| riboflavin synthase, alpha subunit [Ruminococcus albus 8]
 gi|324107876|gb|EGC02142.1| riboflavin synthase, alpha subunit [Ruminococcus albus 8]
          Length = 214

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 106/204 (51%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G +  +        +R+         K+G SIA  G+CLTV          
Sbjct: 1   MFTGLIEEVGTVCEVHKSGSQSFIRIAAKKVLEGTKVGDSIAVNGVCLTVTEHD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +++ S   G+  +LER++    R  GH+VSGHIDGT  I  +   G
Sbjct: 56  SVFRADVMNETLMRSSLGSLKAGSKTDLERALPADGRFGGHIVSGHIDGTGVISAIQKDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++    S    L ++IA KGSV ++G+SLTV  V  + F V +I HT E T   + KVG
Sbjct: 116 IAVRYTFSAESRLLRYIAEKGSVAIDGISLTVASVNDSSFSVSVIPHTAENTVLPLRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIE D + +YI +L      +
Sbjct: 176 DTVNIETDVIAKYIEKLLRPAPQK 199


>gi|91776449|ref|YP_546205.1| riboflavin synthase subunit alpha [Methylobacillus flagellatus KT]
 gi|91710436|gb|ABE50364.1| riboflavin synthase, alpha subunit [Methylobacillus flagellatus KT]
          Length = 199

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 82/200 (41%), Positives = 117/200 (58%), Gaps = 8/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G I  +TP     RL + T   +   + +G SIA  G+CLT + L      
Sbjct: 1   MFTGIIQAQGHIKTITPHDGDARLVIDTGDLDLHDVAIGDSIAVNGVCLTAIALGP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +E +V  ET   T          +NLE++++L DRL GHLVSGH+DG  +++  + +
Sbjct: 57  -HSFEADVSKETLSCTVGLDTLRQ--VNLEKALRLSDRLGGHLVSGHVDGVGQVIRFEPV 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+SM   +  PH L ++IAVKGSV ++GVSLTVN V  + F V LI HT+E TT K   V
Sbjct: 114 GESMLLIVRAPHALSRYIAVKGSVTIDGVSLTVNHVDGDDFSVNLIPHTMEVTTLKNLGV 173

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+EVD + RY+ R+  
Sbjct: 174 GSRVNLEVDLIARYVERMAQ 193


>gi|254511752|ref|ZP_05123819.1| riboflavin synthase, alpha subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221535463|gb|EEE38451.1| riboflavin synthase, alpha subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 195

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG +  +      +R R+ T Y T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGTVTELDQQGD-LRARIRTGYETAGIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WY+V++ AET   TN+++W IG  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWYDVQISAETVSKTNLSTWRIGKRVNLERALKVGDELGGHIVSGHVDGVAEVVAVADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    VG
Sbjct: 115 DSTRVALRAPSELARFIAPKGSVALNGTSLTVNDVDGCNFGINFIPHTKEVTTWGDVAVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DRVNLEIDTLARYVARL 191


>gi|34391414|gb|AAM77478.1| riboflavin synthase [Bartonella vinsonii subsp. arupensis]
          Length = 205

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+RL + T Y+ + +++G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEEVQSLKKGVRLNISTRYDMASLEIGSSIACSGICLTIVERGSKQENM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAKWTKGTCINLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P   + FI  KGS+ LNG SLTVN +    FD+L+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLKVPMRFKPFIVSKGSIALNGTSLTVNCIEDCIFDILVIRHTLKMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|330505154|ref|YP_004382023.1| riboflavin synthase subunit alpha [Pseudomonas mendocina NK-01]
 gi|328919440|gb|AEB60271.1| riboflavin synthase subunit alpha [Pseudomonas mendocina NK-01]
          Length = 220

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I AMTP    +R+ V T   +   +KLG SIA  GICLT V L      
Sbjct: 1   MFTGIIEAIGSIRAMTPKGGDVRVYVATGKLDLGDVKLGDSIAVNGICLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T       G+ +NLE+++    RL GHLVSGH+DG  EI+     
Sbjct: 56  GDGFWADVSRETLARTAFVDLKPGSAVNLEKALTPTSRLGGHLVSGHVDGVGEIVSRADN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             ++  ++  P  L ++IA KGS+ ++G SLTVN V    F++ ++ HT+ ET    ++ 
Sbjct: 116 ARAVQFKVRAPRELAKYIAHKGSITVDGTSLTVNAVDGAEFELTIVPHTLAETIMVDYQA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GRKVNLEVDLLARYLERLLLGDKA 199


>gi|256821697|ref|YP_003145660.1| riboflavin synthase subunit alpha [Kangiella koreensis DSM 16069]
 gi|256795236|gb|ACV25892.1| riboflavin synthase, alpha subunit [Kangiella koreensis DSM 16069]
          Length = 202

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 71/200 (35%), Positives = 116/200 (58%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G I A+ P  +  R R  T   + S ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEATGYIAAIEPKGEDARYRFQTGKLDLSDVELGDSIACNGVCLTVIE-----KF 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           ++ +  +V  ET ++T    +     IN E+++    R  GH+VSGH+DG  E++ ++  
Sbjct: 56  NDGFAADVSVETIKVTCFKHYQAQQPINFEKAMLPTTRFGGHMVSGHVDGIGEVMAIEDA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   +  P ++  +IA+KGS+ ++G SLTVN + ++ F + L+ HT++ET    +KV
Sbjct: 116 GRSIQYTIRAPQDVLHYIAIKGSITVDGTSLTVNQIKEDCFFLNLVPHTLQETIADSYKV 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  IN+E+D + RY+ RL  
Sbjct: 176 GTKINLEIDLIARYLERLMQ 195


>gi|152966923|ref|YP_001362707.1| riboflavin synthase, alpha subunit [Kineococcus radiotolerans
           SRS30216]
 gi|151361440|gb|ABS04443.1| riboflavin synthase, alpha subunit [Kineococcus radiotolerans
           SRS30216]
          Length = 209

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 72/208 (34%), Positives = 112/208 (53%), Gaps = 9/208 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG+++A+   A+  RL V      S    G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEEIGEVVAVEFGAESARLTVRGPLVVSDAVHGASIAVGGVCLTVVD----QPGP 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  E+ R +++     G  +NLER++    RL GH+V GH+DGT  I       
Sbjct: 57  GTFTVDVMQESLRRSSLRDVAPGRRVNLERALAAHGRLGGHIVQGHVDGTGTITARTPGD 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
                R+++P +L +++  KGS+ ++G SLTV+ V      + + +V LI  T++ TT  
Sbjct: 117 AWEVVRIAVPADLARYVVEKGSITVDGTSLTVSAVSAVEEDEPWLEVSLIPTTLDLTTLG 176

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNTS 203
              VG  +N+EVD + +Y+ RL A   +
Sbjct: 177 SAPVGTTVNLEVDVLAKYVERLNAFGRA 204


>gi|262202281|ref|YP_003273489.1| riboflavin synthase subunit alpha [Gordonia bronchialis DSM 43247]
 gi|262085628|gb|ACY21596.1| riboflavin synthase, alpha subunit [Gordonia bronchialis DSM 43247]
          Length = 215

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 117/201 (58%), Gaps = 9/201 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I A   +    R+ V     TS    G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEIAAREDLPDAARITVRGPVVTSDAGYGDSIAVNGVCLTVVE-----KRD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V AET R ++++  G G+ +NLER++  G R  GH+V GH+DGT E++ +    
Sbjct: 56  DSFTVDVMAETLRRSSLSGLGPGSRVNLERAMPAGGRFGGHIVQGHVDGTGEVMSVSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEETTWKM 176
                R+++P  L +++  KGS+ ++GVSLTV  +G+     +F++ LI  T+ ET    
Sbjct: 116 HWTVVRIAMPGQLSRYLVEKGSITVDGVSLTVAALGETDQTPWFEISLIPTTLSETNLGS 175

Query: 177 HKVGDLINIEVDSMMRYIARL 197
              G ++N+EVD + +Y+ RL
Sbjct: 176 AAPGTVVNLEVDVIAKYVERL 196


>gi|163815504|ref|ZP_02206877.1| hypothetical protein COPEUT_01669 [Coprococcus eutactus ATCC 27759]
 gi|158449141|gb|EDP26136.1| hypothetical protein COPEUT_01669 [Coprococcus eutactus ATCC 27759]
          Length = 227

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 69/199 (34%), Positives = 105/199 (52%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  +        + V         ++G SIA  G+CLT   +S      
Sbjct: 1   MFTGIVEEIGTIRKIDKGVSSCSITVQAGKVLQGSQVGDSIAVNGVCLTATSIS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET R + +     G+ +NLER++  G R  GH+VSGHIDGT  I  L    
Sbjct: 56  NIFTADVMPETLRRSGLGQLTGGSRVNLERAMAAGGRFGGHIVSGHIDGTGTIRELKRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGS+ ++G+SLTV  V    F V +I HT  ETT    K G
Sbjct: 116 NAVWVTIDCSPKILRYIIEKGSIAIDGISLTVAYVDDTCFKVSIIPHTAGETTLLDGKPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
            ++N+E D + +Y+ +L A
Sbjct: 176 KVVNLENDVVGKYVEKLLA 194


>gi|114767005|ref|ZP_01445913.1| riboflavin synthase subunit alpha [Pelagibaca bermudensis HTCC2601]
 gi|114540789|gb|EAU43853.1| riboflavin synthase subunit alpha [Roseovarius sp. HTCC2601]
          Length = 195

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 93/201 (46%), Positives = 131/201 (65%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G++ ++      +  R+ T Y+TS +++G SIA  G+CLTV+ L       
Sbjct: 1   MFTGIVTDMGEVRSLEQAGD-LTARIGTGYDTSGIEIGASIACDGVCLTVIDLGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN+ +W  G  INLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWFDVQISAETVSKTNLDAWTEGRRINLERALKVGDELGGHIVSGHVDGLAEVVAMRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW   +VG
Sbjct: 115 DSTRVTLRAPEALARFIAPKGSVALNGTSLTVNEVDGCEFGINFIPHTKEVTTWGGVEVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D IN+E+D++ RY+ARL  ++
Sbjct: 175 DRINLEIDTLARYVARLAEMS 195


>gi|332559226|ref|ZP_08413548.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides WS8N]
 gi|332276938|gb|EGJ22253.1| riboflavin synthase subunit alpha [Rhodobacter sphaeroides WS8N]
          Length = 198

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 89/200 (44%), Positives = 120/200 (60%), Gaps = 3/200 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV+DIG+++ +      +R R+ T+Y+   + +G SIA  G+CLTVV    E S  
Sbjct: 1   MFTGIVSDIGRVLELERTGD-LRARIATAYDVQAIDIGASIACDGVCLTVVATGTEPSA- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V +  ET   T I  W  G  INLER++K+GD L GH+VSGH+DG  E++     G
Sbjct: 59  -WFDVNISGETLSKTVIGDWEPGRRINLERALKVGDELGGHIVSGHVDGVAEVVRAVPEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+      P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW     G
Sbjct: 118 DSVRVTFRAPEALARFIAPKGSVALNGTSLTVNEVDGAEFGINFIPHTQEVTTWSGIAPG 177

Query: 181 DLINIEVDSMMRYIARLYAL 200
             +N+E+D++ RY+ARL   
Sbjct: 178 LRVNLEIDTLARYVARLNEF 197


>gi|325928454|ref|ZP_08189645.1| riboflavin synthase, alpha subunit [Xanthomonas perforans 91-118]
 gi|325541171|gb|EGD12722.1| riboflavin synthase, alpha subunit [Xanthomonas perforans 91-118]
          Length = 200

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDEDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGAR 197


>gi|109897637|ref|YP_660892.1| riboflavin synthase subunit alpha [Pseudoalteromonas atlantica T6c]
 gi|109699918|gb|ABG39838.1| riboflavin synthase, alpha subunit [Pseudoalteromonas atlantica
           T6c]
          Length = 221

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ D+G I ++TP    +RLR+  +  + S + LG SIA+ G+CLTVV ++     
Sbjct: 1   MFTGIIEDVGHIESLTPTGDDIRLRIRVNKLDMSDVALGDSIANNGVCLTVVDMNS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET + +  A +  G+ +NLE+++    R  GH+VSGH+DG  E++ ++ +
Sbjct: 57  -SGFSADVSHETIKRSGFADYKAGSKVNLEKAMLPTSRFGGHIVSGHVDGVGEVVSVNPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G  +   +  P +L +++A KGS+ ++GVSLTVN V    F + LI H++EET    +K 
Sbjct: 116 GRYVEIWVQAPKDLARYLAEKGSITVDGVSLTVNAVEGAKFLITLIPHSLEETIIGGYKK 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  IN+EVD + RY+ RL   + +
Sbjct: 176 GTKINLEVDVVARYLERLMLGDKA 199


>gi|240172787|ref|ZP_04751446.1| riboflavin synthase subunit alpha [Mycobacterium kansasii ATCC
           12478]
          Length = 215

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/201 (37%), Positives = 115/201 (57%), Gaps = 7/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++IA   +    RL +     TS    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGEVIARDTLTDAARLTIRGPVVTSDAGHGDSIAVNGVCLTVVEV----LPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +++    +G+ +NLER+  L  RL GH+V GH+DGT EI+      
Sbjct: 57  GQFTADVMAETLNRSSLGDLRVGSRVNLERAAALNSRLGGHIVQGHVDGTGEIVARTPSQ 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  L ++I  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEVPATLARYIVEKGSITVDGISLTVSGLGAQPRDWFEVSLIPTTRELTTLGSA 176

Query: 178 KVGDLINIEVDSMMRYIARLY 198
            VG  +N+EVD + +Y+ RL 
Sbjct: 177 PVGTRVNLEVDVLAKYVERLL 197


>gi|34391424|gb|AAM77483.1| riboflavin synthase [Bartonella vinsonii subsp. vinsonii]
          Length = 205

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 129/201 (64%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I  +  + KG+R  V T Y    +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCIEDIQSLKKGVRFNVSTRYAVESLEIGSSIACSGICLTIVGRGSKQANM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLVSGHIDG  E +     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTCINLERSLRLGDEMGGHLVSGHIDGLAETIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FD+L+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTQFTPFIVNKGSIALNGTSLTVNCVEGCIFDILIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY+A+     
Sbjct: 181 DQVNLEIDPLARYVAKFSGFK 201


>gi|260578781|ref|ZP_05846688.1| riboflavin synthase, alpha subunit [Corynebacterium jeikeium ATCC
           43734]
 gi|258603079|gb|EEW16349.1| riboflavin synthase, alpha subunit [Corynebacterium jeikeium ATCC
           43734]
          Length = 210

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 66/212 (31%), Positives = 101/212 (47%), Gaps = 14/212 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++ A+      +R+R          K G SIA  G+CLTV  L+ E    
Sbjct: 1   MFTGIIEEVGRVAAIEEAGDSLRMRFTAPGVLVDAKRGDSIAINGVCLTVAELAPEE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V   T   + +    +G  +N+ER++  G R  GH+V GH+DGT  +       
Sbjct: 58  --FTADVMQVTLDYSALGGVSVGDRVNVERAMASGQRFGGHIVQGHVDGTATLQERRPSE 115

Query: 121 DSMYCRLS-LPHNLEQFIAVKGSVCLNGVSLTVNLV--------GKNFFDVLLIRHTIEE 171
                R       L +++A KGSV LNG SLTV  V         + +F+V LI  T+ +
Sbjct: 116 HWEVFRFRLEDPQLARYVAKKGSVALNGTSLTVAEVAEAGGTGSAEAWFEVSLIPTTLAD 175

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
           T       GD +N+E D + +Y+ RL      
Sbjct: 176 TMLGDLHPGDTVNVECDVLAKYVERLAQHGAQ 207


>gi|49474162|ref|YP_032204.1| riboflavin synthase subunit alpha [Bartonella quintana str.
           Toulouse]
 gi|6572111|emb|CAB63094.1| riboflavin synthase alpha chain [Bartonella quintana]
 gi|49239666|emb|CAF26037.1| Riboflavin synthase alpha chain [Bartonella quintana str. Toulouse]
          Length = 206

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 98/202 (48%), Positives = 133/202 (65%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRL-SEEHSV 59
           MFTGIVTDIG +  +  + +G+R  + T Y+   +++G SIA +GICLT+V   S++ + 
Sbjct: 1   MFTGIVTDIGCVEDIQSLKQGVRFNISTHYDMESLEIGASIACSGICLTIVERGSKQKAK 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            NW+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     
Sbjct: 61  TNWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKE 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW    +
Sbjct: 121 GDAVRFFLQVPTKFTPFIVNKGSIALNGTSLTVNCVKDRIFDVLIIRHTLEMTTWGQANI 180

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +N+E+D + RY A+L    
Sbjct: 181 GDRVNLEIDQLARYAAKLSGFK 202


>gi|328906121|gb|EGG25896.1| riboflavin synthase, alpha subunit [Propionibacterium sp. P08]
          Length = 199

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 75/203 (36%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLT+  L E     
Sbjct: 1   MFTGIIEEIGEVLAIERGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTITELDE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +V AET   T +     G  +NLER V +GDRL GH+V GH+DGT E++      
Sbjct: 56  DFFGCDVMAETLNRTALGHLAAGIRVNLERPVSVGDRLGGHIVQGHVDGTAELVSRTPGD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R ++P  L ++I  KGS+ +NG SLTV  V   +F+V LI  T+  T      +G
Sbjct: 116 HWEVFRFTVPTILSRYITEKGSIAINGTSLTVCAVTPEWFEVSLIPATLTGTVLGALTLG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 176 DEVNVEVDVIAKYLEALTNKERS 198


>gi|194364359|ref|YP_002026969.1| riboflavin synthase subunit alpha [Stenotrophomonas maltophilia
           R551-3]
 gi|194347163|gb|ACF50286.1| riboflavin synthase, alpha subunit [Stenotrophomonas maltophilia
           R551-3]
          Length = 208

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A   I   +R      +     +++G SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGRLAARESIGGDVRFTFNVGNLPFDNVQMGESIAINGVCLTVIAFD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++ +   ET  +T +     G  INLER+++  DRL GHLVSGH+DG  ++L +   
Sbjct: 56  ASSFQADASTETLGLTTLGQLSEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVLSIHED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P +L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASLRRYIAKKGSICVDGVSLTVNEVDDEGFEVALIPHTVANTAFSAAGV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+E+D + RY+ RL ++  +
Sbjct: 176 GSAVNLEIDLVARYVERLISVPAN 199


>gi|84515385|ref|ZP_01002747.1| riboflavin synthase subunit alpha [Loktanella vestfoldensis SKA53]
 gi|84510668|gb|EAQ07123.1| riboflavin synthase subunit alpha [Loktanella vestfoldensis SKA53]
          Length = 198

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 94/197 (47%), Positives = 129/197 (65%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+++A+      +R R+ T Y+ + + +G SIA  G+CLTV+ L  +    
Sbjct: 1   MFTGIVTDIGRVLALDQQGD-LRARIGTGYDVAGIDIGASIACNGVCLTVIALGRDPQ-- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW++V++ AET   TN++ W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 58  NWFDVQISAETVGATNVSGWTVGKRLNLERALKVGDELGGHIVSGHVDGVAEVVAMRDEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS       P  L +FIA KGSV L+G SLTVN V    F +  I HT   TTW    VG
Sbjct: 118 DSTRVTFRAPEALARFIAPKGSVALDGTSLTVNEVAGRDFGINFIPHTKTATTWGDVAVG 177

Query: 181 DLINIEVDSMMRYIARL 197
           DLINIE+D+M RY+ARL
Sbjct: 178 DLINIEIDTMARYVARL 194


>gi|163782876|ref|ZP_02177872.1| riboflavin synthase subunit alpha [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881997|gb|EDP75505.1| riboflavin synthase subunit alpha [Hydrogenivirga sp. 128-5-R1-1]
          Length = 206

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 75/202 (37%), Positives = 112/202 (55%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++GK++++T  +KG  L V  S     +K+G S++  G CLTVVRL      +
Sbjct: 1   MFTGLVEEVGKVVSITRDSKGGVLEVGCS--FEDLKVGDSVSVNGACLTVVRLG-----N 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                EV  ET   TN+ +   G F+NLER+++   RL GH V GH+D T  I+    +G
Sbjct: 54  GTAHFEVSPETFSRTNLKALKRGDFVNLERALRADSRLGGHFVLGHVDFTARIVSFRDLG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +     + LPH   +    KGSV ++G+SLTVN V +    + +I HT E T  K  K G
Sbjct: 114 EHRELLIELPHPYRKHFVEKGSVAIDGISLTVNRVSEGSVSINVIPHTYESTNLKYRKPG 173

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ R    + 
Sbjct: 174 DEVNVETDIIGKYVLRYLGADE 195


>gi|328956809|ref|YP_004374195.1| riboflavin synthase, subunit alpha [Carnobacterium sp. 17-4]
 gi|328673133|gb|AEB29179.1| riboflavin synthase, subunit alpha [Carnobacterium sp. 17-4]
          Length = 217

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 119/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I ++    K   L++         ++G SI+  GICLTV ++      +
Sbjct: 1   MFTGIIEEMGTIQSIKRGEKSSILKIKGQKVLQGTRIGDSISTNGICLTVTKIG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +V +E+ + TNI     G+++NLER++ L  RL GH+VSGHIDGT EI  +    
Sbjct: 56  DSFDADVMSESLKRTNIGELAPGSYVNLERALSLETRLGGHMVSGHIDGTGEIREMKRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGS+ ++GVSLTV  V    F V +I HT EET     ++G
Sbjct: 116 NAVWITVETSPKLLRYIIEKGSIAIDGVSLTVVTVDDQSFKVSVIPHTGEETVLLRKQLG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ +L  L++
Sbjct: 176 DAVNLECDMIGKYVEKLLGLDS 197


>gi|302206247|gb|ADL10589.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           C231]
 gi|308276489|gb|ADO26388.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           I19]
          Length = 213

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 117/202 (57%), Gaps = 9/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G ++++ P+   + L +          LG SIA  G+CLTV  + E     
Sbjct: 1   MFSGIVEEVGTVVSLEPLTDSIVLSIAAHKVLEGTSLGDSIAVNGVCLTVTDIQE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++  +V  E+   +++     GT +NLER+++   RLDGH+V GH+DGT E++  D   
Sbjct: 56  GFFSADVMQESLVRSSLGGLTAGTPVNLERALRADGRLDGHIVQGHVDGTAELISKDPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----KNFFDVLLIRHTIEETTWKM 176
                R +LP  L +++  KGS+ ++G SLTV+ +G     ++F+V LI  T++ TT   
Sbjct: 116 HWTVLRFTLPKELSRYVVEKGSISVDGTSLTVSGLGESEGNHWFEVSLIPTTLQSTTHGQ 175

Query: 177 HKVGDLINIEVDSMMRYIARLY 198
            ++GD +N+EVD + +Y+ R+ 
Sbjct: 176 CQLGDRVNLEVDVLAKYVERML 197


>gi|258515513|ref|YP_003191735.1| riboflavin synthase subunit alpha [Desulfotomaculum acetoxidans DSM
           771]
 gi|257779218|gb|ACV63112.1| riboflavin synthase, alpha subunit [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 221

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 111/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G + ++   A   +L +     T  +K+G SIA  G+CLT ++   +    
Sbjct: 1   MFTGLVEELGVLQSVRHGAASAQLNIAAGKITRGIKIGDSIAVNGVCLTAIKFGGQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   TN+ +   G  +NLER++ LGDRL GHLVSGHIDG   I   +   
Sbjct: 57  -GFTADVMAETLSKTNLGNLKPGDRVNLERALSLGDRLGGHLVSGHIDGVGIIANKEIQD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   +  P  + ++I  KGSV ++G SLT+     + F V LI HT +ETT      G
Sbjct: 116 IAILITIKAPPEVMRYIIKKGSVAIDGTSLTIVDFTDDSFLVSLIPHTAKETTLGFKTPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +YI RL     +
Sbjct: 176 DTVNLEGDIIGKYIERLLQARET 198


>gi|332982091|ref|YP_004463532.1| riboflavin synthase subunit alpha [Mahella australiensis 50-1 BON]
 gi|332699769|gb|AEE96710.1| riboflavin synthase, alpha subunit [Mahella australiensis 50-1 BON]
          Length = 219

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 109/197 (55%), Gaps = 5/197 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGI+ +IG +  +T  A+ +RL V      S++ +G SI   G CLTV          +
Sbjct: 4   FTGIIQEIGSVRHITHGAQSVRLAVEAPKLISRLNIGDSICTNGTCLTVTDKE-----GH 58

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +   ET R T +     G  +NLE S+ L D L GH+VSGH+DG   I  L    +
Sbjct: 59  VFWADATPETVRRTTLFELKPGDPVNLEPSLTLQDFLGGHIVSGHVDGIGIIKQLRHEEN 118

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           +++  +++  +L  +I  KGSV ++GVSLTV  V  + F V +I HT  +TT K+ K GD
Sbjct: 119 ALWLDITVGPDLLLYIVEKGSVAVDGVSLTVADVPDDRFSVSIIPHTAAQTTLKVKKAGD 178

Query: 182 LINIEVDSMMRYIARLY 198
            +NIE D + RY+A+  
Sbjct: 179 RVNIECDMIGRYVAKFL 195


>gi|21241519|ref|NP_641101.1| riboflavin synthase subunit alpha [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78046356|ref|YP_362531.1| riboflavin synthase subunit alpha [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|21106866|gb|AAM35637.1| riboflavin synthase alpha chain [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|78034786|emb|CAJ22431.1| riboflavin synthase, alpha chain [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 200

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFEAVQLGESIAVNGVCLTVIAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPTDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P ++ +++A KGS+C++GVSLTVN V ++ F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPASVLRYVAKKGSICVDGVSLTVNDVDEDGFEVALIPHTVAHTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GAAVNLEIDLVARYVERLLGTR 197


>gi|84687682|ref|ZP_01015555.1| riboflavin synthase subunit alpha [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664265|gb|EAQ10756.1| riboflavin synthase subunit alpha [Rhodobacterales bacterium
           HTCC2654]
          Length = 196

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 99/197 (50%), Positives = 132/197 (67%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG+I  +T     +R R+ T+Y+TS+++LG SIA  G+CLTV RL       
Sbjct: 1   MFTGIITDIGRIAEVTRTED-LRARIATAYDTSRIELGASIASDGVCLTVTRLGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +WYEV V  ET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E+  +   G
Sbjct: 55  DWYEVFVSGETLTKTNLGGWEVGRRVNLERALKVGDELGGHIVSGHVDGVAEVTDVHDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS      +P +L +FIA KGSV LNG SLTVN V  + F V LI HT E TTW   +VG
Sbjct: 115 DSTRISFKVPGDLARFIAPKGSVALNGTSLTVNEVEGDTFGVNLITHTKEVTTWGDVRVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DKVNLEIDTLARYVARL 191


>gi|302525888|ref|ZP_07278230.1| riboflavin synthase, alpha subunit [Streptomyces sp. AA4]
 gi|302434783|gb|EFL06599.1| riboflavin synthase, alpha subunit [Streptomyces sp. AA4]
          Length = 201

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 117/199 (58%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    RL V     TS    G SIA +G+CLTVV +S      
Sbjct: 1   MFTGIVEEVGEVTAVEQLTDAARLTVRGPLVTSDAGHGDSIAVSGVCLTVVTVS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + +++A   +G  +NLER+   G RL GH++ GH+DGT   L  D  G
Sbjct: 56  GEFTVDVVNETLQRSSLAKVAVGDAVNLERATPAGGRLGGHIMQGHVDGTGVFLSRDERG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +   SLP  L +++  KGS+ ++GVSLTV  + ++ F V LI  T+E TT    + G
Sbjct: 116 VTTF---SLPPALARYVVEKGSIAVDGVSLTVASIAEDRFSVALIPTTLEATTLGRREEG 172

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +Y+ +L A
Sbjct: 173 DHVNLEVDVVAKYVEKLTA 191


>gi|325289916|ref|YP_004266097.1| riboflavin synthase, alpha subunit [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965317|gb|ADY56096.1| riboflavin synthase, alpha subunit [Syntrophobotulus glycolicus DSM
           8271]
          Length = 218

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 64/202 (31%), Positives = 107/202 (52%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G I  +    +   L V  +        G SIA  G+CLTV R+  +    
Sbjct: 1   MFTGLIEELGSIENIEIGGESAALTVNATKVLEGTVPGDSIAVNGVCLTVTRMGNK---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET + T +      + +NLER+++L  RL GHLVSGH+DG   +  +  +G
Sbjct: 57  -LFTVDVMAETLQKTGLQELKPMSRVNLERALRLSSRLGGHLVSGHVDGVGTVRSVKQVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     +  ++  KGSV ++G+SLTV   G ++F + +I HT + TT    K G
Sbjct: 116 IAKVYSIQTTPAIMHYLIPKGSVAVDGISLTVVETGTDYFTISIIPHTFQNTTLYDKKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+E D + +Y+A+    + 
Sbjct: 176 SRVNLETDLIGKYVAKFLKTDE 197


>gi|257092177|ref|YP_003165818.1| riboflavin synthase subunit alpha [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044701|gb|ACV33889.1| riboflavin synthase, alpha subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 210

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 76/208 (36%), Positives = 115/208 (55%), Gaps = 11/208 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG---MRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MF+GI+  +G+I  +T    G   +RL +         + LG SIA  G+CLTVV     
Sbjct: 1   MFSGIIAALGQITCITARDDGAGTVRLTIDAGRLALDDVNLGDSIACNGVCLTVVD---- 56

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
              DN + V+V  E+   T          +NLE++++L DRL GHLVSGH+DG  E+L  
Sbjct: 57  -RRDNSFCVDVSPESLACTVG--LATPGPVNLEKALRLADRLGGHLVSGHVDGVGEVLRF 113

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
           D +GD+    +  P  L ++IA KGS+ ++GVSLT N V    F + LI HT++ TT   
Sbjct: 114 DPVGDNRLLEIRAPAALARYIARKGSITVDGVSLTTNSVDGAAFSINLIPHTLDATTLGR 173

Query: 177 HKVGDLINIEVDSMMRYIARLYALNTSQ 204
            + G  +N+E+D + RY+ R+    + +
Sbjct: 174 LQPGSRVNLEIDLIARYVERMLGAPSGE 201


>gi|168187452|ref|ZP_02622087.1| riboflavin synthase, alpha subunit [Clostridium botulinum C str.
           Eklund]
 gi|169294653|gb|EDS76786.1| riboflavin synthase, alpha subunit [Clostridium botulinum C str.
           Eklund]
          Length = 216

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I ++    +  R+++  +     + LG SI   G+CLTV     +    
Sbjct: 1   MFTGIVEEIGTINSIFQSGENARIKIDANKVLEDVNLGDSICTNGVCLTVTEYDSK---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R +N+     G  +NLER++ LG R  GH+VSGHIDG   I      G
Sbjct: 57  -GFTVDVMGETLRRSNLGELKKGDKVNLERALALGGRFGGHIVSGHIDGIGVIKEFSNEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +   +N+ + I  KGS+ ++GVSLTV  V  + F V +I HT  ET     K G
Sbjct: 116 NAIWISIEAINNILKSIVFKGSITIDGVSLTVAYVDDDIFKVCIIPHTQSETILTSKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +YI +L  +   +
Sbjct: 176 DKVNLECDVIAKYIEKLLMVQEKE 199


>gi|284166519|ref|YP_003404798.1| riboflavin synthase, subunit alpha [Haloterrigena turkmenica DSM
           5511]
 gi|284016174|gb|ADB62125.1| riboflavin synthase, alpha subunit [Haloterrigena turkmenica DSM
           5511]
          Length = 201

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 108/203 (53%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G+I+A      G+RLR+      + ++ G SI+ +G+CLTV R        
Sbjct: 1   MFTGIVEETGEIVARERTDDGLRLRIGADAVATGLEHGQSISVSGVCLTVERFE----TG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EV +  ET   T + +   G  +NLER++    R DGH+V GH+D    +  ++ + 
Sbjct: 57  AWFEVFLATETVERTYLGTLEEGDIVNLERAMPADGRFDGHVVQGHVDAVATVTEIESVE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK--NFFDVLLIRHTIEETTWKMHK 178
           +  +    LP    +++  KGS+ L+G+SLTV  + +      V +I  T + TT     
Sbjct: 117 EDWFFEFELPEGYAKYVVEKGSITLDGISLTVADLDEAAGRVTVAIIPTTYDLTTLSEKS 176

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VGD +++EVD + +Y+ RL    
Sbjct: 177 VGDQVHLEVDVLAKYVERLLEAR 199


>gi|163742961|ref|ZP_02150344.1| riboflavin synthase subunit alpha [Phaeobacter gallaeciensis 2.10]
 gi|161383644|gb|EDQ08030.1| riboflavin synthase subunit alpha [Phaeobacter gallaeciensis 2.10]
          Length = 249

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 95/203 (46%), Positives = 130/203 (64%), Gaps = 8/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ T Y+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 53  MFTGIVTDIGIITELEQQGD-LRARIRTGYDTASIDIGASIASDGVCLTVIALG-----D 106

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +WY+V++ AET   TNI    W +G  +NLER++K+GD L GH+VSGH+DG  E++ +  
Sbjct: 107 DWYDVQISAETVSKTNIGGNGWTVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVDIRD 166

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    
Sbjct: 167 EGDSTRVTLRAPEDLARFIAPKGSVALNGTSLTVNDVEGCDFGINFIPHTKEVTTWGDVA 226

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG+ +N+E+D++ RY+ARL+  +
Sbjct: 227 VGNAVNLEIDTLARYVARLHEAS 249


>gi|160895273|ref|ZP_02076045.1| hypothetical protein CLOL250_02833 [Clostridium sp. L2-50]
 gi|156863152|gb|EDO56583.1| hypothetical protein CLOL250_02833 [Clostridium sp. L2-50]
          Length = 229

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G I  +       RL +         K+G SIA  G+CLT+  +S      
Sbjct: 12  MFTGIVEETGTIKKIEKGTSSGRLTIEADKVLQGSKIGDSIAVNGVCLTITGMS-----G 66

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET R +N+ +   G+ +NLER++    R  GH+VSGHIDGT  I       
Sbjct: 67  HLFTADVMAETIRRSNLGTLSSGSKVNLERAMAADGRFGGHIVSGHIDGTGVITDYTGEE 126

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  ++    L ++I  KGS+ ++G+SLTV  V    F V +I HT EETT    + G
Sbjct: 127 NAIWVTVTCDKKLLKYIIEKGSITIDGISLTVAYVDDRCFKVSIIPHTAEETTLIRRQTG 186

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            ++N+E D + +Y+ +L      +
Sbjct: 187 AVVNLENDVIGKYVDKLLHFKDKE 210


>gi|90415721|ref|ZP_01223655.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2207]
 gi|90333044|gb|EAS48214.1| riboflavin synthase, alpha subunit [marine gamma proteobacterium
           HTCC2207]
          Length = 204

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI++ +G++  + P     RL +   + + + ++LG SIA  G CLT V L+E    
Sbjct: 1   MFTGIISALGELTNLEPRGGDARLHINAGNLSMADVQLGDSIACNGTCLTAVELTE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N +  +V  ET  +T       G+ INLE++++  DR  GH+VSGH+DG  E++ L   
Sbjct: 57  -NGFVADVSVETLTLTTTGDLKSGSRINLEKAMQATDRFGGHIVSGHVDGIGEVVSLHED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   R+  P  L +++A KGS+ ++G SLTVN V    F++ ++ HT+  T    ++V
Sbjct: 116 ARSWRFRIRAPRELAKYVAHKGSITVDGTSLTVNHVEGAEFELNIVPHTMVHTIMGDYQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTKVNLEVDLVARYLERLLLGDKA 199


>gi|18309549|ref|NP_561483.1| riboflavin synthase subunit alpha [Clostridium perfringens str. 13]
 gi|18144226|dbj|BAB80273.1| riboflavin synthase alpha subunit [Clostridium perfringens str. 13]
          Length = 217

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 119/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +NI +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNIGNLKKSSKVNLERAMSINSRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE D + +Y+ +L   N 
Sbjct: 176 DLVNIECDPIGKYVEKLLGFNK 197


>gi|223939369|ref|ZP_03631248.1| riboflavin synthase, alpha subunit [bacterium Ellin514]
 gi|223891973|gb|EEF58455.1| riboflavin synthase, alpha subunit [bacterium Ellin514]
          Length = 218

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 113/203 (55%), Gaps = 1/203 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSE-EHSV 59
           MFTGIV + G I  + P  K + L V        +KLG S++  G CLTVV++S  +   
Sbjct: 16  MFTGIVEETGTIERIKPSVKSIELVVRAKICARGLKLGESVSVNGCCLTVVKVSAVKKGG 75

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 ++  ET   TN+ S  +G+ +NLER++ +G RL GH V+GHIDGT  I+  +  
Sbjct: 76  GKLVHFDLLQETWNRTNLQSAKVGSLVNLERALAVGARLGGHFVTGHIDGTGRIIRWERS 135

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      ++ P  + +++  KGS+ ++G+SLTV  V K  F + +I HT E T  +   V
Sbjct: 136 GQDHVLEIAAPAEVMRYVIFKGSIAVDGISLTVAQVSKKSFRIWIIPHTFEVTALRERAV 195

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           GD +N+E D + +Y+ +  ++  
Sbjct: 196 GDAVNLEADLLGKYVHQFVSVRE 218


>gi|213965609|ref|ZP_03393803.1| riboflavin synthase, alpha subunit [Corynebacterium amycolatum
           SK46]
 gi|213951768|gb|EEB63156.1| riboflavin synthase, alpha subunit [Corynebacterium amycolatum
           SK46]
          Length = 195

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 68/199 (34%), Positives = 114/199 (57%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I  +   A  + L +  S     +  G SIA  G+CLTVV        D
Sbjct: 1   MFTGIVEELGEIREIHREADSITLTIRASTVLDDVHHGDSIAVNGVCLTVVEFG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  ++  ET   +++    +G+ +NLER+  +G RL GH+V GH+DGT +++      
Sbjct: 56  DFFNADLMQETLDRSSLGQVEVGSKVNLERATAVGQRLGGHIVQGHVDGTGKVISRTPGE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R+SLP  L +++  KGS+ ++G SLTV+ VG+ FF+V LI  T+ ++      VG
Sbjct: 116 RWEVVRISLPEQLSKYVVEKGSIAVDGTSLTVSAVGEGFFEVSLIPTTLTDSVIGSIAVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ ++  
Sbjct: 176 AKVNLEVDVLAKYVEKMLE 194


>gi|28210396|ref|NP_781340.1| riboflavin synthase subunit alpha [Clostridium tetani E88]
 gi|28202833|gb|AAO35277.1| riboflavin synthase alpha chain [Clostridium tetani E88]
          Length = 216

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 69/202 (34%), Positives = 110/202 (54%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  +        +++        + LG SI   G+CLTV   S+     
Sbjct: 1   MFTGIVEELGSIENIEKKGNAYSIKIKAKKVLEDVNLGDSICTNGVCLTVTNFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET R +N+ +   G+ +NLER++K   RL GH+VSGHIDG   I      G
Sbjct: 56  DSFTVDVMPETIRQSNLKNIKKGSLVNLERALKATGRLGGHIVSGHIDGEGIIKEYKKEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++ +  +     L +++  +GS+ L+GVSLTV  V +  F V +I +T E+TT     VG
Sbjct: 116 NAWWISVEPEKGLLKYVIERGSIALDGVSLTVAYVDEKLFKVSVIPNTSEKTTLLKKGVG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D++NIE D + +Y+ ++     
Sbjct: 176 DILNIECDLIGKYVEKILNFKN 197


>gi|308069555|ref|YP_003871160.1| riboflavin synthase subunit alpha [Paenibacillus polymyxa E681]
 gi|305858834|gb|ADM70622.1| Riboflavin synthase alpha chain [Paenibacillus polymyxa E681]
          Length = 221

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+I  ++   + M L +  S     +K+G S++  G+CLT +R+  +    
Sbjct: 1   MFTGLVEEVGRIQTISQSGEAMVLGISGSVVLGDLKIGDSVSVNGVCLTAIRIGTKD--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++V+V  ET R TN+     G+ +NLER++    R  GH+V GH+DGT  I  +    
Sbjct: 58  --FKVDVMPETFRSTNLKELRSGSRVNLERAMAASGRFGGHIVQGHVDGTGTIRGVTSDQ 115

Query: 121 DSMYCRLSLPHN-LEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++   +   +  L ++I +KGS+ ++G+SLTV     + F V +I HT+ ET  +  + 
Sbjct: 116 NAVVFEIEPKNQTLFKYILLKGSITIDGISLTVAQRTGDTFAVSIIPHTLSETALQAKRE 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GD +NIE D + +Y+ +L    
Sbjct: 176 GDTVNIECDILGKYVEQLLNYR 197


>gi|118467379|ref|YP_887387.1| riboflavin synthase subunit alpha [Mycobacterium smegmatis str. MC2
           155]
 gi|118168666|gb|ABK69562.1| riboflavin synthase, alpha subunit [Mycobacterium smegmatis str.
           MC2 155]
          Length = 199

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 112/199 (56%), Gaps = 4/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G ++    +    RL +     T+    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGVLVDKAELDDSARLTIRGPVVTADAGHGDSIAVNGVCLTVVDV----LPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++A   +G  +NLER+  +  RL GH+V GH+DGT  ++      
Sbjct: 57  GAFTADVMGETLNRSSLAGVAVGDRVNLERAAAVNSRLGGHIVQGHVDGTGSVISRTPHE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R++LP  L +++  KGS+ ++GVSLTV+ +G ++F++ LI  T E TT     VG
Sbjct: 117 HWEVVRIALPPALSRYVVEKGSITVDGVSLTVSAIGDDWFEISLIPTTRELTTLGTAPVG 176

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ RL +
Sbjct: 177 TTVNLEVDVIAKYVERLMS 195


>gi|110801688|ref|YP_697859.1| riboflavin synthase subunit alpha [Clostridium perfringens SM101]
 gi|110682189|gb|ABG85559.1| riboflavin synthase, alpha subunit [Clostridium perfringens SM101]
          Length = 217

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 118/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE D + +Y+ +L     
Sbjct: 176 DLVNIECDPIGKYVEKLLGFKK 197


>gi|209884996|ref|YP_002288853.1| riboflavin synthase, alpha subunit [Oligotropha carboxidovorans
           OM5]
 gi|209873192|gb|ACI92988.1| riboflavin synthase, alpha subunit [Oligotropha carboxidovorans
           OM5]
          Length = 202

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 91/199 (45%), Positives = 128/199 (64%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+TD+G+I+++TP A+G   RL +   Y+ + +  G SIA  G+CLTVVR S   +
Sbjct: 1   MFTGIITDVGEILSITPTAQGQLHRLHIGCHYDQTTIADGASIACNGVCLTVVR-SGVEA 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+E +  AET R+T    W  G+ +NLER++K+GD L GH+VSGH+DG   +   + 
Sbjct: 60  GRTWFEADAAAETLRLTTARDWTQGSHLNLERALKIGDELGGHIVSGHVDGIATVTLRED 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L  P +L +FIA KGSV L+G SLTVN    + F VL+I HT++ TT +  +
Sbjct: 120 LPDMARFELRAPRDLAKFIAAKGSVTLDGASLTVNTAVNDTFSVLIIPHTLQVTTLQSWQ 179

Query: 179 VGDLINIEVDSMMRYIARL 197
           VG  +NIE+D M RY ARL
Sbjct: 180 VGSEVNIEIDVMARYAARL 198


>gi|227549214|ref|ZP_03979263.1| riboflavin synthase [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078668|gb|EEI16631.1| riboflavin synthase [Corynebacterium lipophiloflavum DSM 44291]
          Length = 197

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 118/198 (59%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++A+T +   +R+ V      +  + G SIA  G+CLTVV      + D
Sbjct: 1   MFTGLVEEVGEVVALTKLDDSVRIAVRAPRVATDARHGDSIAVDGVCLTVVD-----TAD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + + S+  G+ +NLER++  G R+ GH+V GH+DG  ++L      
Sbjct: 56  GVFSADVMQETLDRSRLGSYVEGSRVNLERALAAGARMGGHIVQGHVDGVAQVLSRTASE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    R SLP  L +++  KGS+ +NG SLTV+ VG+++F+V LI  T+ +TT      G
Sbjct: 116 NWEVIRFSLPAGLARYVVEKGSITVNGTSLTVSAVGEDYFEVSLIPTTLTDTTASSLATG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           + +N+EVD + +Y+ ++ 
Sbjct: 176 ENVNLEVDIVAKYVEKMV 193


>gi|190569842|dbj|BAG48883.1| riboflavin synthase [Bartonella japonica]
          Length = 201

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 99/201 (49%), Positives = 131/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y    +++G SIA +GICLT+V         
Sbjct: 1   MFTGIITDIGCVEEVMSLEQGVRLNISTFYAIESLEIGASIACSGICLTIVERGIHQENR 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GTFINLERS++LGD + GHLVSGH+DG  EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTFINLERSLRLGDEMGGHLVSGHVDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGSV LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQIPTQFVPFIVNKGSVALNGTSLTVNSVENCIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+  AL 
Sbjct: 181 DQVNLEIDQLARYAAKFLALK 201


>gi|149914269|ref|ZP_01902800.1| riboflavin synthase, alpha subunit [Roseobacter sp. AzwK-3b]
 gi|149811788|gb|EDM71621.1| riboflavin synthase, alpha subunit [Roseobacter sp. AzwK-3b]
          Length = 195

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 90/201 (44%), Positives = 125/201 (62%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G++  +      +R R+ T Y+   + +G SIA  G+CLTVV         
Sbjct: 1   MFTGIITDVGQVRLVEMRGD-LRARIGTRYDMQSVDIGASIACDGVCLTVVDKG-----A 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN+  W  G  INLER++K+GD L GH+VSGH+DG  EI+ +   G
Sbjct: 55  DWFDVDISAETVSKTNVKGWTEGHRINLERALKVGDELGGHIVSGHVDGLAEIVAVRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT + TTW    VG
Sbjct: 115 DSTRVSLRAPEALAKFIAPKGSVALNGTSLTVNEVEGCTFGINFIPHTKQSTTWGQAAVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D++ RY+ARL  ++
Sbjct: 175 DAVNLEIDTLARYVARLQEMS 195


>gi|15614118|ref|NP_242421.1| riboflavin synthase subunit alpha [Bacillus halodurans C-125]
 gi|10174172|dbj|BAB05274.1| riboflavin synthase alpha subunit [Bacillus halodurans C-125]
          Length = 215

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 113/202 (55%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G I A+    + + + + +    S ++LG SIA  G+CLTV   +     D
Sbjct: 1   MFTGIIEDVGTIDAIQQTGEAIVMTITSKKIVSDVQLGDSIAVNGVCLTVTSFT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V++  ET R T++     G+ +NLER++    R  GH+VSGH+DG   I   +   
Sbjct: 56  TQFTVDLMPETVRATSLRLLSKGSRVNLERAMVANGRFGGHIVSGHVDGIGTIRKKERKD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L +++  KGSV ++G SLT+  V    F + +I HT+EET   + K G
Sbjct: 116 NAVYYTIEVSSSLRRYMIHKGSVAVDGTSLTIFDVSDKTFTISIIPHTMEETIIGLKKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D++NIE D + +YI +      
Sbjct: 176 DIVNIECDLIGKYIEQFVQQGK 197


>gi|269837994|ref|YP_003320222.1| riboflavin synthase, alpha subunit [Sphaerobacter thermophilus DSM
           20745]
 gi|269787257|gb|ACZ39400.1| riboflavin synthase, alpha subunit [Sphaerobacter thermophilus DSM
           20745]
          Length = 212

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 66/197 (33%), Positives = 108/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G + A+  +   + L +         +LG SIA  G+CLTV  L   H   
Sbjct: 1   MFSGIVEEVGTVAALGRVGGDVALTIRGRTVLEGTRLGDSIAVNGVCLTVADLDAGH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +   +   T R+TN+     G+ +NLERSV +G R+ GH V GHIDGT  ++     G
Sbjct: 58  --FVANLQPVTLRLTNLGDLSPGSPVNLERSVMVGGRIGGHYVQGHIDGTGRVVSQTPDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++  R++ P  + +++  +G + ++G SLT+  V  + F V L+ HT   TT    + G
Sbjct: 116 AAVVVRIATPPEIHRYLVPRGFIAVDGASLTIVEVLPDGFTVSLVTHTQHHTTLAHKRPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+EVD + +Y+ RL
Sbjct: 176 ERVNLEVDIIAKYVERL 192


>gi|85705015|ref|ZP_01036115.1| riboflavin synthase subunit alpha [Roseovarius sp. 217]
 gi|85670337|gb|EAQ25198.1| riboflavin synthase subunit alpha [Roseovarius sp. 217]
          Length = 195

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 128/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G+I A+      +R R+ T Y+T ++ +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGRIQAVEHRGD-LRARIGTGYDTGRIDIGASIACDGVCLTVVALGS----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W++V++ AET   TN++ W  G  +NLER++++GD L GH+VSGH+DG  E++ L   G
Sbjct: 55  DWFDVDISAETLSKTNLSGWDAGRRVNLERALRVGDELGGHIVSGHVDGLAEVVGLRDEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    +G
Sbjct: 115 DSTRVILRAPDALARFIAPKGSVALNGTSLTVNEVEGRDFGINFIPHTKAVTTWGDVALG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D+IN+E+D++ RY+ARL
Sbjct: 175 DMINLEIDTLARYVARL 191


>gi|291524229|emb|CBK89816.1| riboflavin synthase, alpha subunit [Eubacterium rectale DSM 17629]
          Length = 239

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  ++  A    L +      +  K+G SIA  GICLTV RL     + 
Sbjct: 1   MFTGIVEEVGTIDTISRGANSAVLTIRAEKVLAGTKVGDSIAVNGICLTVTRL-----MP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +++A+   G  +NLER++    R  GH+VSGH+DGT  I+ +    
Sbjct: 56  HAFTADVMHETLNRSSLANAMRGAHVNLERAMAADGRFGGHIVSGHVDGTGRIVEVKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGSV ++G+SLTV  V ++ F +  I HT+ +T  K  KVG
Sbjct: 116 NAIWYTIHAAPQLIRYIVEKGSVTIDGISLTVAKVAEDNFSISAIPHTVSQTVLKDRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            ++N+E D + +Y+ +L     S+
Sbjct: 176 AVVNLETDIIGKYVEKLLFKGQSE 199


>gi|78485743|ref|YP_391668.1| riboflavin synthase subunit alpha [Thiomicrospira crunogena XCL-2]
 gi|78364029|gb|ABB41994.1| riboflavin synthase, alpha subunit [Thiomicrospira crunogena XCL-2]
          Length = 221

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 124/203 (61%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G +  + P+    R+ +     + S +K+G SIA  G+CLT + L+     
Sbjct: 1   MFTGIIETEGFVSRIEPVNGDARMTIEVGKLDMSDVKIGDSIACNGVCLTAIELTP---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  +V +ET ++T + +  +G+ +NLE++++L DRL GHLVSGH+DG  ++L +   
Sbjct: 57  -SAYVADVSSETLKVTTLGALKVGSPVNLEKALRLQDRLGGHLVSGHVDGVGKVLSITQE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   ++  P  L ++IA KGS+C+NG+SLTVN V    FDV ++ HT +ETT K  +V
Sbjct: 116 ARSWRYQIEAPVALAKYIAGKGSICINGISLTVNQVDGCAFDVNIVPHTRQETTIKHFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           G  +N+EVD + RY+ R+ +   
Sbjct: 176 GTTVNLEVDLLARYLERMLSAPK 198


>gi|88811148|ref|ZP_01126404.1| riboflavin synthase subunit alpha [Nitrococcus mobilis Nb-231]
 gi|88791687|gb|EAR22798.1| riboflavin synthase subunit alpha [Nitrococcus mobilis Nb-231]
          Length = 206

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 111/199 (55%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G +   +P  +  RL +     +++ ++ G S+A  G CLT+V        
Sbjct: 1   MFTGIVQAVGTVRQASPYGQDRRLLIEPGDLDSNGLQPGDSLAVDGCCLTLVS-----KA 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + + V+V AET   T +     G  +NLE ++ L   L GHLVSGH+DG  E+L+    
Sbjct: 56  ADGFVVDVSAETLSRTTLGDLTAGNQVNLEPALTLSSALGGHLVSGHVDGVAELLWRSPA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G      L  P  L ++IA KGS+CL GVSLTVN V    F+V L+ HT++ TT    + 
Sbjct: 116 GRCERWCLRGPQRLARYIAEKGSICLAGVSLTVNAVAGAEFEVALVPHTLQVTTLGTRRP 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G+ +N+E+D + RY+ RL 
Sbjct: 176 GECMNLEIDLVARYLERLM 194


>gi|284045159|ref|YP_003395499.1| riboflavin synthase, subunit alpha [Conexibacter woesei DSM 14684]
 gi|283949380|gb|ADB52124.1| riboflavin synthase, alpha subunit [Conexibacter woesei DSM 14684]
          Length = 196

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 108/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G + A+ P A G+RL V T     ++  G S+A  G+CLT V        +
Sbjct: 1   MFTGLVQGLGTVAAVQPTADGVRLTVATELG-RELSPGDSVAVNGVCLTAVD-----PSN 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +++A    G  +NLE  ++  DRL GH+V GH+DG   I  L   G
Sbjct: 55  GTFAADVMNETLRRSSLAEIAPGAEVNLELPLRAHDRLGGHIVQGHVDGLGTIAELTDDG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   R++    L +++  KGS+ ++GVSLTV+ V      V LI  T+E T      VG
Sbjct: 115 FARIVRIAADPELLRYVVEKGSIAIDGVSLTVSAVDDESLSVSLIPETLERTILGSAAVG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+EVD + +Y+ +L   + 
Sbjct: 175 RPVNLEVDVLAKYVEKLVGAHR 196


>gi|238925476|ref|YP_002938993.1| riboflavin synthase, alpha subunit [Eubacterium rectale ATCC 33656]
 gi|238877152|gb|ACR76859.1| riboflavin synthase, alpha subunit [Eubacterium rectale ATCC 33656]
          Length = 239

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  ++  A    L +      +  K+G SIA  GICLTV RL     + 
Sbjct: 1   MFTGIVEEVGTIDTISRGANSAVLTIRAEKVLAGTKVGDSIAVNGICLTVTRL-----MP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +++A+   G  +NLER++    R  GH+VSGH+DGT  I+ +    
Sbjct: 56  HAFTADVMHETLNRSSLANAMRGAHVNLERAMAADGRFGGHIVSGHVDGTGRIVEVKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGSV ++G+SLTV  V ++ F +  I HT+ +T  K  KVG
Sbjct: 116 NAIWYTIHAAPQLIRYIVEKGSVTIDGISLTVAKVAEDNFSISAIPHTVSQTVLKDRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            ++N+E D + +Y+ +L     S+
Sbjct: 176 AVVNLETDIIGKYVEKLLFKGQSE 199


>gi|55981032|ref|YP_144329.1| riboflavin synthase subunit alpha [Thermus thermophilus HB8]
 gi|55772445|dbj|BAD70886.1| riboflavin synthase alpha chain [Thermus thermophilus HB8]
          Length = 194

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 110/199 (55%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G+I+ +      +R+ +        +K+G S+A  G CLT V + E     
Sbjct: 1   MFTGLVEETGEILKVEE-GPFLRVYIGARKVLEDLKVGDSVAVDGACLTAVAVEE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG   +  +    
Sbjct: 55  GGFWVELAQETLRRTAP-TWRVGHRPNLERALKVGDRLGGHFVTGHVDGVARLWEVREAP 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +       P  L  +IA KGSV LNGVSLTV  +    F V LI HT+E T     +VG
Sbjct: 114 GAKDFYFLPPKALAPYIAEKGSVALNGVSLTVAGLTGEAFWVTLIPHTLEVTNLGRLRVG 173

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY+ARL  
Sbjct: 174 DGVNLEVDLIARYVARLLG 192


>gi|313835936|gb|EFS73650.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL037PA2]
 gi|314927221|gb|EFS91052.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL044PA1]
 gi|314970654|gb|EFT14752.1| riboflavin synthase, alpha subunit [Propionibacterium acnes
           HL037PA3]
          Length = 204

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 75/203 (36%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG+++A+       RL +      S  +LG SIA  G CLT+  L E     
Sbjct: 6   MFTGIIEEIGEVLAIERGRDSARLAIRGPLVCSDARLGSSIAVNGTCLTITELDE----- 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +V AET   T +     G  +NLER V +GDRL GH+V GH+DGT E++      
Sbjct: 61  DFFGCDVMAETLNRTALGHLAAGIRVNLERPVSVGDRLGGHIVQGHVDGTAELVSRTPGD 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R ++P  L ++I  KGS+ +NG SLTV  V   +F+V LI  T+  T      +G
Sbjct: 121 HWEVFRFTVPTILSRYITEKGSIAINGTSLTVCAVTPEWFEVSLIPATLTGTVLGALTLG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+EVD + +Y+  L     S
Sbjct: 181 DEVNVEVDVIAKYLEALTNKERS 203


>gi|163789729|ref|ZP_02184166.1| riboflavin synthase subunit alpha [Carnobacterium sp. AT7]
 gi|159874951|gb|EDP69018.1| riboflavin synthase subunit alpha [Carnobacterium sp. AT7]
          Length = 217

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 118/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I A+        L++         ++G SI+  GICLTV ++      +
Sbjct: 1   MFTGIIEEMGTIQAIRRGENSSILKIKGQKVLQGTRIGDSISTNGICLTVTKIE-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +V +E+ + TNI     G+++NLER++ L  RL GH+VSGHIDGT +I  +    
Sbjct: 56  DSFDADVMSESLKRTNIGELAPGSYVNLERALSLETRLGGHMVSGHIDGTGKIREMKRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGS+ ++GVSLTV  V    F V +I HT EET     ++G
Sbjct: 116 NAVWITVETSPKLLRYIIEKGSIAIDGVSLTVVTVDNQSFKVSVIPHTGEETVLLRKQLG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y+ +L  L++
Sbjct: 176 DAVNLECDMIGKYVEKLLGLDS 197


>gi|170725744|ref|YP_001759770.1| riboflavin synthase subunit alpha [Shewanella woodyi ATCC 51908]
 gi|169811091|gb|ACA85675.1| riboflavin synthase, alpha subunit [Shewanella woodyi ATCC 51908]
          Length = 220

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +      +RL V +   +   ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERRGDDIRLTVASGKLDLGDVRLGDSIATNGVCLTVVEC-----M 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +G  +NLE++V    RL GH+VSGH+DG   +      
Sbjct: 56  SDGYVADISAETVSLTGFAHYQVGRKVNLEKAVTPTTRLGGHMVSGHVDGIASVDDRQLR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  N F + ++ HT  ETT    K 
Sbjct: 116 GKAIEFWLTAPAELARYIAHKGSITIDGVSLTVNEVQDNRFRLTIVPHTAGETTLVDMKA 175

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           GD +N+EVD + R++ RL + 
Sbjct: 176 GDTVNLEVDLIARHLERLMSY 196


>gi|15672976|ref|NP_267150.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723938|gb|AAK05092.1|AE006333_9 ribiflavin synthase alpha chain [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406538|gb|ADZ63609.1| riboflavin synthase alpha chain [Lactococcus lactis subsp. lactis
           CV56]
          Length = 216

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 67/197 (34%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++  +    K  ++ +  S     MKLG SI+  G+CLTV   +++    
Sbjct: 1   MFTGIIEELGEVSRLQKREKSFKISIRASLILEDMKLGDSISTNGLCLTVSEFNQKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  E+   +N+ +  +G  +NLER++ L  R  GH+VSGHIDG  +IL +    
Sbjct: 58  --FTADIMPESLNRSNLGTLNVGAKVNLERAMPLNGRFGGHIVSGHIDGVGQILEVKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    NL ++   KGS+ ++G+SLTV  V    F V +I HT++ET     KVG
Sbjct: 116 NAIWFEIKTSLNLMRYTVEKGSITIDGISLTVAQVKSKSFSVSIIPHTLKETIMADKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +YI +L
Sbjct: 176 DTVNLENDILGKYIEKL 192


>gi|303241093|ref|ZP_07327602.1| riboflavin synthase, alpha subunit [Acetivibrio cellulolyticus CD2]
 gi|302591353|gb|EFL61092.1| riboflavin synthase, alpha subunit [Acetivibrio cellulolyticus CD2]
          Length = 218

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/198 (37%), Positives = 112/198 (56%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IGKI  +   +K ++L +        +KLG SIA  GICLTV          
Sbjct: 1   MFTGIVEEIGKIRGIVHGSKSIKLAIQCDKIMDDVKLGDSIAVNGICLTVTEKGS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET R T + +  +G  +NLER+++L DRL GH+V+GHIDGT  ++      
Sbjct: 56  DQFTADVMPETMRKTGLENLKVGNSVNLERALRLVDRLGGHIVTGHIDGTGVLVDRAAED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    ++ ++I +KGSV L+G SLT+  +    F V LI  T   TT    +VG
Sbjct: 116 NAIWLTIEANPHILKYIIMKGSVALDGTSLTIAYIDDRCFKVSLIPFTAGVTTLGSKEVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             INIE D + +YI +L 
Sbjct: 176 SKINIECDMLGKYIEKLI 193


>gi|168210246|ref|ZP_02635871.1| riboflavin synthase, alpha subunit [Clostridium perfringens B str.
           ATCC 3626]
 gi|170711629|gb|EDT23811.1| riboflavin synthase, alpha subunit [Clostridium perfringens B str.
           ATCC 3626]
          Length = 217

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/202 (33%), Positives = 118/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTMTTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  + +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGKFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE D + +Y+ +L     
Sbjct: 176 DLVNIECDPIGKYVEKLLGFKK 197


>gi|152976520|ref|YP_001376037.1| riboflavin synthase subunit alpha [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025272|gb|ABS23042.1| riboflavin synthase, alpha subunit [Bacillus cytotoxicus NVH
           391-98]
          Length = 214

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  M      M+L +   +  S +K+G SIA  GICLT    +E H   
Sbjct: 1   MFTGIVEELGTVSTMKQSGDAMKLTIQARFILSDIKIGDSIAVNGICLTATSFTESH--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + T++      + +NLER++    R  GH V+GHIDGT  I+      
Sbjct: 58  --FTVDVMPETMKSTSLRMLKQHSQVNLERAMAANGRFGGHFVTGHIDGTGTIVSKKQHY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++ +P++L ++   KGS+ ++G SLT+  V  N   + LI HT+ E+     + G
Sbjct: 116 NAIYYKIKMPNHLLRYCLQKGSIAIDGTSLTIFDVDDNSITISLIPHTVSESIIGTKEAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI +  +  T +
Sbjct: 176 DIVNIECDMIGKYIEQFMSQPTKR 199


>gi|212638857|ref|YP_002315377.1| riboflavin synthase subunit alpha [Anoxybacillus flavithermus WK1]
 gi|212560337|gb|ACJ33392.1| Riboflavin synthase alpha chain [Anoxybacillus flavithermus WK1]
          Length = 215

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  M    + +   +        ++LG SIA  G+CLTV   +     D
Sbjct: 4   MFTGIIEEIGTIQQMKQTGEAIVFTIGAQKVLQDVQLGDSIAVNGVCLTVTSFT-----D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R T++ +  +G  +NLER++    R  GH VSGH+DG   I+    + 
Sbjct: 59  RLFTVDVMPETVRATSLRTLTVGAKVNLERAMAANGRFGGHFVSGHVDGIGRIVRKQPVA 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P +L +++ +KGSV ++G SLT+  +    F + LI HT E T     KVG
Sbjct: 119 NAVYYDIEVPSHLRKYMILKGSVAVDGTSLTIFGLTDRTFTISLIPHTREATILGAKKVG 178

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++NIE D + +Y+ +       
Sbjct: 179 DIVNIECDIIGKYVEQFVGGKRE 201


>gi|220912437|ref|YP_002487746.1| riboflavin synthase subunit alpha [Arthrobacter chlorophenolicus
           A6]
 gi|219859315|gb|ACL39657.1| riboflavin synthase, alpha subunit [Arthrobacter chlorophenolicus
           A6]
          Length = 226

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/208 (35%), Positives = 110/208 (52%), Gaps = 11/208 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ + G+++A+         +R+     T  + LG SIA  G+CLT   +  +   
Sbjct: 1   MFTGIIAEQGEVLAVERDGDTSATVRLRAPGTTEGLALGGSIAVNGVCLTATAIDGKE-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   + I     G  +NLER V  G RLDGH+V GH+DG   +L  +  
Sbjct: 59  ---FSVDVMGETLVRSTIGELAAGDAVNLERCVPAGGRLDGHVVQGHVDGVGVLLEREPQ 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTW 174
           G+    R  +P NL ++IA KGS+ ++GVSLTV  V      + +F+V LI  T+ ET  
Sbjct: 116 GNWERLRFGVPANLARYIAEKGSIAIDGVSLTVTAVSAATEEQPWFEVGLIPTTLAETGL 175

Query: 175 KMHKVGDLINIEVDSMMRYIARLYALNT 202
                G  +N+EVD + +Y  RL +  +
Sbjct: 176 GTKTTGSRVNLEVDVLAKYTERLLSFRS 203


>gi|310827883|ref|YP_003960240.1| riboflavin synthase [Eubacterium limosum KIST612]
 gi|308739617|gb|ADO37277.1| riboflavin synthase [Eubacterium limosum KIST612]
          Length = 212

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/204 (31%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G + ++   A    L +  +      + G SIA  G+CLT+   S     D
Sbjct: 1   MFTGIIEEMGTVKSIRRGAASSILTLGATTVLEDAREGDSIAVNGVCLTITDFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++ V+V  ET + ++++S   G  +NLER++    R  GH+V+GHIDGT +I  +    
Sbjct: 56  SYFTVDVMHETLKRSSLSSLHPGDAVNLERAMPATGRFGGHIVAGHIDGTGKITAVKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +   ++L ++I  KGS+ ++G+SLTV  +    F V +I HT++ TT      G
Sbjct: 116 NAIWYTIQASNDLLRYIVEKGSIAVDGISLTVAGITGKQFSVSVIPHTVKNTTLSQKGAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L      Q
Sbjct: 176 DCVNLENDCIGKYVEKLLGTAPQQ 199


>gi|288957858|ref|YP_003448199.1| riboflavin synthase alpha chain [Azospirillum sp. B510]
 gi|288910166|dbj|BAI71655.1| riboflavin synthase alpha chain [Azospirillum sp. B510]
          Length = 195

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G++ A+       R  + T+++T  + +G SIAH G+CLTV+         
Sbjct: 1   MFTGIITDVGRVRAVERQGDT-RFTIETAFDTETIAIGASIAHNGVCLTVIEKGP----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y ++   ET   T +  W  GT +NLER++K+GD L GH+VSGH+DG   ++ +   G
Sbjct: 55  GTYVIQASGETLSKTTLDGWEPGTRVNLERALKVGDELGGHIVSGHVDGVGRLVSVRPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S+      P  L ++IA KGSV ++GVSLTVN V  N F V +I HT   TT+     G
Sbjct: 115 ESLRLTFEAPATLAKYIASKGSVAIDGVSLTVNEVEGNRFGVNIIPHTQTATTFGGLTEG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D + RY+ARL
Sbjct: 175 DAVNLEIDMLARYVARL 191


>gi|253576365|ref|ZP_04853695.1| riboflavin synthase, alpha subunit [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251844258|gb|EES72276.1| riboflavin synthase, alpha subunit [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 241

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/203 (31%), Positives = 105/203 (51%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG + +++   + M L +     T  +KLG SI+  G+CLT           
Sbjct: 18  MFTGLVEEIGTMKSISRKGEAMILNISAKVVTEGIKLGDSISVNGVCLTATSFD-----A 72

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  +T R TN+     G+ +NLER++    R  GH+V GH+DG   I+      
Sbjct: 73  SSFTVDVMPQTFRNTNLKDLKPGSRVNLERAMAANGRFGGHIVQGHVDGVGTIVGTSQDQ 132

Query: 121 DSMYCRLSL-PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++   +     +L ++I  KGS+ ++G+SLTV       F V +I HT+ ET     + 
Sbjct: 133 NAVVFEIRPSKPSLFKYIIPKGSIAVDGISLTVVEAEGGTFTVSIIPHTLAETVLAFKRA 192

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           GD +N+E D + +Y+  L     
Sbjct: 193 GDTVNLECDVLGKYVDHLLKYGR 215


>gi|168214535|ref|ZP_02640160.1| riboflavin synthase, alpha subunit [Clostridium perfringens CPE
           str. F4969]
 gi|170714019|gb|EDT26201.1| riboflavin synthase, alpha subunit [Clostridium perfringens CPE
           str. F4969]
          Length = 217

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 120/202 (59%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKLSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE DS+ +Y+ +L   N 
Sbjct: 176 DLVNIECDSIGKYVEKLLGFNK 197


>gi|297584479|ref|YP_003700259.1| riboflavin synthase subunit alpha [Bacillus selenitireducens MLS10]
 gi|297142936|gb|ADH99693.1| riboflavin synthase, alpha subunit [Bacillus selenitireducens
           MLS10]
          Length = 219

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + GKI  M      + + +  S     + +G SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEKGKISQMKESGDAIVMTISGSKVLEDVHMGDSIAVNGVCLTVTGYT-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET R T++ + G G+ +NLER++    R  GH VSGH+DG   I       
Sbjct: 56  DTFSVDVMPETVRNTSLRNLGTGSSVNLERAMAANGRFGGHFVSGHVDGIGTIRSKKPEY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L  ++ +KGSV ++G SLT+  +    F + +I HT++ET       G
Sbjct: 116 NAVYYEIEVAEHLRDYMTMKGSVSVDGTSLTIFGLTDRTFTISIIPHTLDETVIGSKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +Y+  L     ++
Sbjct: 176 DIVNIECDMLAKYMDELLNRRFNK 199


>gi|38233904|ref|NP_939671.1| riboflavin synthase subunit alpha [Corynebacterium diphtheriae NCTC
           13129]
 gi|38200165|emb|CAE49846.1| riboflavin synthase alpha chain [Corynebacterium diphtheriae]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 66/207 (31%), Positives = 113/207 (54%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG I  M      + L +        +K G SI+  G+CLTVV         
Sbjct: 1   MFTGLIEEIGTITGMEEQGDSLVLSISAPALMVDVKQGDSISVNGVCLTVVICD-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   +++     G+++NLER+++   R+ GH+V GH+DGT  +L  D   
Sbjct: 56  TGFTADVMRESLDRSSLGQLRTGSYVNLERAMRADARMGGHIVQGHVDGTGVLLSRDHSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
                R SLP ++ Q++  KGS+ ++G SLTV+ +       ++F+V LI  T+E TT  
Sbjct: 116 HWDVLRFSLPADISQYVVEKGSIAVDGTSLTVSSISEPLAENHWFEVSLIPTTLEHTTLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNT 202
             K+ +++N+EVD + +Y+ R+ A + 
Sbjct: 176 ELKLREVVNLEVDIVGKYVERMLAGHK 202


>gi|108758043|ref|YP_632925.1| riboflavin synthase subunit alpha [Myxococcus xanthus DK 1622]
 gi|108461923|gb|ABF87108.1| riboflavin synthase, alpha subunit [Myxococcus xanthus DK 1622]
          Length = 220

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 83/202 (41%), Positives = 113/202 (55%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D+G++  + P      L + TS   +  +LG SIA  G CLTVV  +      
Sbjct: 1   MFTGLIQDLGRVERVIP-GGMTDLWIHTSLGAAAFELGESIAVNGACLTVVERT-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+   ET R T + S   G  +NLER++ LGDRL GHLVSGH+D   E+L     G
Sbjct: 55  DSFRVQAAPETLRRTTLGSVKPGDQVNLERALALGDRLGGHLVSGHVDAVSEVLETYPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S      LP  L  +   KGSV ++G+SLTVN V  + F V LI  T E TT K   VG
Sbjct: 115 GSWVMGFRLPEELAPYFIEKGSVAIDGISLTVNTVEADRFRVQLIPETQERTTLKARGVG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+E D + +Y+ARL+AL  
Sbjct: 175 SKVNLEADQIGKYVARLFALQR 196


>gi|282890460|ref|ZP_06298983.1| hypothetical protein pah_c022o023 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499457|gb|EFB41753.1| hypothetical protein pah_c022o023 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 212

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 84/198 (42%), Positives = 116/198 (58%), Gaps = 1/198 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G I  M    KGMR+ +      S  K+G SIA  G CLTV+ ++ + S  
Sbjct: 1   MFTGLIEEMGIIRNMIATEKGMRIEINAELVLSDAKIGDSIAVNGCCLTVIEITSDSSGT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+  +   ET + T++    IG  +NLERSVKL DRL GHLV GH+DG   I  +  + 
Sbjct: 61  QWWAADAVKETLQRTSLQQLKIGDAVNLERSVKLNDRLGGHLVQGHVDGIGTIETIRALP 120

Query: 121 D-SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           D S    ++ P NL ++I  KGS+ L+GVSLTV LV    F V LI HT   TTW   K 
Sbjct: 121 DGSHEFVIAPPQNLLRYIVEKGSITLDGVSLTVCLVNHRSFSVTLIPHTKAVTTWGQKKT 180

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + +Y+ +L
Sbjct: 181 GMFVNVEVDLLAKYMEKL 198


>gi|213691300|ref|YP_002321886.1| riboflavin synthase, alpha subunit [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|296453533|ref|YP_003660676.1| riboflavin synthase subunit alpha [Bifidobacterium longum subsp.
           longum JDM301]
 gi|213522761|gb|ACJ51508.1| riboflavin synthase, alpha subunit [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|296182964|gb|ADG99845.1| riboflavin synthase, alpha subunit [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 209

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/202 (33%), Positives = 112/202 (55%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +   A    L V  +     + +G S+A  GICLTVV         
Sbjct: 1   MFTGIVEEVGTVADIRRSAANCTLSVDATNVMEDLHIGDSMAVNGICLTVVDFDRRR--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R T++     G+ +NLER++ +  R  GH+V+GHIDGT  I  +   G
Sbjct: 58  --FTVDVMNETWRRTSLGVLRHGSGVNLERALPVNGRFGGHIVTGHIDGTGSISSVRREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ R++  + + + I  KGS+ ++G+SLTV  V +  F V +I HT+ +T     +VG
Sbjct: 116 NAVWYRIAARNEILEGIVEKGSIAVDGISLTVAEVTERDFSVSIIPHTLAQTVLGEKRVG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
            ++N+E D + +Y+  +    T
Sbjct: 176 GVVNLENDVLGKYVRNMMTTRT 197


>gi|111024119|ref|YP_707091.1| riboflavin synthase subunit alpha [Rhodococcus jostii RHA1]
 gi|110823649|gb|ABG98933.1| riboflavin synthase alpha subunit [Rhodococcus jostii RHA1]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/206 (35%), Positives = 115/206 (55%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A   +A   R  V     TS    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGEVVAKEELADAARFTVRGPVVTSDASHGDSIAVNGVCLTVVEV----LAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++    +G+ +NLER+  L  RL GHLV GH+DGT  I+      
Sbjct: 57  GSFTADVMQETLNRSSLQKIDVGSRVNLERAAALNSRLGGHLVQGHVDGTGHIISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVN----LVGKNFFDVLLIRHTIEETTWKM 176
           +    R++LP  + +++  KGS+ ++GVSLTV+      G+ +F++ LI  T++ TT   
Sbjct: 117 NWEVVRIALPDAISRYVVEKGSITVDGVSLTVSALGGERGEEYFEISLIPTTLQLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLYALNT 202
             VG  +N+EVD + +Y+ RL A   
Sbjct: 177 ASVGTPVNLEVDVIAKYVERLQAAGR 202


>gi|322381772|ref|ZP_08055726.1| riboflavin synthase subunit alpha-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154160|gb|EFX46482.1| riboflavin synthase subunit alpha-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 221

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 108/201 (53%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  +    + + L +        + LG SIA  G+CLTVV   ++    
Sbjct: 1   MFTGIIEEIGTMRRIDRQGQALILTIGAKKILEDIHLGDSIAVNGVCLTVVAFQDQE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R TN+A    G+ +NLER+++ G R  GH+V GH+DGT  ++  D   
Sbjct: 58  --FSVDVMPETFRSTNLAKLKTGSRVNLERAMQAGGRYGGHIVQGHVDGTAVVIGKDREE 115

Query: 121 DSMYCRLSL-PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++  R       L ++I  KGS+ ++G+SLTV    +  F V +I HT+ ET       
Sbjct: 116 NAVVYRFRPLTGRLTRYIIPKGSITIDGISLTVVDTKEGTFSVSIIPHTLAETILNDKGP 175

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           GD +NIE D + +YI     +
Sbjct: 176 GDTVNIECDIIGKYIEHFLKV 196


>gi|305680981|ref|ZP_07403788.1| riboflavin synthase, alpha subunit [Corynebacterium matruchotii
           ATCC 14266]
 gi|305659186|gb|EFM48686.1| riboflavin synthase, alpha subunit [Corynebacterium matruchotii
           ATCC 14266]
          Length = 193

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 66/200 (33%), Positives = 108/200 (54%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GI+ +IG I  +TP     +L +  +  T+ +  G SIA  GICLTVV         
Sbjct: 1   MFSGIIEEIGTITTITPRGDSCKLHITAATVTTDIHPGDSIAVNGICLTVVDHDP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +    +G  +NLER++ +  RL GH+V GH+D T  ++  +   
Sbjct: 56  TGFTADVMKETLDRSVLGH--VGDPVNLERALPVTGRLGGHIVQGHVDTTTTLIHREIGE 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R  LP  L +++  KGS+ +NG SLTV+ +G ++F+V LI  T+  T     + G
Sbjct: 114 HWHTLRFHLPPQLAKYVVEKGSIAINGTSLTVSAIGDDYFEVSLIPTTLTHTNLGTLQPG 173

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+E D + +++ +L A 
Sbjct: 174 DSVNLEADILAKHVEKLLAH 193


>gi|304312169|ref|YP_003811767.1| Riboflavin synthase, alpha subunit [gamma proteobacterium HdN1]
 gi|301797902|emb|CBL46124.1| Riboflavin synthase, alpha subunit [gamma proteobacterium HdN1]
          Length = 219

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/198 (38%), Positives = 116/198 (58%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +       +L V T   +   ++LG SIA +G+CLTV  L     +
Sbjct: 1   MFTGIIEAVGHISRIDRKGGDWQLTVKTGKLDLGDVRLGDSIAVSGVCLTVTAL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++ +V  ET   T       G+ +NLE+++ L  RL GHLVSGH+DG  E++     
Sbjct: 56  SDGFQADVSNETLACTAFRDLKAGSRVNLEKALTLAARLGGHLVSGHVDGVGEVINRSED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G S+   +  P++L ++IA KGS+C+NGVSLTVN V  + F + +I HT  ETT +  + 
Sbjct: 116 GRSIRLEIRAPNSLARYIAEKGSICVNGVSLTVNSVNGDCFGLNVIPHTAAETTVEEWRT 175

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ RL
Sbjct: 176 GASLNLEVDLIARYLERL 193


>gi|58428071|gb|AAW77108.1| riboflavin synthase alpha chain [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 332

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTVV        
Sbjct: 133 MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAAS-- 190

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 191 ---FQADASTETLSLTTLGALPEGALLNLERAMRPIDRLGGHLVSGHVDGLGQVQSVHDD 247

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V +  F+  LI HT+  T +    V
Sbjct: 248 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEEGFEAALIPHTMANTAFAQTAV 307

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 308 GATVNLEIDLVARYVERLLGTR 329


>gi|84625290|ref|YP_452662.1| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|122879294|ref|YP_202493.6| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188575266|ref|YP_001912195.1| riboflavin synthase subunit alpha [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84369230|dbj|BAE70388.1| riboflavin synthase alpha chain [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519718|gb|ACD57663.1| riboflavin synthase, alpha subunit [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 200

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G++ A  P    +R    T       ++LG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEGVGQLAARQPQGGDVRFTFATGTLPFESVQLGESIAVNGVCLTVVAFDAAS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG  ++  +   
Sbjct: 59  ---FQADASTETLSLTTLGALPEGALLNLERAMRPIDRLGGHLVSGHVDGLGQVQSVHDD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  + +++A KGS+C++GVSLTVN V +  F+  LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPPAVLRYVAKKGSICVDGVSLTVNEVDEEGFEAALIPHTMANTAFAQTAV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+E+D + RY+ RL    
Sbjct: 176 GATVNLEIDLVARYVERLLGTR 197


>gi|169659022|dbj|BAG12720.1| riboflavin synthase [Bartonella grahamii]
          Length = 205

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 100/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+RL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDVQSLKKGVRLKISTRYAIESLAIGASIACSGICLTIVERGFKQEDS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFVVEAWEETLRLTNLAQWTTGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN +    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFYLKVSRQFMPFIVNKGSIALNGTSLTVNGIEDCVFDVLIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           +LIN+E+D + RY A+L  L 
Sbjct: 181 NLINLEIDQLARYAAKLLTLK 201


>gi|255528572|ref|ZP_05395346.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
 gi|296188129|ref|ZP_06856521.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
 gi|255507737|gb|EET84203.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
 gi|296047255|gb|EFG86697.1| riboflavin synthase, alpha subunit [Clostridium carboxidivorans P7]
          Length = 217

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 72/198 (36%), Positives = 118/198 (59%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I++++      ++ +        +KLG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGRILSISKGINSAQINIEAKKVLEDVKLGDSIAVNGVCLTVTSFK-----H 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +++ +   G+ +NLER++ LGDRL GH+VSGHID T +++ +    
Sbjct: 56  NSFTVDVMPETMRRSSLNNLKKGSLVNLERALALGDRLGGHIVSGHIDCTGKVVNIKNED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +  + +P +  ++I +KGS+ ++GVSLTV  V +  F V LI HT  ETT     +G
Sbjct: 116 IATWITVEVPDDALKYIVLKGSITIDGVSLTVAEVNEKSFSVSLIPHTKGETTLYEKNLG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           + +NIE D + +Y+ RL 
Sbjct: 176 EEVNIECDLIGKYVERLV 193


>gi|295093778|emb|CBK82869.1| riboflavin synthase, alpha subunit [Coprococcus sp. ART55/1]
          Length = 227

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 104/198 (52%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  +        + V         ++G SIA  G+CLT   +S      
Sbjct: 1   MFTGIVEEIGTIRKIDKGVSSCSITVQADKVLHGSQVGDSIAVNGVCLTATGIS-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET R + +     G+ +NLER++  G R  GH+VSGHIDGT  I  L    
Sbjct: 56  NIFTADVMPETLRRSGLGQLTGGSRVNLERAMAAGGRFGGHIVSGHIDGTGTIRELKRED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGS+ ++G+SLTV  V    F V +I HT  ETT    K G
Sbjct: 116 NAVWVTIDCSPKILRYIIEKGSIAIDGISLTVAYVDDTCFKVSIIPHTAGETTLLDGKPG 175

Query: 181 DLINIEVDSMMRYIARLY 198
            ++N+E D + +Y+ +L 
Sbjct: 176 KVVNLENDVVGKYVEKLL 193


>gi|126733194|ref|ZP_01748941.1| riboflavin synthase subunit alpha [Roseobacter sp. CCS2]
 gi|126716060|gb|EBA12924.1| riboflavin synthase subunit alpha [Roseobacter sp. CCS2]
          Length = 198

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 93/197 (47%), Positives = 126/197 (63%), Gaps = 3/197 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIGK++ +      +R R+ T Y+   + +G SIA  G+CLTV+ L    +  
Sbjct: 1   MFTGIITDIGKVLELEQRGD-LRARIGTGYDIGGIDIGASIACNGVCLTVIALG--SAPQ 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW++VE+ AET   TN+  W +G  +NLER++K+GD L GH+VSGH+DG  E++ +   G
Sbjct: 58  NWFDVEISAETVGATNVGDWALGVRLNLERALKVGDELGGHIVSGHVDGVAEVVAMTDEG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS       P +L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    VG
Sbjct: 118 DSTRVTFRTPGDLAKFIAPKGSVALNGTSLTVNEVDGVDFGINFIPHTKAATTWGDTSVG 177

Query: 181 DLINIEVDSMMRYIARL 197
           D IN+E+D+M RY+ARL
Sbjct: 178 DHINLEIDTMARYVARL 194


>gi|46199006|ref|YP_004673.1| riboflavin synthase subunit alpha [Thermus thermophilus HB27]
 gi|46196630|gb|AAS81046.1| riboflavin synthase alpha chain [Thermus thermophilus HB27]
          Length = 194

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 110/199 (55%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G+I+ +      +R+ +        +K+G S+A  G CLT V + E     
Sbjct: 1   MFTGLVEETGEILKVEE-GPFLRVYIAARKVLEDLKVGDSVAVDGACLTAVAVEE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG   +  +    
Sbjct: 55  GGFWVELAQETLRRTAP-TWRVGHRPNLERALKVGDRLGGHFVTGHVDGVARLWEVREAP 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +       P  L  +IA KGSV LNGVSLTV  +    F V LI HT+E T     +VG
Sbjct: 114 GAKDFYFLPPKALAPYIAEKGSVALNGVSLTVAGLAGEAFWVTLIPHTLEVTNLGRLRVG 173

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY+ARL  
Sbjct: 174 DGVNLEVDLIARYVARLLG 192


>gi|46446525|ref|YP_007890.1| riboflavin synthase subunit alpha [Candidatus Protochlamydia
           amoebophila UWE25]
 gi|46400166|emb|CAF23615.1| probablep riboflavin synthase alpha chain [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 201

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/199 (34%), Positives = 109/199 (54%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G +  +     G+R ++  S     +K+G SI  +G CLTVV   ++    
Sbjct: 1   MFTGLVEEVGCLTKIEKRGDGIRFQIEASKILEDIKIGDSINVSGCCLTVVEYFKQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++ AET + T      IG F+NLER++K  DRL GHLV GHID    I+    + 
Sbjct: 58  --FSCDLVAETLQRTYFHHLSIGDFVNLERAIKYSDRLGGHLVQGHIDDIGRIISYSTLE 115

Query: 121 DS-MYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
               +  + +   L +++  KGS+ ++GVSLT+  +G + F   +I HT + T       
Sbjct: 116 GGAYWVTIKISPPLLRYVVHKGSITIDGVSLTIAEIGASHFSFAMIPHTGQCTILGRKGK 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           GDL+N+EVD M +YI +L 
Sbjct: 176 GDLVNVEVDLMAKYIEKLM 194


>gi|148261111|ref|YP_001235238.1| riboflavin synthase subunit alpha [Acidiphilium cryptum JF-5]
 gi|146402792|gb|ABQ31319.1| riboflavin synthase, alpha subunit [Acidiphilium cryptum JF-5]
          Length = 204

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 116/208 (55%), Gaps = 13/208 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAK--GMRLRVMTSYNTSK------MKLGCSIAHAGICLTVVR 52
           MFTGI+T +G +  + P       RL +              + LG SIA +G CLTVV 
Sbjct: 1   MFTGIITGVGDVRDVRPADSVSDTRLVIGVPAGNPDWAGIGEVALGASIACSGCCLTVVE 60

Query: 53  LSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVE 112
                   +W+ VEV  ET   T + +W  GT INLER++++GD L GH+VSGH+DG  E
Sbjct: 61  RGP-----DWFAVEVSGETLSKTTLGAWRTGTRINLERALRMGDELGGHVVSGHVDGLGE 115

Query: 113 ILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
           ++ +   G S   R  +   L +FIA KGSV +NGVSLTVN V    F V +I HT   T
Sbjct: 116 VVSMRPEGGSTRWRFRVSRELARFIAPKGSVAVNGVSLTVNEVDGTEFGVNIIPHTETHT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYAL 200
            +    VGD +NIE+D + RY+ARL  +
Sbjct: 176 NFATLAVGDAVNIEIDMLARYVARLAEV 203


>gi|313200418|ref|YP_004039076.1| riboflavin synthase subunit alpha [Methylovorus sp. MP688]
 gi|312439734|gb|ADQ83840.1| riboflavin synthase, alpha subunit [Methylovorus sp. MP688]
          Length = 235

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +  +   ++L +  T+ N   + +G SI   G+CLT V LS  H  
Sbjct: 35  MFTGIIQAVGRIEKVDTLGSDVKLTIDATALNLGDVAIGDSICVNGVCLTAVSLSPSH-- 92

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++  V  ET   T          +NLE++++  DRL GH+VSGH+DG  +++  +  
Sbjct: 93  ---FQAHVSRETLNCTVGLDNVKP--VNLEKALRFSDRLGGHIVSGHVDGVGQVVRFEPA 147

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD M   +  PH + ++IA+KGS+ ++GVSLTVN V  + F V LI HTIE T  K   V
Sbjct: 148 GDCMLLAVRAPHAISRYIAIKGSITIDGVSLTVNSVDGDVFSVNLIPHTIEVTALKSLGV 207

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ R+    T 
Sbjct: 208 GSRVNLEVDMIARYVERMAQWKTE 231


>gi|218781152|ref|YP_002432470.1| riboflavin synthase, alpha subunit [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762536|gb|ACL05002.1| riboflavin synthase, alpha subunit [Desulfatibacillum alkenivorans
           AK-01]
          Length = 219

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 64/204 (31%), Positives = 110/204 (53%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G +  +    +G+ +++   ++ + +KLG SIA +G CLT  RL       
Sbjct: 1   MFTGIIEGLGTLKRINK-GRGVTMQIQADFDLTGVKLGDSIAVSGTCLTATRLD-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++V+V  ET   + +     G  +NLE+++    RLDGHLV GH+DG   +  +    
Sbjct: 55  STFDVDVSPETISRSILNWAKPGDRVNLEKALTFASRLDGHLVQGHVDGIATVASVKADA 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++      P +L  ++  KGSV ++G+SLT+N      F V +I HT + TT  + K G
Sbjct: 115 NAILYSFEAPSSLTYYMVEKGSVAIDGISLTINQRSDTGFSVSIIPHTAKITTIGLRKPG 174

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIE D + +Y+    +    +
Sbjct: 175 DRVNIETDIIGKYVEHFLSATRGE 198


>gi|307244583|ref|ZP_07526687.1| riboflavin synthase, alpha subunit [Peptostreptococcus stomatis DSM
           17678]
 gi|306491964|gb|EFM64013.1| riboflavin synthase, alpha subunit [Peptostreptococcus stomatis DSM
           17678]
          Length = 218

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 111/202 (54%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  ++  A    L +  S     + LG SIA  G+CLTV          
Sbjct: 1   MFTGIVEEIGSIKGISKGANSAVLTLSASKVLEDVNLGDSIAVNGVCLTVTSY-----RQ 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET   ++++S   G+ +NLER++    R  GH+VSGHIDGT +IL +    
Sbjct: 56  DEFTVDVMHETMDRSSLSSLKAGSKVNLERAMMANGRFGGHIVSGHIDGTGKILSVKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ ++S    + ++I  KGS+ ++G+SLTV  V    F + +I HT+E T       G
Sbjct: 116 NAIWYQISADKKILKYIIEKGSITVDGISLTVARVTDRDFSLSIIPHTLENTILAYKSEG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
            ++N+E D + +Y+ +L     
Sbjct: 176 HIVNLENDCIAKYVEKLMNFGN 197


>gi|34391422|gb|AAM77482.1| riboflavin synthase [Bartonella taylorii]
          Length = 205

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 128/201 (63%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  + P+ +G+RL + T Y    ++LG SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQPLKQGVRLNITTRYAIESLELGASIACSGICLTIVERGSKQADT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLER ++LGD + GHLV GHIDG  EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTSINLERPLRLGDEVGGHLVFGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAVRFFLQIPTRFTSFIVNKGSIALNGTSLTVNCVEDCIFDVLIIRHTLEMTTWGQAQIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D   RY A+     
Sbjct: 181 DQVNLEIDQFARYAAKFSGFK 201


>gi|257063445|ref|YP_003143117.1| riboflavin synthase, alpha subunit [Slackia heliotrinireducens DSM
           20476]
 gi|256791098|gb|ACV21768.1| riboflavin synthase, alpha subunit [Slackia heliotrinireducens DSM
           20476]
          Length = 223

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 109/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  + P A+  ++ +  S      ++G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEEMGTVRRVLPGARAGKITIGASKVLGGTQIGDSIAVNGVCLTVVEMG-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   + +     G  +NLER++    R  GH+VSGHIDGT  I  +    
Sbjct: 56  DSFVADVMPETLSKSGLGQLKTGDKVNLERAMAADGRFGGHIVSGHIDGTGRIAEMRPDQ 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+S P  +   I  KGS+ ++G+SLTV  V    F V LI HT EETT    + G
Sbjct: 116 NAVRVRISAPAGILALIVEKGSIAIDGISLTVASVSATDFQVSLIPHTGEETTLLKKRAG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D++N+E D + +Y+ +L  
Sbjct: 176 DIVNLENDVVGKYVQKLLG 194


>gi|315924111|ref|ZP_07920337.1| riboflavin synthase subunit alpha [Pseudoramibacter alactolyticus
           ATCC 23263]
 gi|315622513|gb|EFV02468.1| riboflavin synthase subunit alpha [Pseudoramibacter alactolyticus
           ATCC 23263]
          Length = 214

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 109/198 (55%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+I  + P AK   L V          +G SI  +G+CLTV R+       
Sbjct: 1   MFTGLVEEVGRISRIQPGAKSCILTVDCQTVLEDTAVGDSIMTSGVCLTVTRMD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V +ET   + + S  IG+ +NLER++    R  GH+V+GHID T  I  +    
Sbjct: 56  HSFTADVMSETLNRSALKSLKIGSAVNLERAMPADGRFGGHMVAGHIDDTGMITAIRQDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  ++ P  + ++I  KGS+ ++G+SLTV  V    F V +I HT E T     K G
Sbjct: 116 NAVWYTVAAPPAVLRYIIAKGSIAMDGISLTVAQVDDKGFAVSVIPHTREVTALADKKTG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +YI +L 
Sbjct: 176 DAVNLECDMVGKYIEKLM 193


>gi|226366359|ref|YP_002784142.1| riboflavin synthase subunit alpha [Rhodococcus opacus B4]
 gi|226244849|dbj|BAH55197.1| riboflavin synthase alpha chain [Rhodococcus opacus B4]
          Length = 202

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/206 (35%), Positives = 114/206 (55%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++A   +A   R  V     TS    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGEVVAKEELADAARFTVRGPVVTSDASHGDSIAVNGVCLTVVEV----LAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++    +G+ +NLER+  L  RL GHLV GH+DGT  I+      
Sbjct: 57  GSFTADVMQETLNRSSLEKIDVGSRVNLERAAALNSRLGGHLVQGHVDGTGHIISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVN----LVGKNFFDVLLIRHTIEETTWKM 176
           +    R++LP  + +++  KGS+ ++GVSLTV+      G  +F++ LI  T++ TT   
Sbjct: 117 NWEIVRIALPDAISRYVVEKGSITVDGVSLTVSALGGERGAEYFEISLIPTTLQLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLYALNT 202
             VG  +N+EVD + +Y+ RL A   
Sbjct: 177 ASVGTPVNLEVDVIAKYVERLQAAGR 202


>gi|153855731|ref|ZP_01996745.1| hypothetical protein DORLON_02763 [Dorea longicatena DSM 13814]
 gi|149751954|gb|EDM61885.1| hypothetical protein DORLON_02763 [Dorea longicatena DSM 13814]
          Length = 217

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G +  M    +   L V       + K+G SIA  G+CLTV  L       
Sbjct: 1   MFTGIVEEKGSVRYMQLTGESGVLAVKAKKVLERTKIGDSIAVNGVCLTVTSLQP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET R +++ S  +G+ +NLER++    R  GH+VSGHIDGT  I  L    
Sbjct: 56  DGFTADVMAETIRRSSLGSCKVGSQVNLERAMAADGRFGGHIVSGHIDGTGVIRSLTREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     +   I  KGS+C++G+SLTV  V +  F V +I HT EETT      G
Sbjct: 116 NAIWVSIGTSPQILHLIVEKGSICIDGISLTVAKVEEEGFQVSVIPHTGEETTLLEKVPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ RL  L  S+
Sbjct: 176 DSVNLENDVIGKYVERLLGLGKSE 199


>gi|260426229|ref|ZP_05780208.1| riboflavin synthase, alpha subunit [Citreicella sp. SE45]
 gi|260420721|gb|EEX13972.1| riboflavin synthase, alpha subunit [Citreicella sp. SE45]
          Length = 195

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 96/201 (47%), Positives = 131/201 (65%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I A+      +  R+ TSY+T+ + LG SIA  G+CLTVV L      D
Sbjct: 1   MFTGIVTDMGEIRALQQAGD-LTARIGTSYDTAGIDLGASIACDGVCLTVVDLG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+EV++ AET   TN+ SW  G  INLER++++GD L GH+VSGH+DG  E++ +   G
Sbjct: 55  DWFEVQISAETLSKTNLGSWAEGRRINLERALRVGDELGGHIVSGHVDGLAEVISIADEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS   +   P  L +FIA KGSV LNG SLTVN V    F + +I HT + TTW     G
Sbjct: 115 DSTRIQFRAPDALAKFIAPKGSVALNGTSLTVNEVQGAVFGINVIPHTKDATTWGQVGEG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D+M RY+ARL  ++
Sbjct: 175 DKVNLEIDTMARYVARLAEMS 195


>gi|300312949|ref|YP_003777041.1| riboflavin synthase subunit alpha [Herbaspirillum seropedicae SmR1]
 gi|300075734|gb|ADJ65133.1| riboflavin synthase (alpha chain) protein [Herbaspirillum
           seropedicae SmR1]
          Length = 206

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 123/212 (58%), Gaps = 16/212 (7%)

Query: 1   MFTGIVTDIGKIIAMTPI----AKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  IG I ++TP+      G+RL +   S   + + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAIGTITSVTPLAAGPDAGVRLTIDAGSLPMADVGLGDSIALNGACMTVVEKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                N + V+V  E+ R+T  A       +NLE+++ L +RL GHLVSGH+DG  ++  
Sbjct: 60  ----ANGFTVDVSRESLRLT--AGLDAPGEVNLEKALTLAERLGGHLVSGHVDGLGQVHS 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
            + +G+S    +  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FEPVGESRELIVDAPKALGKYLAYKGSIVVNGVSLTVNRVEDLAEACRFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
           TT+K  K G  +N+E+D + RY+ R+ + + +
Sbjct: 174 TTFKHLKAGSKVNLEIDLIARYVERMLSSSQA 205


>gi|190569849|dbj|BAG48886.1| riboflavin synthase [Bartonella silvatica]
          Length = 204

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 94/204 (46%), Positives = 130/204 (63%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL + T Y    +++G SIA +GICLTVV    +    
Sbjct: 1   MFTGIITDIGCVEEVQSLKQGVRLNISTRYAVQSLEIGASIACSGICLTVVERGSKQMNM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN++ W  GT+INLERS+K GD + GH VSGH+DG  EI+     G
Sbjct: 61  SWFVVEAWEEALRLTNLSQWTKGTYINLERSLKFGDEVGGHFVSGHVDGLAEIIDQKKEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN V    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPKRFASFIVNKGSIALNGTSLTVNNVDDCIFDVLIIRHTLEVTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E+D   RY A+   +  ++
Sbjct: 181 DCVNLEIDQFARYAAKFSGIFNTE 204


>gi|325294791|ref|YP_004281305.1| riboflavin synthase, alpha subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065239|gb|ADY73246.1| riboflavin synthase, alpha subunit [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 201

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/201 (31%), Positives = 113/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++++   ++   L++     T  +K+G SI+  G+CLTVV   +     
Sbjct: 1   MFTGLVEEVGRVLSLKKSSQSAVLKIGCQKITEDIKIGDSISVNGVCLTVVSFEK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +    +V AET R +NI       F+NLER+++  DRL GH++ GH+D   +++ +   G
Sbjct: 56  DSVTFDVSAETLRRSNIGILKTNDFVNLERALRFSDRLGGHILQGHVDTITKVVGIKREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                   LP      +  KGS+ ++G+SLT+  +  + F V +I HT + TT K  K G
Sbjct: 116 TGFLFSFKLPPAYRHLVVEKGSIGIDGISLTIATLFADTFSVAVIPHTYKNTTLKFRKPG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D++N+E D + +Y+ ++  + 
Sbjct: 176 DIVNLEFDIIGKYVEKMLRIQ 196


>gi|322377270|ref|ZP_08051762.1| riboflavin synthase, alpha subunit [Streptococcus sp. M334]
 gi|321281983|gb|EFX58991.1| riboflavin synthase, alpha subunit [Streptococcus sp. M334]
          Length = 211

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQA--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKLNFSVSVIPHTLEQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|237654562|ref|YP_002890876.1| riboflavin synthase subunit alpha [Thauera sp. MZ1T]
 gi|237625809|gb|ACR02499.1| riboflavin synthase, alpha subunit [Thauera sp. MZ1T]
          Length = 202

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/203 (37%), Positives = 116/203 (57%), Gaps = 7/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GIV  +G+I  +  +A G+R+ V T+  + S + +G S+AH+G+CLTVV +      
Sbjct: 1   MFSGIVAAVGRIEHVEALADGVRITVDTNGLDLSDVIVGDSVAHSGVCLTVVEMDGPR-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
                 +V  ET   T +    +G  +NLE+S++L DRL GHLV+GH+D   E++    I
Sbjct: 59  ---LRYDVSRETLNCT-VGLDAVGGEVNLEKSLRLADRLGGHLVTGHVDSVGEVVKFAPI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  +  +IA KGSV +NGVSLTVN V    F + LI HT+  T  K    
Sbjct: 115 GESHELVIRAPAAIAGYIAKKGSVTVNGVSLTVNRVEGRDFWINLIPHTVAVTNLKHLAP 174

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           G  +N+E+D + RY+ R+     
Sbjct: 175 GSKVNLEIDLIARYVERMLEWKN 197


>gi|319651134|ref|ZP_08005267.1| riboflavin synthase [Bacillus sp. 2_A_57_CT2]
 gi|317397188|gb|EFV77893.1| riboflavin synthase [Bacillus sp. 2_A_57_CT2]
          Length = 217

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 111/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  +    K M+L +  S   + ++LG SI+  G+CLTV   ++     
Sbjct: 1   MFTGIIEELGTVKKVVQQGKAMKLTIQASTVLTDVQLGDSISVNGVCLTVTEFAK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET + T++++    T +NLER++    R  GH V+GHIDGT +IL      
Sbjct: 56  NEFSADVMPETFKSTSLSAIKERTKVNLERAMSANGRFGGHFVTGHIDGTGQILKKTASE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++S+P  L   + +KGS+ ++G+SLTV     N   V +I HT  ET       G
Sbjct: 116 NAIYIQISVPPALSHLLIMKGSIAVDGISLTVFGNEDNTVTVSIIPHTASETVLGFKAAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+         
Sbjct: 176 DIVNLEFDMLAKYLYSFMNRQQE 198


>gi|300784678|ref|YP_003764969.1| riboflavin synthase alpha chain [Amycolatopsis mediterranei U32]
 gi|299794192|gb|ADJ44567.1| riboflavin synthase alpha chain [Amycolatopsis mediterranei U32]
          Length = 209

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 115/201 (57%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++ A+  +    RLRV     T     G SIA +G+CLTVV ++      
Sbjct: 1   MFTGIVEEIGEVTAVEQLTNAARLRVRGPLVTGDAGHGDSIAVSGVCLTVVEVT-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET + +++A   +G  +NLER+   G RL GH++ GH+DGT   L  D  G
Sbjct: 56  GEFTVDVVHETLQRSSLAKVAVGDRVNLERATPAGGRLGGHIMQGHVDGTGVFLGRDENG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +   +    L +++  KGS+ ++GVSLTV  +  + F V LI  T+E TT    + G
Sbjct: 116 VTTFAMPAH---LSRYVVEKGSIAVDGVSLTVAAISADQFAVALIPTTLEATTLGAREAG 172

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+N+EVD + +Y+ +L   +
Sbjct: 173 DLVNLEVDVVAKYVEKLAEAH 193


>gi|34391420|gb|AAM77481.1| riboflavin synthase [Bartonella koehlerae]
          Length = 206

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 100/202 (49%), Positives = 134/202 (66%), Gaps = 1/202 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLS-EEHSV 59
           MFTGIVTDIG +  +  + +GMR  + T Y    +++G SIA +GICLT+V    ++ + 
Sbjct: 1   MFTGIVTDIGCVEDVQSLKQGMRFIISTRYGIEDLEIGASIACSGICLTIVERGLKQQTK 60

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            NW+ VE W E  R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     
Sbjct: 61  TNWFAVEAWEEALRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKME 120

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD++   L +  +   FIA KGS+ LNG SLTVN V  + FDVL+IRHT+E TTW   ++
Sbjct: 121 GDAVRFFLQVSKHFMPFIANKGSIALNGTSLTVNCVEDHIFDVLIIRHTLEMTTWGQAEI 180

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           GDL+N+E+D   RY ARL    
Sbjct: 181 GDLVNLEIDQFARYAARLSDFR 202


>gi|84502766|ref|ZP_01000885.1| riboflavin synthase subunit alpha [Oceanicola batsensis HTCC2597]
 gi|84389161|gb|EAQ01959.1| riboflavin synthase subunit alpha [Oceanicola batsensis HTCC2597]
          Length = 198

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 92/199 (46%), Positives = 127/199 (63%), Gaps = 8/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +      +R R+ T+Y+TS + LG SI   G+CLTV+      +  
Sbjct: 1   MFTGIITDIGTVREVEKRGD-LRARIGTAYDTSGIDLGASICCDGVCLTVIE-----TGA 54

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +W++VE+ AET   TNI+   W  G  +NLER++K+GD L GH+VSGH+DG  E++ L  
Sbjct: 55  DWFDVEISAETVSKTNISHNTWDPGRRVNLERALKVGDELGGHIVSGHVDGVAELIALVD 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS       P +L +F+A KGSV LNG SLTVN V    F + +I HT   TTW   +
Sbjct: 115 DGDSTRATFRAPEDLARFVAPKGSVALNGTSLTVNDVDGAEFGINMIPHTKTVTTWGDAR 174

Query: 179 VGDLINIEVDSMMRYIARL 197
           VGD IN+E+D++ RY+ARL
Sbjct: 175 VGDRINLEIDTLARYVARL 193


>gi|110799364|ref|YP_695001.1| riboflavin synthase subunit alpha [Clostridium perfringens ATCC
           13124]
 gi|168216369|ref|ZP_02641994.1| riboflavin synthase, alpha subunit [Clostridium perfringens NCTC
           8239]
 gi|110674011|gb|ABG82998.1| riboflavin synthase, alpha subunit [Clostridium perfringens ATCC
           13124]
 gi|182381310|gb|EDT78789.1| riboflavin synthase, alpha subunit [Clostridium perfringens NCTC
           8239]
          Length = 217

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/202 (34%), Positives = 119/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +N+ +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE DS+ +Y+ +L     
Sbjct: 176 DLVNIECDSIGKYVEKLLGFKK 197


>gi|124268130|ref|YP_001022134.1| riboflavin synthase subunit alpha [Methylibium petroleiphilum PM1]
 gi|124260905|gb|ABM95899.1| riboflavin synthase alpha chain [Methylibium petroleiphilum PM1]
          Length = 205

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/210 (35%), Positives = 116/210 (55%), Gaps = 14/210 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIA----KGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI++ +G++  + P+      G RL + T     + ++LG SIA  G C+TV     
Sbjct: 1   MFTGIISGLGRLSKVAPLGADPSHGKRLTIATPPGYLADVQLGDSIALNGACMTVTAFDA 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
           E    +W+ V++ AE+   T  A       +NLE++++  DRL GHLVSGH+DG   +  
Sbjct: 61  E---ADWFTVDISAESLDKT--AGLADPGPLNLEKALRASDRLGGHLVSGHVDGVGTVTK 115

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN----FFDVLLIRHTIEE 171
              +G+S    ++ P  L +++A KGS+ +NGVSLTVN V  +       + LI HT+E 
Sbjct: 116 FAPVGESWELCIAAPQALGRYLAYKGSITVNGVSLTVNRVTDHAETTELGINLIPHTLEH 175

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           TT     VG  +N+E+D + RY+ R+    
Sbjct: 176 TTLGTLSVGARVNLEIDLIARYVERMLGSR 205


>gi|262196664|ref|YP_003267873.1| riboflavin synthase, subunit alpha [Haliangium ochraceum DSM 14365]
 gi|262080011|gb|ACY15980.1| riboflavin synthase, alpha subunit [Haliangium ochraceum DSM 14365]
          Length = 200

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/200 (37%), Positives = 116/200 (58%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V DIG I  +   +    LR+ T     ++++LG S+A  G+CLTV     E   
Sbjct: 1   MFTGLVQDIGTIARVDRRSDAAILRIATKRIHAAELELGESVAVNGVCLTVTERDAE--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V   AET R TNI    +   +NLER++++GDRL GH+VSGH+D    I     +
Sbjct: 58  --GFTVLAGAETLRRTNIGELRVSARVNLERALRMGDRLGGHMVSGHVDAVGTIASRRDL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P +  +++  KGS+ ++G+SLTVN V    F V LI HT++ETT    ++
Sbjct: 116 GANLDIAIETPASALRYVIEKGSIAIDGISLTVNRVEARSFAVALIPHTVDETTLAARRI 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G+ +N+EVD + +Y+ RL  
Sbjct: 176 GERVNLEVDMIGKYVERLLG 195


>gi|289209045|ref|YP_003461111.1| riboflavin synthase, subunit alpha [Thioalkalivibrio sp. K90mix]
 gi|288944676|gb|ADC72375.1| riboflavin synthase, alpha subunit [Thioalkalivibrio sp. K90mix]
          Length = 227

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 116/199 (58%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP    +RL V     + S  +LG SIA  G+CLTV  L+     
Sbjct: 1   MFTGIIETLGNLDRLTPSGGDVRLYVNAPGMDLSDTRLGDSIAVNGVCLTVTDLT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  E+  +T + + G G  +NLER++ LGDRL GH+VSGH+DG  E++ ++  
Sbjct: 56  TGGFAADVSRESLDVTTLGALGPGDRVNLERALALGDRLGGHMVSGHVDGVGEVIAMEPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S   R   P  L ++IA KGS+ ++G SLTVN V    F+V +I HT   T + ++ V
Sbjct: 116 ARSTRVRFRAPAALARYIAAKGSITIDGTSLTVNRVDGAEFEVNIIPHTWSLTRFSVYAV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTPVNLEVDLIARYLERLM 194


>gi|117618861|ref|YP_857821.1| riboflavin synthase subunit alpha [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560268|gb|ABK37216.1| riboflavin synthase, alpha subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 217

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/205 (36%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +    + M L V     +   +KLG SIA  G+CLTV+ L ++   
Sbjct: 1   MFTGIIEAVGTLAELRRQGEDMALTVHAPTLDFGDVKLGDSIATNGVCLTVIALGDKS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V  ET   T  A+  +G  +NLE+++    RL GHLVSGH+DG  E+      
Sbjct: 59  ---YTADVSLETLSRTGFATARVGDRVNLEKALMPTSRLGGHLVSGHVDGIGEVKSKSAS 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P  L ++IA KGS+ ++G+SLTVN V  + F + ++ HT EETT    K 
Sbjct: 116 GRAIEYWIKAPGELSRYIAEKGSIAVDGISLTVNAVRGDLFRLTIVPHTAEETTIAQWKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD ++RY+ RL      +
Sbjct: 176 GYRVNLEVDQIVRYLERLMTGKREE 200


>gi|312113515|ref|YP_004011111.1| riboflavin synthase, subunit alpha [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218644|gb|ADP70012.1| riboflavin synthase, alpha subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 200

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 80/203 (39%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+T  G ++     A   R  +   +  + +  G SIA  G CLTV  +       
Sbjct: 1   MFTGIITAQGTVLE----ADNGRFAIACPWEATGIVHGASIACDGCCLTVTGVDS-FGGG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET   T +  W  G  INLERS++ GD + GHLVSGH+DG   I  +   G
Sbjct: 56  SIFRVDVSNETLSKTTLGGWAKGRKINLERSLRFGDEMGGHLVSGHVDGVARIESITPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    +  P  L +FIA KGSV L+GVSLT+N V  + F + LI  T+E T +   + G
Sbjct: 116 FSKIFAIRAPDALAKFIAPKGSVALDGVSLTINDVDGSLFTINLIPTTLEVTIFGGKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D IN+EVD + RY+ARL      
Sbjct: 176 DSINMEVDLIARYVARLLGQQAE 198


>gi|15900114|ref|NP_344718.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae TIGR4]
 gi|111657938|ref|ZP_01408647.1| hypothetical protein SpneT_02000887 [Streptococcus pneumoniae
           TIGR4]
 gi|116516797|ref|YP_815687.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae D39]
 gi|148987915|ref|ZP_01819378.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP6-BS73]
 gi|148992758|ref|ZP_01822401.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP9-BS68]
 gi|149001718|ref|ZP_01826691.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP14-BS69]
 gi|149005930|ref|ZP_01829659.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP18-BS74]
 gi|149011049|ref|ZP_01832354.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP19-BS75]
 gi|168490357|ref|ZP_02714556.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae SP195]
 gi|182683161|ref|YP_001834908.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae CGSP14]
 gi|194398327|ref|YP_002036883.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae G54]
 gi|225855948|ref|YP_002737459.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae P1031]
 gi|237649749|ref|ZP_04524001.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae CCRI
           1974]
 gi|237821447|ref|ZP_04597292.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae CCRI
           1974M2]
 gi|303255120|ref|ZP_07341196.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae BS455]
 gi|307126403|ref|YP_003878434.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae 670-6B]
 gi|14971644|gb|AAK74358.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae TIGR4]
 gi|116077373|gb|ABJ55093.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae D39]
 gi|147760176|gb|EDK67165.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP14-BS69]
 gi|147762286|gb|EDK69247.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP18-BS74]
 gi|147764685|gb|EDK71615.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP19-BS75]
 gi|147926379|gb|EDK77452.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928484|gb|EDK79499.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP9-BS68]
 gi|182628495|gb|ACB89443.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae CGSP14]
 gi|183571307|gb|EDT91835.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae SP195]
 gi|194357994|gb|ACF56442.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae G54]
 gi|225725201|gb|ACO21053.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae P1031]
 gi|301793456|emb|CBW35829.1| riboflavin synthase alpha chain [Streptococcus pneumoniae INV104]
 gi|301801128|emb|CBW33801.1| riboflavin synthase alpha chain [Streptococcus pneumoniae INV200]
 gi|302597950|gb|EFL65020.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae BS455]
 gi|306483465|gb|ADM90334.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           670-6B]
 gi|332075849|gb|EGI86316.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA17570]
 gi|332076628|gb|EGI87090.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA17545]
 gi|332077483|gb|EGI87944.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA41301]
          Length = 211

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLEQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|326404512|ref|YP_004284594.1| riboflavin synthase alpha chain [Acidiphilium multivorum AIU301]
 gi|325051374|dbj|BAJ81712.1| riboflavin synthase alpha chain [Acidiphilium multivorum AIU301]
          Length = 204

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 116/208 (55%), Gaps = 13/208 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAK--GMRLRVMTSYNTSK------MKLGCSIAHAGICLTVVR 52
           MFTGI+T +G +  + P       RL +              + LG SIA +G CLTVV 
Sbjct: 1   MFTGIITGVGDVRDVRPADSVSDTRLVIGVPAGNPDWAGIGEVALGASIACSGCCLTVVE 60

Query: 53  LSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVE 112
                   +W+ VEV  ET   T + +W  GT INLER++++GD L GH+VSGH+DG  E
Sbjct: 61  RGP-----DWFAVEVSGETLSKTTLGAWRTGTRINLERALRMGDELGGHVVSGHVDGLGE 115

Query: 113 ILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
           ++     G S   R  +  +L +FIA KGSV +NGVSLTVN V    F V +I HT   T
Sbjct: 116 VVSTRPEGGSTRWRFRVSRDLARFIAPKGSVAVNGVSLTVNEVDGTEFGVNIIPHTETHT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYAL 200
            +    VGD +NIE+D + RY+ARL  +
Sbjct: 176 NFATLAVGDAVNIEIDMLARYVARLAEV 203


>gi|148996603|ref|ZP_01824321.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP11-BS70]
 gi|168576391|ref|ZP_02722274.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           MLV-016]
 gi|307066859|ref|YP_003875825.1| riboflavin synthase alpha chain [Streptococcus pneumoniae AP200]
 gi|147757178|gb|EDK64217.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP11-BS70]
 gi|183577882|gb|EDT98410.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           MLV-016]
 gi|306408396|gb|ADM83823.1| Riboflavin synthase alpha chain [Streptococcus pneumoniae AP200]
          Length = 211

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLEQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|34391412|gb|AAM77477.1| riboflavin synthase [Bartonella alsatica]
          Length = 205

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 132/201 (65%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI++DIG +  +  + +G+RL++ T Y+   +K+G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIISDIGCVEDVQSLKQGLRLKISTCYDIESLKIGTSIACSGICLTIVERGSKQAKT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFXVEAWEETLRLTNLMQWTKGTFVNLERSLRLGDEVGGHLVSGHIDGLAEIIDKKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN +    FDVL+IRHT+E TTW   K+G
Sbjct: 121 DAIRFFLQVPKQFTPFIVNKGSLALNGTSLTVNCIEDCIFDVLIIRHTLEVTTWGQTKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY  +     
Sbjct: 181 DKVNLEIDQLARYAVKFSGFK 201


>gi|253681161|ref|ZP_04861964.1| riboflavin synthase, alpha subunit [Clostridium botulinum D str.
           1873]
 gi|253563010|gb|EES92456.1| riboflavin synthase, alpha subunit [Clostridium botulinum D str.
           1873]
          Length = 216

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I  ++      ++ +        + LG SI+  G+CLTV   +      
Sbjct: 1   MFTGIVEEIGTINIISMTKDFAKITIDAKEILKDVSLGDSISTNGVCLTVTEYNR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +N++S   G  +NLER++ LG R  GH+VSGHIDG   I       
Sbjct: 56  NNFTVDVMGETIRRSNLSSLKRGDKVNLERALALGGRFGGHIVSGHIDGVGTIKNFKHEA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + + I  KGS+ ++GVSLTV  V +  F V +I HT  ETT    K G
Sbjct: 116 NAIWITIEASEEILKNIVFKGSIAIDGVSLTVAYVDREVFKVCIIPHTQSETTLTSKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +N+E D + +Y+ +L  +  ++
Sbjct: 176 DKVNLECDVIAKYVEKLLQVKNNE 199


>gi|325528282|gb|EGD05446.1| riboflavin synthase subunit alpha [Burkholderia sp. TJI49]
          Length = 211

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 79/208 (37%), Positives = 120/208 (57%), Gaps = 16/208 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESITPLGASPEAGVRLSVQAGGLDLADVALGDSIAIQGACMTVIEKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++VEV  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DAAFDVEVSRESLNRTVG--LAEPGDVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V      + F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNSVEDLADGSEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYA 199
           TT +  K GD +N+EVD + RY+ R+ +
Sbjct: 174 TTLRHLKAGDKVNLEVDMIARYVERMLS 201


>gi|167590678|ref|ZP_02383066.1| riboflavin synthase subunit alpha [Burkholderia ubonensis Bu]
          Length = 211

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/212 (35%), Positives = 120/212 (56%), Gaps = 16/212 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESIKPLGASPDAGVRLTVKAGGLDLADVALGDSIAIQGACMTVIEKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                + ++VEV  E+  +T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----ADAFDVEVSRESLNLTVG--LAEPGDVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRQLGRYLAYKGSITVNGVSLTVNSVADRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
           TT +  + G  +N+E+D + RY+ R+ + + S
Sbjct: 174 TTLRHLRAGSQVNLEIDMIARYVERMLSTSPS 205


>gi|227488844|ref|ZP_03919160.1| riboflavin synthase subunit alpha [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227091266|gb|EEI26578.1| riboflavin synthase subunit alpha [Corynebacterium glucuronolyticum
           ATCC 51867]
          Length = 215

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 110/213 (51%), Gaps = 16/213 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G I  +      + L V        +  G SI+  G+CLTV   ++E    
Sbjct: 1   MFTGLVEEVGHIARLEAADDSVILTVNADTVLDGVHTGDSISVNGVCLTVTAFTDES--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ +V  E+   +N+ +    + +NLER+ +LG RL GHLV GH+DG   +L      
Sbjct: 58  --FQADVMKESLDRSNLGALSERSPVNLERAAELGSRLGGHLVQGHVDGVATLLERTPGS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----------FFDVLLIRHTI 169
                R +LP  L +++  KGS+C+NG SLTV+ V              +F+V LI  T+
Sbjct: 116 HWEVFRFTLPAALSRYVVEKGSICVNGTSLTVSGVSATGTLTEGNTSDAWFEVALIPTTL 175

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
            +T     + GD +NIEVD + +Y+ ++   +T
Sbjct: 176 RDTNLGTLEPGDSVNIEVDVIAKYVEKMLTPDT 208


>gi|254442782|ref|ZP_05056258.1| riboflavin synthase, alpha subunit [Verrucomicrobiae bacterium
           DG1235]
 gi|198257090|gb|EDY81398.1| riboflavin synthase, alpha subunit [Verrucomicrobiae bacterium
           DG1235]
          Length = 203

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 110/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK++A   +    R RV      +++ LG S+A  G CLTVV + E     
Sbjct: 6   MFTGIVEEKGKVVACEELEGSWRYRVAVEVVGAEISLGDSVAVNGCCLTVVEIGE----- 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET R+TN+    +G+ +NLERS++   R+ GH VSGHIDGT  I  L   G
Sbjct: 61  GVLSFDVLEETRRLTNLRDIAVGSSVNLERSLRFDGRVGGHFVSGHIDGTGVIRTLRPEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
             +   +  P   E+++  KG + ++G+SLTV  V      + LI HT+E T+     VG
Sbjct: 121 KDVILEIEAPEGFEKYLVYKGCIAIDGMSLTVAEVKGRMVTIWLIPHTLEVTSIGEKGVG 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y  ++ A   +
Sbjct: 181 DAVNLEFDLIAKYTEKIVAQRDA 203


>gi|148983579|ref|ZP_01816898.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP3-BS71]
 gi|225860209|ref|YP_002741718.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298230113|ref|ZP_06963794.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298255024|ref|ZP_06978610.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298501979|ref|YP_003723919.1| riboflavin synthase [Streptococcus pneumoniae TCH8431/19A]
 gi|147923726|gb|EDK74838.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP3-BS71]
 gi|225727472|gb|ACO23323.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237574|gb|ADI68705.1| riboflavin synthase [Streptococcus pneumoniae TCH8431/19A]
 gi|301799333|emb|CBW31868.1| riboflavin synthase alpha chain [Streptococcus pneumoniae OXC141]
 gi|327390585|gb|EGE88925.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA04375]
 gi|332202098|gb|EGJ16167.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA41317]
          Length = 211

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+++T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLKQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|158422888|ref|YP_001524180.1| riboflavin synthase alpha chain [Azorhizobium caulinodans ORS 571]
 gi|158329777|dbj|BAF87262.1| riboflavin synthase alpha chain [Azorhizobium caulinodans ORS 571]
          Length = 203

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 87/203 (42%), Positives = 118/203 (58%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTD+G+I+ +    +     + T Y  S + +G SIA +G+CLTV ++ +     
Sbjct: 1   MFTGIVTDLGEIVDLEVHNEVRTFGIATDYKPSSIDIGASIACSGVCLTVTKVKKRGPKR 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET  IT +A W  G  INLERS+ +G  L GHLV+GH+DG   ++  D   
Sbjct: 61  AVFYVDAAPETLAITTVAKWREGARINLERSLTIGGELGGHLVTGHVDGIARVVARDDFE 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++       P  L +FIA KGSVCL+G SLTVN V  N F  LLI HT+  TTW + +  
Sbjct: 121 ETSRFTFEAPEPLARFIAAKGSVCLDGTSLTVNTVKGNRFSCLLIPHTLAVTTWGVVQAE 180

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D IN+EVD M RY ARL     +
Sbjct: 181 DEINLEVDLMARYAARLAQYEPA 203


>gi|260904123|ref|ZP_05912445.1| riboflavin synthase alpha chain/3,4-dihydroxy-2-butanone
           4-phosphate synthase [Brevibacterium linens BL2]
          Length = 246

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/222 (32%), Positives = 111/222 (50%), Gaps = 21/222 (9%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G + A+  +     + +        + LG S+A  G+CLT VR       D
Sbjct: 1   MFTGIIEELGTVEAIDHLDDSAVITIDAKGLVDDLGLGGSLAVNGVCLTSVRDESSSPQD 60

Query: 61  NW----------------YEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVS 104
           +                 +  EV  ET R+T + +  IG  +NLER      R DGH+V 
Sbjct: 61  SGAPGESPGAFTTEVQGPFTAEVMGETLRLTGLGALRIGDRVNLERCTPASGRFDGHVVQ 120

Query: 105 GHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----F 159
           GH+DG  E+L  D   +    R+ +P++L  + A KGS+ LNGVSLT+  V +      +
Sbjct: 121 GHVDGCGELLSRDDFAEWSTLRIGIPNSLAPYTATKGSIALNGVSLTLTAVSEPSEASAW 180

Query: 160 FDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
            +V LI  T+  TT+     GD +N+EVD + +Y ARL +  
Sbjct: 181 VEVGLIPATLTHTTFGDLSPGDPVNVEVDVLAKYTARLLSFR 222


>gi|15902207|ref|NP_357757.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae R6]
 gi|15457705|gb|AAK98967.1| Riboflavin synthase alpha-chain [Streptococcus pneumoniae R6]
          Length = 211

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWHQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLEQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|161525608|ref|YP_001580620.1| riboflavin synthase subunit alpha [Burkholderia multivorans ATCC
           17616]
 gi|189349663|ref|YP_001945291.1| riboflavin synthase subunit alpha [Burkholderia multivorans ATCC
           17616]
 gi|160343037|gb|ABX16123.1| riboflavin synthase, alpha subunit [Burkholderia multivorans ATCC
           17616]
 gi|189333685|dbj|BAG42755.1| riboflavin synthase alpha chain [Burkholderia multivorans ATCC
           17616]
          Length = 209

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 120/211 (56%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVNAGGLDLADVALGDSIAIQGACMTVIAKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DTTFDVDVSRESLNRTVG--LAQPGDVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V      + F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVEDRPDGSEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  K GD +N+EVD + RY+ R+  ++ 
Sbjct: 174 TTLRHLKAGDRVNLEVDMIARYVERMLTMSQ 204


>gi|258627341|ref|ZP_05722125.1| Riboflavin synthase alpha chain [Vibrio mimicus VM603]
 gi|258580379|gb|EEW05344.1| Riboflavin synthase alpha chain [Vibrio mimicus VM603]
          Length = 217

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   N  
Sbjct: 176 GRRVNLEVDVLARYMERLLQGNKE 199


>gi|133778399|dbj|BAF49204.1| riboflavin synthase [Bartonella rattimassiliensis]
          Length = 205

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 99/201 (49%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+RL++ T Y    + +G SIA +GICLT+V    +    
Sbjct: 1   MFTGIITDIGCVEDIQSLKQGVRLKISTRYAIESLAIGASIACSGICLTIVERGLKQKNS 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+ VE W ET R+TN+  W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  NWFIVEAWEETLRLTNLVQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +      FI  KGS+ LNG SLTVN+V    FDVL+IRHT+E TTW+  K+G
Sbjct: 121 DAIRFYLKVSRQFIPFIVNKGSLALNGTSLTVNVVEDCIFDVLIIRHTLEMTTWRQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+N+E+D   RY A+L  L 
Sbjct: 181 DLVNLEIDQFARYSAKLLTLK 201


>gi|52080842|ref|YP_079633.1| riboflavin synthase subunit alpha [Bacillus licheniformis ATCC
           14580]
 gi|52786213|ref|YP_092042.1| riboflavin synthase subunit alpha [Bacillus licheniformis ATCC
           14580]
 gi|319645200|ref|ZP_07999433.1| RibE protein [Bacillus sp. BT1B_CT2]
 gi|52004053|gb|AAU23995.1| riboflavin synthase (alpha subunit) [Bacillus licheniformis ATCC
           14580]
 gi|52348715|gb|AAU41349.1| RibE [Bacillus licheniformis ATCC 14580]
 gi|317393009|gb|EFV73803.1| RibE protein [Bacillus sp. BT1B_CT2]
          Length = 215

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 116/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I+ M      M L + ++     +KLG SIA  G+CLTV          
Sbjct: 1   MFTGIIEEVGTILDMKKAGSAMSLVIQSNKVIEDVKLGDSIAVNGVCLTVNEFGSSS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET + T++ +   G+ +NLER++    R  GH+VSGH+DGT  I+ ++   
Sbjct: 58  --FTADVMLETLKATSLGTLKKGSRVNLERAMAANGRFGGHMVSGHVDGTASIVRIEKAA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L L  +L + + +KGS+ ++GVSLT+  + ++   V LI HT++ET +   KVG
Sbjct: 116 NTVYYDLKLDPSLAKMLVLKGSIAVDGVSLTIFGLTEDQVTVSLIPHTLDETIFPAKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
            ++NIE D + +YI R       +
Sbjct: 176 SIVNIECDMIGKYIYRFLHQTKQE 199


>gi|291527732|emb|CBK93318.1| riboflavin synthase, alpha subunit [Eubacterium rectale M104/1]
          Length = 239

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 114/203 (56%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  ++  A    L +      +  K+G SIA  GICLTV RL     + 
Sbjct: 1   MFTGIVEEVGTIDTISRGANSAVLTIRAEKVLAGTKVGDSIAVNGICLTVTRL-----MP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET   +++A+   G  +NLER++    R  GH+VSGH+DGT  I+ +    
Sbjct: 56  HAFTADVMHETLNRSSLANAMRGAHVNLERAMAADGRFGGHIVSGHVDGTGRIVEVKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     L ++I  KGSV ++G+SLTV  V ++ F +  I HT+ +T  K  KVG
Sbjct: 116 NAIWYTIHAAPQLMRYIVEKGSVTIDGISLTVAKVAEDNFSISAIPHTVSQTVLKDRKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
            ++N+E D + +Y+ +L     S
Sbjct: 176 AVVNLETDIIGKYVEKLLFKGQS 198


>gi|269121378|ref|YP_003309555.1| riboflavin synthase, subunit alpha [Sebaldella termitidis ATCC
           33386]
 gi|268615256|gb|ACZ09624.1| riboflavin synthase, alpha subunit [Sebaldella termitidis ATCC
           33386]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 61/203 (30%), Positives = 103/203 (50%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IGKI  +    +G+ + +        + +G SIA  G+CLTV    +     
Sbjct: 1   MFTGLIEEIGKIANIKNKNQGLEIEIEAEKVLENVNIGDSIAVNGVCLTVTGYKK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +   ET   +N+     G  +NLE+S+ L   L GHLV+G ++   EI+ ++  G
Sbjct: 56  NLFTADAMYETINRSNLKRLRSGDKVNLEKSLTLSKPLGGHLVTGDVECEGEIISVETNG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + + ++ +     +++  KG + L+G SLTV     + F V LI HTI+       K G
Sbjct: 116 IARHYKIKMDKKYMKYVVEKGRITLDGASLTVIDAENDTFSVSLIPHTIKNIILGSKKNG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+NIE D   +Y+ ++      
Sbjct: 176 DLVNIETDLFAKYVEKILNSEKE 198


>gi|225858038|ref|YP_002739548.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae 70585]
 gi|225721065|gb|ACO16919.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae 70585]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSINGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLEQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|221201162|ref|ZP_03574202.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2M]
 gi|221206385|ref|ZP_03579398.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2]
 gi|221213662|ref|ZP_03586636.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD1]
 gi|221166451|gb|EED98923.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD1]
 gi|221173694|gb|EEE06128.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2]
 gi|221179012|gb|EEE11419.1| riboflavin synthase, alpha subunit [Burkholderia multivorans CGD2M]
          Length = 209

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 120/211 (56%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVNAGGLDLADVALGDSIAIQGACMTVIAKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DTSFDVDVSRESLNRTVG--LAQPGDVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V      + F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVEDRPDGSEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  K GD +N+EVD + RY+ R+  ++ 
Sbjct: 174 TTLRHLKAGDQVNLEVDMIARYVERMLTMSQ 204


>gi|304407003|ref|ZP_07388657.1| riboflavin synthase, alpha subunit [Paenibacillus curdlanolyticus
           YK9]
 gi|304343990|gb|EFM09830.1| riboflavin synthase, alpha subunit [Paenibacillus curdlanolyticus
           YK9]
          Length = 222

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 62/206 (30%), Positives = 108/206 (52%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G+    +   + M L +  +     + +G SIA  G+CLTV   +      
Sbjct: 1   MFTGLIEEVGRFRGASRAGEAMVLTIDATRILGDVAIGDSIAVNGVCLTVTSFTR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ +V  +T R +N+     G+ +NLER++  G R  GH+V GHIDG   I+      
Sbjct: 56  GSFQADVMPQTYRHSNLKDLKPGSKVNLERAMAAGGRFGGHIVQGHIDGIGVIVSRKVDA 115

Query: 121 DSMYCRLSLPH--NLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +++  +L       L +++  KGS+ ++G+SLTV       F V +I HT+ ET  +  +
Sbjct: 116 NAVIFKLRAEESSELAKYVIPKGSITIDGISLTVTEAESGSFGVSIIPHTLAETALQDKQ 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
            GD +N+E D + +Y+  L    TS+
Sbjct: 176 PGDTVNLEADIIGKYVDHLLHYRTSE 201


>gi|153834832|ref|ZP_01987499.1| riboflavin synthase, alpha subunit [Vibrio harveyi HY01]
 gi|156973477|ref|YP_001444384.1| riboflavin synthase subunit alpha [Vibrio harveyi ATCC BAA-1116]
 gi|148868760|gb|EDL67834.1| riboflavin synthase, alpha subunit [Vibrio harveyi HY01]
 gi|156525071|gb|ABU70157.1| hypothetical protein VIBHAR_01167 [Vibrio harveyi ATCC BAA-1116]
          Length = 217

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/205 (36%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V     + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET   T  A++ +G  +NLE+++    R  GH+VSGH+DG   I+  + +
Sbjct: 57  -HYYSADLSLETLNKTGFAAYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGVIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVEMPAEICKYVAEKGSITVDGISLTVNDLRKNGFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQKEE 200


>gi|292654586|ref|YP_003534483.1| riboflavin synthase subunit alpha [Haloferax volcanii DS2]
 gi|291372746|gb|ADE04973.1| riboflavin synthase, alpha subunit [Haloferax volcanii DS2]
          Length = 203

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 78/198 (39%), Positives = 113/198 (57%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G+I+A+T    G RLR+ T      +  G SIA +G+CLTV         D
Sbjct: 1   MFTGIVEGPGEIVAVTDTDGGRRLRIRTDLAFDDLHHGQSIAVSGVCLTVEAFG-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+EV + AET   T +     G  +NLER++   DR DGH+V GH+DGT  +  ++ +G
Sbjct: 56  DWFEVFLAAETIEKTYLGDAVEGDRVNLERALAADDRFDGHIVQGHVDGTTTVTNVERVG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D  +    LP +L  ++  KGSVCL+G+SLTV    +  F V +I  T + TT     VG
Sbjct: 116 DDWFFEFDLPESLANYVVQKGSVCLDGISLTVADRREGTFAVAIIPTTYDLTTLSEKAVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D I++EVD + +Y+  + 
Sbjct: 176 DPIHVEVDVVAKYVESML 193


>gi|302875672|ref|YP_003844305.1| riboflavin synthase, alpha subunit [Clostridium cellulovorans 743B]
 gi|307688110|ref|ZP_07630556.1| riboflavin synthase subunit alpha [Clostridium cellulovorans 743B]
 gi|302578529|gb|ADL52541.1| riboflavin synthase, alpha subunit [Clostridium cellulovorans 743B]
          Length = 218

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 63/203 (31%), Positives = 112/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV  IG+++A+    K  ++ +        + +G S++  G+CLT  ++       
Sbjct: 1   MFTGIVEKIGRVLAIQKGEKSSKITIQAGNIIDGIAVGDSVSTNGVCLTATKI-----FL 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ ++ AET R +N+ +  IG+ +NLER++    R  GH+V+GHID    I   +   
Sbjct: 56  DSFQADIMAETLRKSNLGNLKIGSRVNLERAMTPSRRFGGHIVTGHIDDVGIIKKFEKED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + ++I  KGS+ ++GVSLTV  V K  F+V +I HT +ET      +G
Sbjct: 116 NAIWINIGASEKVMKYIIHKGSIAIDGVSLTVAKVNKEGFEVSIIPHTQDETILLEKVIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ RL      
Sbjct: 176 DTVNLECDILGKYVERLLTYGKE 198


>gi|149017851|ref|ZP_01834310.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP23-BS72]
 gi|168483818|ref|ZP_02708770.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC1873-00]
 gi|168492135|ref|ZP_02716278.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC0288-04]
 gi|147931415|gb|EDK82393.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           SP23-BS72]
 gi|172042883|gb|EDT50929.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC1873-00]
 gi|183573608|gb|EDT94136.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC0288-04]
 gi|332203339|gb|EGJ17406.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA47368]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSINGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+++T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLKQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+E D + +Y+ +L 
Sbjct: 176 STVNLENDILGKYVQKLM 193


>gi|34391410|gb|AAM77476.1| riboflavin synthase [Bartonella vinsonii subsp. berkhoffii]
          Length = 205

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 94/201 (46%), Positives = 128/201 (63%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + KG+R  + T Y    +++G SIA +GICLT+V    + S  
Sbjct: 1   MFTGIITDIGCVEDIQSLKKGVRFNISTRYAVESLEIGSSIACSGICLTIVERGSKQSNM 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT INLERS++LGD + GHLVSGHID   EI+     G
Sbjct: 61  SWFAVEAWEEALRLTNLAQWTKGTCINLERSLRLGDEMGGHLVSGHIDSLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN +    FD+L+IRHT+E TTW   K+G
Sbjct: 121 DAVRFFLQVPTRFTPFIVSKGSIALNGTSLTVNCIEDCIFDILIIRHTLEMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D   RY+A+     
Sbjct: 181 DQVNLEIDPFARYVAKFSGFK 201


>gi|291287236|ref|YP_003504052.1| riboflavin synthase, alpha subunit [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884396|gb|ADD68096.1| riboflavin synthase, alpha subunit [Denitrovibrio acetiphilus DSM
           12809]
          Length = 215

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 64/198 (32%), Positives = 107/198 (54%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G + ++        L++  S      ++G SIA  G+CLTV  +       
Sbjct: 1   MFTGIIEEVGSVSSIDRKGDFAVLKIKCSKVLESTQIGDSIAVNGVCLTVTSMG-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++  ET + +  A    G+ +NLER++ L  RL GHLVSGH+D    I       
Sbjct: 56  DTFCADISYETIKKSTFADITNGSGVNLERALTLSTRLGGHLVSGHVDAVGTIEKFTRNQ 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P ++++++A KGSVC++G+SLT        F+V +I HT E T+ K  + G
Sbjct: 116 SAYILTIRYPDDIDKYLASKGSVCVDGISLTTARCSNGTFEVAVIPHTYEGTSLKGKRQG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+EVD + RY+ +L 
Sbjct: 176 SKVNLEVDMISRYLEKLL 193


>gi|15608550|ref|NP_215928.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           H37Rv]
 gi|15840870|ref|NP_335907.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           CDC1551]
 gi|31792606|ref|NP_855099.1| riboflavin synthase subunit alpha [Mycobacterium bovis AF2122/97]
 gi|121637342|ref|YP_977565.1| riboflavin synthase subunit alpha [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148661203|ref|YP_001282726.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           H37Ra]
 gi|148822632|ref|YP_001287386.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis F11]
 gi|167968451|ref|ZP_02550728.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           H37Ra]
 gi|215403259|ref|ZP_03415440.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           02_1987]
 gi|215411057|ref|ZP_03419865.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           94_M4241A]
 gi|215426749|ref|ZP_03424668.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis T92]
 gi|215430299|ref|ZP_03428218.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           EAS054]
 gi|219557316|ref|ZP_03536392.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis T17]
 gi|224989817|ref|YP_002644504.1| riboflavin synthase subunit alpha [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253799538|ref|YP_003032539.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           KZN 1435]
 gi|254231654|ref|ZP_04924981.1| riboflavin synthase alpha chain ribC [Mycobacterium tuberculosis C]
 gi|254364294|ref|ZP_04980340.1| riboflavin synthase alpha chain ribC [Mycobacterium tuberculosis
           str. Haarlem]
 gi|254550426|ref|ZP_05140873.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260186351|ref|ZP_05763825.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           CPHL_A]
 gi|260200467|ref|ZP_05767958.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis T46]
 gi|260204677|ref|ZP_05772168.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis K85]
 gi|289442857|ref|ZP_06432601.1| riboflavin synthase, alpha subunit [Mycobacterium tuberculosis T46]
 gi|289447008|ref|ZP_06436752.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           CPHL_A]
 gi|289554797|ref|ZP_06444007.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           KZN 605]
 gi|289569429|ref|ZP_06449656.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           T17]
 gi|289574081|ref|ZP_06454308.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           K85]
 gi|289745163|ref|ZP_06504541.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           02_1987]
 gi|289749970|ref|ZP_06509348.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           T92]
 gi|289753494|ref|ZP_06512872.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           EAS054]
 gi|294994974|ref|ZP_06800665.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis 210]
 gi|297633968|ref|ZP_06951748.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis KZN
           4207]
 gi|297730957|ref|ZP_06960075.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis KZN
           R506]
 gi|298524918|ref|ZP_07012327.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           94_M4241A]
 gi|306775595|ref|ZP_07413932.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu001]
 gi|306780743|ref|ZP_07419080.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu002]
 gi|306784142|ref|ZP_07422464.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu003]
 gi|306788512|ref|ZP_07426834.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu004]
 gi|306792835|ref|ZP_07431137.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu005]
 gi|306797234|ref|ZP_07435536.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu006]
 gi|306803116|ref|ZP_07439784.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu008]
 gi|306807312|ref|ZP_07443980.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu007]
 gi|306967510|ref|ZP_07480171.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu009]
 gi|306971703|ref|ZP_07484364.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu010]
 gi|307079413|ref|ZP_07488583.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu011]
 gi|307083982|ref|ZP_07493095.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu012]
 gi|313658290|ref|ZP_07815170.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis KZN
           V2475]
 gi|54039063|sp|P65327|RISA_MYCTU RecName: Full=Riboflavin synthase alpha chain
 gi|54039064|sp|P65328|RISA_MYCBO RecName: Full=Riboflavin synthase alpha chain
 gi|1542920|emb|CAB02162.1| PROBABLE RIBOFLAVIN SYNTHASE ALPHA CHAIN RIBC (RIBE) [Mycobacterium
           tuberculosis H37Rv]
 gi|13881070|gb|AAK45721.1| riboflavin synthase, alpha subunit [Mycobacterium tuberculosis
           CDC1551]
 gi|31618195|emb|CAD94308.1| PROBABLE RIBOFLAVIN SYNTHASE ALPHA CHAIN RIBC (RIBE) [Mycobacterium
           bovis AF2122/97]
 gi|121492989|emb|CAL71460.1| Probable riboflavin synthase alpha chain ribC [Mycobacterium bovis
           BCG str. Pasteur 1173P2]
 gi|124600713|gb|EAY59723.1| riboflavin synthase alpha chain ribC [Mycobacterium tuberculosis C]
 gi|134149808|gb|EBA41853.1| riboflavin synthase alpha chain ribC [Mycobacterium tuberculosis
           str. Haarlem]
 gi|148505355|gb|ABQ73164.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           H37Ra]
 gi|148721159|gb|ABR05784.1| riboflavin synthase alpha subunit ribC [Mycobacterium tuberculosis
           F11]
 gi|224772930|dbj|BAH25736.1| riboflavin synthase subunit alpha [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|253321041|gb|ACT25644.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           KZN 1435]
 gi|289415776|gb|EFD13016.1| riboflavin synthase, alpha subunit [Mycobacterium tuberculosis T46]
 gi|289419966|gb|EFD17167.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           CPHL_A]
 gi|289439429|gb|EFD21922.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           KZN 605]
 gi|289538512|gb|EFD43090.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           K85]
 gi|289543183|gb|EFD46831.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           T17]
 gi|289685691|gb|EFD53179.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           02_1987]
 gi|289690557|gb|EFD57986.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           T92]
 gi|289694081|gb|EFD61510.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           EAS054]
 gi|298494712|gb|EFI30006.1| riboflavin synthase subunit alpha [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215906|gb|EFO75305.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu001]
 gi|308326402|gb|EFP15253.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu002]
 gi|308331088|gb|EFP19939.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu003]
 gi|308334901|gb|EFP23752.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu004]
 gi|308338710|gb|EFP27561.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu005]
 gi|308342397|gb|EFP31248.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu006]
 gi|308346235|gb|EFP35086.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu007]
 gi|308350187|gb|EFP39038.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu008]
 gi|308354828|gb|EFP43679.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu009]
 gi|308358779|gb|EFP47630.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu010]
 gi|308362716|gb|EFP51567.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu011]
 gi|308366349|gb|EFP55200.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           SUMu012]
 gi|323720076|gb|EGB29182.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903033|gb|EGE49966.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           W-148]
 gi|328459286|gb|AEB04709.1| riboflavin synthase subunit alpha ribC [Mycobacterium tuberculosis
           KZN 4207]
          Length = 201

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 112/201 (55%), Gaps = 7/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G++     +    RL +     T+    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEERGEVTGREALVDAARLTIRGPMVTADAGHGDSIAVNGVCLTVVDV----LPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +N+     G+ +NLER+  LG RL GH+V GH+D T EI+      
Sbjct: 57  GQFTADVMAETLNRSNLGELRPGSRVNLERAAALGSRLGGHIVQGHVDATGEIVARCPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P ++ +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEMPASVARYVVEKGSITVDGISLTVSGLGAEQRDWFEVSLIPTTRELTTLGSA 176

Query: 178 KVGDLINIEVDSMMRYIARLY 198
            VG  +N+EVD + +Y+ RL 
Sbjct: 177 AVGTRVNLEVDVVAKYVERLM 197


>gi|227824643|ref|ZP_03989475.1| riboflavin biosynthesis protein [Acidaminococcus sp. D21]
 gi|226905142|gb|EEH91060.1| riboflavin biosynthesis protein [Acidaminococcus sp. D21]
          Length = 212

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 107/201 (53%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G++ A+       RL +        + +G S+   G CLTV          
Sbjct: 1   MFTGLIAEMGRVDALRREGSSYRLTIEAKKIPLTLFVGESVCCNGACLTVTHFD-----A 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET R T I     G  INLE+++KLG  LDGHLV GH+DG   I  +   G
Sbjct: 56  HCFTVDVMPETVRHTTIGLLKKGDPINLEQTLKLGAGLDGHLVLGHVDGVGTISRIVPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    ++ P  L  ++  KGS+ ++G+SLT+  V +  F V LI  T+++TT    KVG
Sbjct: 116 IAKVTTITAPKELLHYMVKKGSIAIDGISLTLTDVTETAFSVSLIPLTVKDTTLGKKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E D + +Y+ +L    
Sbjct: 176 DAVNLETDILGKYVEKLINHK 196


>gi|182626740|ref|ZP_02954480.1| riboflavin synthase, alpha subunit [Clostridium perfringens D str.
           JGS1721]
 gi|177907908|gb|EDT70500.1| riboflavin synthase, alpha subunit [Clostridium perfringens D str.
           JGS1721]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 119/202 (58%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++I++    K   L++  +      K+G SI+  G+CLT+    +     
Sbjct: 1   MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++   V  ET R +NI +    + +NLER++ +  R +GH+V+GHID T EI+     G
Sbjct: 56  DYFTAYVMGETLRKSNIGNLKKSSKVNLERAMSINSRFNGHIVTGHIDSTGEIISFKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  + + + L ++I  KGS+ ++G+SLT+  V    F V +I H+ EETT    K+G
Sbjct: 116 EAIWVEIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           DL+NIE DS+ +Y+ +L     
Sbjct: 176 DLVNIECDSIGKYVEKLLGFKK 197


>gi|261211386|ref|ZP_05925674.1| riboflavin synthase alpha chain [Vibrio sp. RC341]
 gi|260839341|gb|EEX65967.1| riboflavin synthase alpha chain [Vibrio sp. RC341]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 119/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDARS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPADLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTMDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   +  
Sbjct: 176 GRRVNLEVDVLARYMERLLQGSKE 199


>gi|262170763|ref|ZP_06038441.1| riboflavin synthase alpha chain [Vibrio mimicus MB-451]
 gi|261891839|gb|EEY37825.1| riboflavin synthase alpha chain [Vibrio mimicus MB-451]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  + + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFSQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELNKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   N  
Sbjct: 176 GRRVNLEVDVLARYMERLLQGNKE 199


>gi|296140261|ref|YP_003647504.1| riboflavin synthase, subunit alpha [Tsukamurella paurometabola DSM
           20162]
 gi|296028395|gb|ADG79165.1| riboflavin synthase, alpha subunit [Tsukamurella paurometabola DSM
           20162]
          Length = 207

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/212 (35%), Positives = 116/212 (54%), Gaps = 13/212 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I A   +    R  V     TS  K G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEELGVITARDDLPDAARFTVRGDLVTSDAKHGDSIAVNGVCLTVVTVE-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ R ++++  G G  +NLER+  +  RL GH+V GH+DGT  ++ L    
Sbjct: 56  GAFTADVMEESLRRSSLSKLGPGDRVNLERAAAVNSRLGGHIVQGHVDGTGHVISLSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG--------KNFFDVLLIRHTIEET 172
                RL+LP  L +++  KGS+ ++GVSLTV+ +G        +++F+V LI  T+E T
Sbjct: 116 HWTVVRLALPTALARYVVEKGSITIDGVSLTVSALGRGVPGDDAQHWFEVSLIPTTLELT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
                + G ++N+EVD + +Y+ RL  L   +
Sbjct: 176 NLGGAEPGTIVNLEVDIVAKYVERLVTLKEEK 207


>gi|28897454|ref|NP_797059.1| riboflavin synthase subunit alpha [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260876414|ref|ZP_05888769.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260898685|ref|ZP_05907181.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260899220|ref|ZP_05907615.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ4037]
 gi|28805666|dbj|BAC58943.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308086938|gb|EFO36633.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308093013|gb|EFO42708.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308106683|gb|EFO44223.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ4037]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 125/205 (60%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V     + S +KLG SIA  G+CLTV+        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVIDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -NYYSADLSLETLKKTGFANYQVGEKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQEE 200


>gi|269962350|ref|ZP_06176700.1| Riboflavin synthase alpha chain [Vibrio harveyi 1DA3]
 gi|269832846|gb|EEZ86955.1| Riboflavin synthase alpha chain [Vibrio harveyi 1DA3]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/205 (36%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMADVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET   T  A++ +G  +NLE+++    R  GH+VSGH+DG   I+  + +
Sbjct: 57  -NYYSADLSLETLNKTGFAAYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGVIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVEMPAEITKYVAEKGSITVDGISLTVNDLRKNGFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQKEE 200


>gi|325109186|ref|YP_004270254.1| riboflavin synthase, subunit alpha [Planctomyces brasiliensis DSM
           5305]
 gi|324969454|gb|ADY60232.1| riboflavin synthase, alpha subunit [Planctomyces brasiliensis DSM
           5305]
          Length = 210

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 69/205 (33%), Positives = 111/205 (54%), Gaps = 12/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT-------SKMKLGCSIAHAGICLTVVRL 53
           MFTG+V   G++  +     G+RL++    +          ++LG S+A  G CLTVV  
Sbjct: 1   MFTGLVEGKGQVAELLQEEAGVRLKITPPESMRSADNSHPAVELGDSVAINGCCLTVVEF 60

Query: 54  SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
           +     D+ ++ +  +ET   TN+     G  +NLERS+    RL GH V GH+DG   +
Sbjct: 61  T-----DDRWDFQAGSETLSRTNLGRLQPGDPVNLERSLTAQARLGGHFVQGHVDGLGTV 115

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
             ++  G+ +     +P  L Q +  KGSV ++G+SLT+  VG  FF + LI HT+E+TT
Sbjct: 116 SRIEPEGEWVKMWFDVPAELAQLMVTKGSVTVDGISLTLVDVGDTFFSIALIPHTLEKTT 175

Query: 174 WKMHKVGDLINIEVDSMMRYIARLY 198
             +   GD +NIE D + +Y+ ++ 
Sbjct: 176 LSVRGPGDPVNIETDILGKYMQKML 200


>gi|302390232|ref|YP_003826053.1| riboflavin synthase, alpha subunit [Thermosediminibacter oceani DSM
           16646]
 gi|302200860|gb|ADL08430.1| riboflavin synthase, alpha subunit [Thermosediminibacter oceani DSM
           16646]
          Length = 215

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  +   + G  + V        +++G S+A  G+CLT   +      +
Sbjct: 1   MFTGIIEEVGVVTKLVGSSSGAMITVSCKKVLEDLRVGDSVAVNGVCLTARDVG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +V  ET R T ++    G  +NLER++K G R  GH+V GH+DG  +IL     G
Sbjct: 56  DFFVADVMPETFRSTALSELSAGKRVNLERALKAGGRFGGHIVLGHVDGVGKILKSHPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +  P  L +++  KGSV ++G+SLTV  V K+ F + +I HT+  T  +  K G
Sbjct: 116 NAVVIEIGAPLELMEYVVPKGSVAVDGISLTVQGVKKHGFMISIIPHTLRATALQYKKPG 175

Query: 181 DLINIEVDSMMRYI-ARLYALNTS 203
           D +N+E D + +Y+   L  +  S
Sbjct: 176 DKVNLETDIIGKYVREFLLTMRES 199


>gi|262404603|ref|ZP_06081158.1| riboflavin synthase alpha chain [Vibrio sp. RC586]
 gi|262349635|gb|EEY98773.1| riboflavin synthase alpha chain [Vibrio sp. RC586]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTIIVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGLGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELNKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTMDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   N  
Sbjct: 176 GRRVNLEVDVLARYMERLLQGNKE 199


>gi|317128515|ref|YP_004094797.1| riboflavin synthase, subunit alpha [Bacillus cellulosilyticus DSM
           2522]
 gi|315473463|gb|ADU30066.1| riboflavin synthase, alpha subunit [Bacillus cellulosilyticus DSM
           2522]
          Length = 215

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 111/203 (54%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  ++     + + +        + LG SIA  G+CLTV   +     D
Sbjct: 1   MFTGIIEEKGHVKTISQSGDSIVMEIKAKKILQDVHLGDSIAVNGVCLTVTTFN-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++ V++  ET R T++ +  +G+ +NLER++    R  GH VSGH+DG   I       
Sbjct: 56  HYFTVDMMPETVRNTSLKNLTVGSKVNLERAMAANGRFGGHFVSGHVDGVGTIRKKRPEH 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +   L +++ +KGS+ ++G SLT+  +  + F + +I HTI+ET       G
Sbjct: 116 NAVYYEIEVSSKLRKYMMMKGSITVDGTSLTIFGLSDDTFTISIIPHTIQETIIGDKGPG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +YI  L    T+
Sbjct: 176 DIVNVECDMLAKYIEELIIQRTN 198


>gi|227542161|ref|ZP_03972210.1| riboflavin synthase subunit alpha [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227181990|gb|EEI62962.1| riboflavin synthase subunit alpha [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 215

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/213 (31%), Positives = 110/213 (51%), Gaps = 16/213 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G I  +      + L V        +  G SI+  G+CLTV   ++E    
Sbjct: 1   MFTGLVEEVGHIARLEAADDSVILTVNADTVLDGVHTGDSISVNGVCLTVTAFTDES--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ +V  E+   +N+ +    + +NLER+ +LG RL GHLV GH+DG   +L      
Sbjct: 58  --FQADVMKESLDRSNLGALSERSPVNLERAAELGSRLGGHLVQGHVDGVATLLERTPGS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----------FFDVLLIRHTI 169
                R +LP  L +++  KGS+C+NG SLTV+ V              +F+V LI  T+
Sbjct: 116 HWEVFRFTLPAALSRYVVEKGSICVNGTSLTVSGVSATGTLTEGNTSDAWFEVSLIPTTL 175

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
            +T     + GD +NIEVD + +Y+ ++   +T
Sbjct: 176 RDTNLGTLEPGDSVNIEVDVIAKYVEKMLTPDT 208


>gi|323484046|ref|ZP_08089416.1| hypothetical protein HMPREF9474_01165 [Clostridium symbiosum
           WAL-14163]
 gi|323402488|gb|EGA94816.1| hypothetical protein HMPREF9474_01165 [Clostridium symbiosum
           WAL-14163]
          Length = 218

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 61/198 (30%), Positives = 95/198 (47%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +        L +         K G SIA  GICLTV  L       
Sbjct: 1   MFTGIVEEMGIVRGIVRGRYSAALDIQARTVLEGTKTGDSIAVNGICLTVTSL-----PA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +     G  +NLER++    R  GH+V+GH DG   I  +    
Sbjct: 56  GGFTADVMHETLDRSALLGLRRGMHVNLERAMPAAGRYGGHIVAGHADGVGTITRIRRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +++  +     + ++I  KGSV ++G+SLTV       F V +I HT+  T     +VG
Sbjct: 116 TAVWYTVRAEPAILRYIVEKGSVTIDGISLTVAQTDTVSFSVSVIPHTLRVTVLGERRVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +Y+ +L 
Sbjct: 176 DSVNLETDIIAKYLEKLV 193


>gi|315646376|ref|ZP_07899494.1| riboflavin synthase, alpha subunit [Paenibacillus vortex V453]
 gi|315278019|gb|EFU41339.1| riboflavin synthase, alpha subunit [Paenibacillus vortex V453]
          Length = 222

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 107/204 (52%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG++  +    + M L +  S     +KLG S++  G+CLT   +       
Sbjct: 1   MFTGLVEEIGEMRRIGRKGEAMLLSISASRIMEDLKLGDSVSVNGVCLTATTIDR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R TN+     G  +NLER++  G R  GH+V GH+DG   I  +    
Sbjct: 56  GIFTVDVMPETYRNTNLKELQPGGKVNLERAMAAGGRFGGHIVQGHVDGVGVIRSVQADQ 115

Query: 121 DSMYCRLSL-PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++   ++    +L ++I  KGSV L+G+SLTV     + F V +I HT+ ET     K 
Sbjct: 116 NAVVYEIAPSQDDLFKYIIPKGSVTLDGISLTVVKTTDSSFTVSIIPHTLAETVLAYKKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD INIE D + +Y+  L    + 
Sbjct: 176 GDTINIECDILGKYVDHLLHYGSE 199


>gi|317051271|ref|YP_004112387.1| riboflavin synthase subunit alpha [Desulfurispirillum indicum S5]
 gi|316946355|gb|ADU65831.1| riboflavin synthase, alpha subunit [Desulfurispirillum indicum S5]
          Length = 222

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 69/206 (33%), Positives = 110/206 (53%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G ++++     G  + V  ++  S +K G SIA  G+CLTV R        
Sbjct: 1   MFTGIIEEVGNVLSIHRSNSGAIISVGCNHVLSGVKDGDSIAVNGVCLTVTRHDSA---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ ++  E+ R+T++     G  +N+ER++    R DGH+V+GH+D T +I+ +   G
Sbjct: 57  -GFQADISNESLRVTSLGQLKSGDGVNVERAMAATGRFDGHMVAGHVDTTAQIMDISRDG 115

Query: 121 DSMYCRLS-LPHNLEQFIAVKGSVCLNGVSLTVNLVGKN--FFDVLLIRHTIEETTWKMH 177
           +S   RL        ++   +GS  ++GVSLTV  V      F   LI H+   TT    
Sbjct: 116 NSWKFRLRLHQPECIRYFIERGSASIDGVSLTVFDVDTATASFTFNLIPHSQSLTTLTTK 175

Query: 178 KVGDLINIEVDSMMRYIARLYALNTS 203
           K GD++NIE D + +YI RL    TS
Sbjct: 176 KSGDVVNIECDLVAKYIERLLGFGTS 201


>gi|257153159|dbj|BAI23134.1| riboflavin synthase [Bartonella washoensis]
          Length = 205

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 97/201 (48%), Positives = 133/201 (66%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFT I+TDIG +  +  + KG+ L + T Y+   +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTEIITDIGCVEDVQSLNKGVHLNISTRYDMESLEIGASIACSGICLTIVERGSKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W ET R+TN+A W  GTF+NLERS++LGD + GHLVSGHIDG  EI+     G
Sbjct: 61  HWFAVEAWEETLRLTNLAQWTKGTFVNLERSLRLGDEMGGHLVSGHIDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P  L  FI  KGS+ LNG SLTVN V    FDVL+IRHT++ TTW   K+G
Sbjct: 121 DAVRFFLQVPTRLMPFIVNKGSIALNGTSLTVNCVEDRIFDVLIIRHTLQMTTWGQAKIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D + RY A+L    
Sbjct: 181 DQVNLEIDQLARYAAKLSGFK 201


>gi|171315489|ref|ZP_02904725.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria MEX-5]
 gi|171099326|gb|EDT44064.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria MEX-5]
          Length = 207

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 119/211 (56%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESIDPLGAWPDAGVRLTVQAGGLDLADVALGDSIAIQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  -----TGFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTVDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  K GD +N+E+D + RY+ R+ + + 
Sbjct: 174 TTLRHVKAGDKVNLEIDMIARYVERMLSASQ 204


>gi|168702404|ref|ZP_02734681.1| riboflavin synthase subunit alpha [Gemmata obscuriglobus UQM 2246]
          Length = 200

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 65/199 (32%), Positives = 99/199 (49%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G + A+T    G RL V        +++G S++  G CLTVV         
Sbjct: 1   MFTGLVQALGTVRAVTDGQGGRRLSVAEPALAPGLRIGDSVSVCGACLTVVSRD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
              + EV  ET   T +     G  +NLE ++++GD L GH V+GH+D    +L     G
Sbjct: 56  AALDFEVGPETLAKTTLGGLTPGDRVNLEGALRVGDALGGHFVTGHVDCVGRVLEERVTG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           + +      P      +  KGSV ++GVSLTV     +   V+LI HT   TT    K G
Sbjct: 116 EWLTIWFGFPAEFGDLLVSKGSVAVDGVSLTVVDAEADRLSVMLIPHTRTHTTLGYKKPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+E D + +++ +L+ 
Sbjct: 176 DAVNLEFDLLAKHVKKLFG 194


>gi|281491488|ref|YP_003353468.1| riboflavin synthase subunit alpha [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375206|gb|ADA64719.1| Riboflavin synthase, alpha chain [Lactococcus lactis subsp. lactis
           KF147]
          Length = 216

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 68/197 (34%), Positives = 114/197 (57%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG++  +    K  ++ +  S     MKLG SI+  G+CLT+   +++    
Sbjct: 1   MFTGIIEEIGEVSRLQKREKSFKISIRASLILEDMKLGDSISTNGLCLTISEFNQKE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  E+   +N  +  +G  +NLER++ L  R  GH+VSGHIDG  +IL +    
Sbjct: 58  --FTADIMPESLNRSNFGTLNVGAKVNLERAMSLNGRFGGHIVSGHIDGVGQILEVKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    NL ++I  KGS+ ++G+SLTV  V    F V +I HT++ET     KVG
Sbjct: 116 NAIWFEIKTSLNLMRYIVEKGSITIDGISLTVAQVKSKSFSVSIIPHTLKETIMADKKVG 175

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E D + +YI +L
Sbjct: 176 DTVNLENDILGKYIEKL 192


>gi|254253007|ref|ZP_04946325.1| Riboflavin synthase alpha chain [Burkholderia dolosa AUO158]
 gi|124895616|gb|EAY69496.1| Riboflavin synthase alpha chain [Burkholderia dolosa AUO158]
          Length = 209

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 117/208 (56%), Gaps = 16/208 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIETIKPLGASPDAGVRLTVHAGGLDLADVALGDSIAIQGACMTVIDKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DTAFDVDVSRESLNRTVG--LAEPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYA 199
           TT +  K GD +N+EVD + RY+ R+ +
Sbjct: 174 TTLRHLKSGDKVNLEVDMIARYVERMLS 201


>gi|262166345|ref|ZP_06034082.1| riboflavin synthase alpha chain [Vibrio mimicus VM223]
 gi|262026061|gb|EEY44729.1| riboflavin synthase alpha chain [Vibrio mimicus VM223]
          Length = 217

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTMDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   +  
Sbjct: 176 GRRVNLEVDVLARYMERLLQGSKE 199


>gi|300855386|ref|YP_003780370.1| riboflavin synthase subunit alpha [Clostridium ljungdahlii DSM
           13528]
 gi|300435501|gb|ADK15268.1| riboflavin synthase alpha chain [Clostridium ljungdahlii DSM 13528]
          Length = 217

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 80/204 (39%), Positives = 125/204 (61%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG+I+ ++      ++ +        +KLG SIA  G C+TVV L +     
Sbjct: 1   MFTGLVEEIGEILKISRGRNSSKVSIKVGNLLDGVKLGDSIAVNGTCVTVVDLKK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V++ AET R++++    IG+ +NLER+++LGDRL GH+VSGHIDGT +I+ +    
Sbjct: 56  NSFTVDIMAETLRMSSLKDLKIGSKVNLERALRLGDRLGGHIVSGHIDGTGKIVDVREED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S +  +   ++L ++I  KGSV ++GVSLTV  + KN F V LI HT  ET     K+G
Sbjct: 116 ISTWIDIEASYDLLRYIVRKGSVTIDGVSLTVAELNKNCFSVSLIPHTKMETILDYKKIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+NIE D + +Y+ ++      +
Sbjct: 176 DLVNIECDLIGKYVEKMVLNPKKE 199


>gi|328472536|gb|EGF43399.1| riboflavin synthase subunit alpha [Vibrio parahaemolyticus 10329]
          Length = 217

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 125/205 (60%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V     + S +KLG SIA  G+CLTV+        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGKLDMSDVKLGDSIATNGVCLTVIDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N+Y  ++  ET + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -NYYSADLSLETLKKTGFANYQVGEKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEVSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQEE 200


>gi|313127501|ref|YP_004037771.1| riboflavin synthase, alpha subunit [Halogeometricum borinquense DSM
           11551]
 gi|312293866|gb|ADQ68326.1| riboflavin synthase, alpha subunit [Halogeometricum borinquense DSM
           11551]
          Length = 203

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/199 (36%), Positives = 112/199 (56%), Gaps = 3/199 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G ++A T    G RLR+        ++ G SIA +G+CLTV   S +    
Sbjct: 1   MFTGIVEGTGVVVAATDDDGGRRLRLSPDVTFEDLRHGQSIAVSGVCLTVEDYSTDEQ-- 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++V + AET   T +     G  +NLER++    RLDGH+V GH+D T  +  ++ +G
Sbjct: 59  -WFDVFLAAETVEKTYLGDVSEGDRVNLERALPADGRLDGHIVQGHVDTTTTVTGIERVG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D  +    LP  L +++  KGSVCL+G+SLTV    ++ F V +I  T + TT     VG
Sbjct: 118 DDWFFEFDLPEELGKYVVAKGSVCLDGISLTVADRRESDFAVAIIPTTYDLTTLSEKSVG 177

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +++EVD + +Y+  + +
Sbjct: 178 DPVHVEVDVVAKYVENMVS 196


>gi|118617423|ref|YP_905755.1| riboflavin synthase subunit alpha [Mycobacterium ulcerans Agy99]
 gi|183982234|ref|YP_001850525.1| riboflavin synthase alpha chain RibC [Mycobacterium marinum M]
 gi|118569533|gb|ABL04284.1| riboflavin synthase alpha chain RibC [Mycobacterium ulcerans Agy99]
 gi|183175560|gb|ACC40670.1| riboflavin synthase alpha chain RibC [Mycobacterium marinum M]
          Length = 207

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 115/206 (55%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I   + +    RL +     T+    G SIA  G+CLTVV +      D
Sbjct: 1   MFTGIVEELGEITDRSTLTDAARLTIRGPIVTADAGHGDSIAVNGVCLTVVEV----LAD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   +N+    +G+ +NLER+  +  RL GH+V GH+DGT EI+      
Sbjct: 57  GQFTADVMAETLNRSNLGELQVGSQVNLERAAAVNSRLGGHIVQGHVDGTGEIIARSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIQVPATVARYVVEKGSITVDGISLTVSDLGAQPRDWFEVSLIPTTRELTTLGQA 176

Query: 178 KVGDLINIEVDSMMRYIARLYALNTS 203
            VG  +N+EVD + +Y+ RL     +
Sbjct: 177 PVGTQVNLEVDVIAKYVERLMQSGPT 202


>gi|117923483|ref|YP_864100.1| riboflavin synthase subunit alpha [Magnetococcus sp. MC-1]
 gi|117607239|gb|ABK42694.1| riboflavin synthase, alpha subunit [Magnetococcus sp. MC-1]
          Length = 223

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 70/202 (34%), Positives = 110/202 (54%), Gaps = 9/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G++ A+       +L V +    +++KLG SIA +G CLTV ++       
Sbjct: 1   MFTGLIETVGQVAALRKGHGEWQLSVQSDLPMAEVKLGDSIAVSGACLTVTQM-----AG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VEV  E+   T  A+  +G  +NLER++++G RLDGHLV GH+D    +      G
Sbjct: 56  RQFTVEVSQESVAKTTFAALQVGAAVNLERALRMGGRLDGHLVQGHVDAVGWLESQQPRG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEETTWKM 176
            SM     +P  + ++I  KGS+ ++G+SLTVN V        F + +I  T  +TT   
Sbjct: 116 GSMELWFRVPGEIGRYIIPKGSIAIDGISLTVNQVADGEDATRFSINVIPLTQRKTTLGG 175

Query: 177 HKVGDLINIEVDSMMRYIARLY 198
             VG  +N+E D + RY+ RL 
Sbjct: 176 LAVGGRVNVETDLLGRYVERLL 197


>gi|302036979|ref|YP_003797301.1| riboflavin synthase subunit alpha [Candidatus Nitrospira defluvii]
 gi|300605043|emb|CBK41376.1| Riboflavin synthase, alpha subunit [Candidatus Nitrospira defluvii]
          Length = 218

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 113/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G +  +     G RL ++ S   S + +G S++  G CLT V  +     D
Sbjct: 1   MFSGIVEEMGAVSILNKGLAGTRLTIIASTIMSDLTIGASVSVNGTCLTAVART-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET  +T +     G+ +NLER++KL +R+ GH+VSGH+DG   I      G
Sbjct: 56  HDFSVDVSPETLAVTTLGGLTSGSPVNLERAMKLNERIGGHMVSGHVDGIGAIRSRHQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +  P  + +    KGS+ ++G+SLT+N V +  F V +I HT   TT  + +VG
Sbjct: 116 NALILEIEAPKEIVRLCVPKGSITVDGISLTINEVTERSFVVSIIPHTATVTTLGLKQVG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E D + +Y+ RL    
Sbjct: 176 DKLNLESDLIGKYVERLLQER 196


>gi|73540479|ref|YP_294999.1| riboflavin synthase subunit alpha [Ralstonia eutropha JMP134]
 gi|72117892|gb|AAZ60155.1| Lumazine-binding protein [Ralstonia eutropha JMP134]
          Length = 209

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 81/213 (38%), Positives = 123/213 (57%), Gaps = 18/213 (8%)

Query: 1   MFTGIVTDIGKIIAMTPIAK------GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRL 53
           MFTGIV  +G+I  +TP+        G+RLRV     + S + +G SIA  G C+TV+ +
Sbjct: 1   MFTGIVAAVGRIETVTPLGSDSAADTGVRLRVAAGGLDLSDVVIGDSIAIQGACMTVIAM 60

Query: 54  SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
           +      + ++VEV  E+   T      +   +NLE++++L DRL GHLVSGH+DG  E+
Sbjct: 61  T-----ADSFDVEVSRESLNKTVG--LELAGRVNLEKALRLADRLGGHLVSGHVDGLGEV 113

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTI 169
           +    +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+
Sbjct: 114 VHFAPVGESHELRIRAPRELGRYLAYKGSVVINGVSLTVNRVTDEADGCVFSINLIPHTL 173

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           E TT +  K G  +N+E+D + RY+ R+ +   
Sbjct: 174 EVTTLQELKAGSRVNLEIDLIARYVERMLSAAK 206


>gi|254775812|ref|ZP_05217328.1| riboflavin synthase subunit alpha [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 199

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A   +A   RL +  +  T+    G SIA  G+CLTV  L      D
Sbjct: 1   MFTGIVEELGEVTARDVLADAARLTIRGAVVTADAGHGDSIAVNGVCLTVAEL----LPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  L  RL GH+V GH+DGT  I+      
Sbjct: 57  GRFTADVMGETLNRSNLGALQVGSRVNLERAAALNSRLGGHIVQGHVDGTGRIVARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEVPPEVARYVVEKGSITVDGISLTVSGLGGEPRDWFEVSLIPTTRELTTLGGA 176

Query: 178 KVGDLINIEVDSMMRYIARLYA 199
            VG  +N+EVD + +Y+ RL +
Sbjct: 177 PVGTQVNLEVDVIAKYVERLMS 198


>gi|332976012|gb|EGK12883.1| riboflavin synthase subunit alpha [Psychrobacter sp. 1501(2011)]
          Length = 200

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 79/205 (38%), Positives = 120/205 (58%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G + ++T +   +RL + +   + S +KLG SIA  GICLTVV +S     
Sbjct: 1   MFTGIIESTGTLKSITELGGDVRLAIESDNLDFSDVKLGDSIASNGICLTVVEMS----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +N Y V+V  ET   T + +W  G  +NLE+++    R  GH+VSGH+DG  +I  +   
Sbjct: 56  NNGYSVDVSRETLAKTAMGNWQQGDTLNLEKAMLPTTRFGGHMVSGHVDGVGKIELMKED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK-MHK 178
             S+Y  +++P  L+++ A KGS+ ++G+SLT NLV  N   + +I HT E T      K
Sbjct: 116 ARSIYIEIAIPEALKKYAATKGSITVDGISLTTNLVKDNIVCLNIIPHTAEVTNIGRHWK 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
           VG  +NIEVD + RY+ RL ++   
Sbjct: 176 VGGPVNIEVDLIARYLERLTSVAAE 200


>gi|77361289|ref|YP_340864.1| riboflavin synthase subunit alpha [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876200|emb|CAI87422.1| Riboflavin synthase subunit E [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 217

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 114/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI  +      + +RV +   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEATGKIALLQKKQGDLAIRVQSPDLDMSDVKLGDSIATNGVCLTVVD-----KH 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  ++  ET  +T  A + +G  +NLE++++   RL GHLVSGH+DG   I  +   
Sbjct: 56  TDGFSADLSNETIDLTGFAHYTLGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITAITPN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   NL ++I  KGSVC++G+SLTVN V  N F + ++ HT E+TT    KV
Sbjct: 116 ARATEYWLTTDENLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSEQTTIANFKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTQVNLEVDQIARYLERLI 194


>gi|302879547|ref|YP_003848111.1| riboflavin synthase, alpha subunit [Gallionella capsiferriformans
           ES-2]
 gi|302582336|gb|ADL56347.1| riboflavin synthase, alpha subunit [Gallionella capsiferriformans
           ES-2]
          Length = 198

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 81/200 (40%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+GI+ D+G I        G+RL V         +++G SIA  G+CLTVV LS     
Sbjct: 1   MFSGIIADVGIITRAVDREGGLRLSVEAEVLGMDDVQIGDSIAVNGVCLTVVTLSGRE-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T +     G  +NLE++++L DRL GHLVSGH+DG   ++  + I
Sbjct: 59  ---FTVDVSRETLSCT-VGLAHQGAHVNLEKALRLSDRLGGHLVSGHVDGVGSVVAFNDI 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P +L ++IAVKGS+ +NGVSLTVN V    F+V LI HT++ TT    K 
Sbjct: 115 GESWRLVVRAPQSLAKYIAVKGSITINGVSLTVNHVAGAEFEVNLIPHTLDVTTLNELKT 174

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+E+D + RY+ R+  
Sbjct: 175 GAQVNLEIDLIARYVERMMQ 194


>gi|218888178|ref|YP_002437499.1| riboflavin synthase subunit alpha [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759132|gb|ACL10031.1| riboflavin synthase, alpha subunit [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 230

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 108/199 (54%), Gaps = 1/199 (0%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G I+A+    K  RLR+   +  S + +G SIA  G+CLT V         
Sbjct: 1   MFTGIIQGQGGIVAVESAGKETRLRIRPLFMLSDIVVGESIAANGVCLT-VETHGGSRDA 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            WY     AET R+T +A    G  +NLER++ +GDRL GH+V+GH+D    +  +   G
Sbjct: 60  AWYTCYASAETMRLTTLADLKTGDRVNLERALAMGDRLGGHMVTGHVDCVATVAEVREEG 119

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   +L  P      +  KGSV L+GVSLTVN  G +F +V +I  T   TT    K G
Sbjct: 120 ESRRYQLKFPQEFGPQVIPKGSVALDGVSLTVNHCGPDFLEVNVIPETQRVTTIAGWKPG 179

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R+ +
Sbjct: 180 VRVNMETDLIGKYVQRMLS 198


>gi|92117362|ref|YP_577091.1| riboflavin synthase subunit alpha [Nitrobacter hamburgensis X14]
 gi|91800256|gb|ABE62631.1| riboflavin synthase, alpha subunit [Nitrobacter hamburgensis X14]
          Length = 202

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 124/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  +T  A+G   RLR++  Y+ S + +G SIA  G+CLT V  S    
Sbjct: 1   MFTGIVTDIGEIENLTQTAQGRLHRLRILCRYDQSTIAVGASIACNGVCLTTVA-SGVAD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W++V+V AET  +T    W  GT +NLER++K+GD L GH+V+GH DG   I+  D 
Sbjct: 60  GRTWFDVDVGAETLDVTTAKHWAAGTRLNLERALKIGDELGGHIVAGHADGIAAIVARDD 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +       L    +L +FIA KGSV L+GVSLTVN V    F VL+I HT+  TT  + +
Sbjct: 120 LHGMARFELRTNRDLARFIAAKGSVTLDGVSLTVNTVRDEAFSVLIIPHTLSSTTLSVWR 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  +NIEVD M RY ARL  + 
Sbjct: 180 AGSEVNIEVDMMARYAARLSEMK 202


>gi|304391941|ref|ZP_07373883.1| riboflavin synthase, alpha subunit [Ahrensia sp. R2A130]
 gi|303296170|gb|EFL90528.1| riboflavin synthase, alpha subunit [Ahrensia sp. R2A130]
          Length = 200

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 95/203 (46%), Positives = 131/203 (64%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I ++  + +G R  V T+Y+   + +G SIAHAG+CLTVV   +     
Sbjct: 1   MFTGIITDIGTIESVEQLPQGRRFTVATAYDVDGIDIGASIAHAGVCLTVVEKGQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+VE W E  R+T  A W +GT +NLER++K+GD L GH+V+GH+DG   ++ +   G
Sbjct: 56  GTYQVEAWEEALRLTTAADWTMGTRLNLERALKVGDELGGHIVAGHVDGMANVVSVKDEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D+    L  P NL +FIA KGSV L+G SLTVN +    FDVLLI H++  TTW   K G
Sbjct: 116 DATRFTLEAPENLARFIAEKGSVALDGTSLTVNGIDGVRFDVLLITHSLSVTTWGYMKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E+D+M RY ARL    ++
Sbjct: 176 DRVNLEIDTMARYAARLAEFPST 198


>gi|227833016|ref|YP_002834723.1| Riboflavin synthase alpha chain [Corynebacterium aurimucosum ATCC
           700975]
 gi|262182496|ref|ZP_06041917.1| Riboflavin synthase alpha chain [Corynebacterium aurimucosum ATCC
           700975]
 gi|227454032|gb|ACP32785.1| Riboflavin synthase alpha chain [Corynebacterium aurimucosum ATCC
           700975]
          Length = 212

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 70/212 (33%), Positives = 111/212 (52%), Gaps = 13/212 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG++ ++ P    +RL +  S   S  +LG SIA  G+CLTV  L E     
Sbjct: 1   MFTGLVEEIGRVDSVEPQGDAVRLGIAASTVLSDAQLGDSIAVNGVCLTVAELGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   +++    +G  +NLER+V    RL GH+V GH+DGT  +L      
Sbjct: 56  GTFTADVMKESLNRSSLGELEVGAPVNLERAVLPTTRLGGHIVQGHVDGTGTLLSRTPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF--------FDVLLIRHTIEET 172
                R SLP  L +++  KGS+ + G SLTV+ +            F+V LI  T+ +T
Sbjct: 116 HWEVLRFSLPAELARYVVEKGSIAVQGTSLTVSALADGQGEPDAEAFFEVSLIPTTLRDT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            +   K G  +N+EVD + +Y+ ++   N  +
Sbjct: 176 VFGSMKPGARVNLEVDVVAKYVEKMVHPNAHR 207


>gi|253998344|ref|YP_003050407.1| riboflavin synthase subunit alpha [Methylovorus sp. SIP3-4]
 gi|253985023|gb|ACT49880.1| riboflavin synthase, alpha subunit [Methylovorus sp. SIP3-4]
          Length = 201

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +  +   ++L +  T+ N   + +G SI   G+CLT V LS  H  
Sbjct: 1   MFTGIIQAVGRIEKVDTLGSDVKLTIDATALNLGDVAIGDSICVNGVCLTAVSLSPSH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++  V  ET   T          +NLE++++  DRL GH+VSGH+DG  +++  +  
Sbjct: 59  ---FQAHVSRETLNCTVGLDNVKP--VNLEKALRFSDRLGGHIVSGHVDGVGQVVRFEPA 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD M   +  PH + ++IA+KGS+ ++GVSLTVN V  + F V LI HTIE T  K   V
Sbjct: 114 GDCMLLAVRAPHAISRYIAIKGSITIDGVSLTVNSVDGDVFSVNLIPHTIEVTALKSLGV 173

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ R+    T 
Sbjct: 174 GSRVNLEVDMIARYVERMAQWKTE 197


>gi|220925140|ref|YP_002500442.1| riboflavin synthase subunit alpha [Methylobacterium nodulans ORS
           2060]
 gi|219949747|gb|ACL60139.1| riboflavin synthase, alpha subunit [Methylobacterium nodulans ORS
           2060]
          Length = 213

 Score =  171 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 88/210 (41%), Positives = 124/210 (59%), Gaps = 9/210 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G++IA+    +  R+ + ++Y+ + + LG SIA +G CLT V +   H   
Sbjct: 1   MFTGLVSDVGRVIAVEGGERLRRITIESAYDPATIALGASIACSGPCLTAVEV-VPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID--------GTVE 112
             + V+  AET   T +  WG GT +NLERS+++GD L GHLV+GH+D          V 
Sbjct: 60  CRFSVDAAAETLARTTVGRWGPGTRVNLERSLRMGDELGGHLVTGHVDGLAEIVAREAVT 119

Query: 113 ILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEET 172
               D    S    L  P +L +FIA KGSV L+G SLTVN V  + F +LLI HT+  T
Sbjct: 120 GDGSDGWAPSDRFVLRAPASLSRFIAEKGSVSLDGTSLTVNGVEGDTFTILLIPHTLAVT 179

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TW   +VGD +N+EVD + RY ARL   + 
Sbjct: 180 TWGERRVGDAVNLEVDLIARYAARLTEAHA 209


>gi|115350874|ref|YP_772713.1| riboflavin synthase subunit alpha [Burkholderia ambifaria AMMD]
 gi|115280862|gb|ABI86379.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria AMMD]
          Length = 209

 Score =  171 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 119/210 (56%), Gaps = 16/210 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVHAGGLDLADVALGDSIAIQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  -----TGFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           TT +  K GD +N+E+D + RY+ R+ + +
Sbjct: 174 TTLRHVKAGDKVNLEIDMIARYVERMLSAS 203


>gi|258620987|ref|ZP_05716021.1| Riboflavin synthase alpha chain [Vibrio mimicus VM573]
 gi|258586375|gb|EEW11090.1| Riboflavin synthase alpha chain [Vibrio mimicus VM573]
          Length = 217

 Score =  171 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ A+ P    + + V     + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAVGKLTAIIPKGSDVTITVEVGKLDMADVKLGDSIATNGVCLTVVAFDSRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVELWVNMPAELSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   +  
Sbjct: 176 GRRVNLEVDVLARYMERLLQGSKE 199


>gi|168486050|ref|ZP_02710558.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC1087-00]
 gi|221231088|ref|YP_002510240.1| riboflavin synthase alpha chain [Streptococcus pneumoniae ATCC
           700669]
 gi|225853790|ref|YP_002735302.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae JJA]
 gi|183570847|gb|EDT91375.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC1087-00]
 gi|220673548|emb|CAR68034.1| riboflavin synthase alpha chain [Streptococcus pneumoniae ATCC
           700669]
 gi|225723407|gb|ACO19260.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae JJA]
 gi|332204190|gb|EGJ18255.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           GA47901]
          Length = 211

 Score =  171 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 116/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLEQTILKSKQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           + +N+E D + +Y+ +L 
Sbjct: 176 NTVNLENDILGKYVQKLM 193


>gi|116748818|ref|YP_845505.1| riboflavin synthase subunit alpha [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697882|gb|ABK17070.1| riboflavin synthase, alpha subunit [Syntrophobacter fumaroxidans
           MPOB]
          Length = 220

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 106/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G ++ +        + +   Y+   + LG SIA  G CLTVV         
Sbjct: 1   MFTGLIEGTGILLRLDRHGVDAGMVIKPRYSMGGLSLGESIAVDGACLTVVAF-----QG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V AET   T + S   G  +NLER++++GDRL GH+VSGH+DG   +      G
Sbjct: 56  ETFTADVSAETLSRTTLGSKQPGRRLNLERALRMGDRLGGHIVSGHVDGIGILRDRVREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S      LP  L +++  KGS+ +NG+SLTVN   +  FDV ++ HT  ETT    + G
Sbjct: 116 RSWRLFFELPEALSRYVIAKGSIAVNGISLTVNGCSRGRFDVNIVPHTAAETTIDDMQKG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +NIE D + +Y+ R+  
Sbjct: 176 DEVNIETDLIGKYVERMLG 194


>gi|103488467|ref|YP_618028.1| riboflavin synthase subunit alpha [Sphingopyxis alaskensis RB2256]
 gi|98978544|gb|ABF54695.1| riboflavin synthase, alpha subunit [Sphingopyxis alaskensis RB2256]
          Length = 205

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 81/204 (39%), Positives = 119/204 (58%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG I +        RL + T+++T+ + LG SIA +G CLTVV    + +  
Sbjct: 1   MFTGIITDIGTIRSREDRGDT-RLVIATAHDTATIDLGASIACSGACLTVVDKGRD-ADG 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V+  AET   T    W  G  +N+ER++K+GD L GH+V+GH+D    I+ ++ +G
Sbjct: 59  DWFAVDASAETLARTAPGMWDAGRRLNIERALKVGDELGGHIVTGHVDAVGRIVAVEPVG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHTIEETTWK 175
           DS+   +  P  L   IA KGS+ L+GVSLTVN V         F + +I HT   TT  
Sbjct: 119 DSVKLTVEAPAALAPHIAPKGSITLDGVSLTVNEVTDQPDGSAHFTLNIIPHTQAMTTLD 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYA 199
               G  +N+E+D + RY+AR+ A
Sbjct: 179 EAAAGRPVNLEIDILARYLARMQA 202


>gi|285019599|ref|YP_003377310.1| riboflavin synthase, alpha subunit protein [Xanthomonas albilineans
           GPE PC73]
 gi|283474817|emb|CBA17316.1| putative riboflavin synthase, alpha subunit protein [Xanthomonas
           albilineans]
          Length = 199

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 75/200 (37%), Positives = 114/200 (57%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A  P    +R    T S   + ++LG SIA  G+CLTV+        
Sbjct: 1   MFTGIIEGVGHLAARQPQGGDVRFTFATGSLPFADVQLGESIAVNGVCLTVIAFD----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++ +   ET  +T + +   G  +NLER+++  DRL GHLVSGH+DG   +L +   
Sbjct: 56  ADAFQADASTETLGLTTLGTLAEGAALNLERAMRPTDRLGGHLVSGHVDGLGRVLAIHHD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +   R + P  L ++IA KGS+C++GVSLTVN V  + F+V LI HT+  T +    V
Sbjct: 116 ARAQRWRFAAPSALLRYIAKKGSICVDGVSLTVNAVDADGFEVALIPHTVAHTAFAQTTV 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+E+D + RY+ RL  
Sbjct: 176 GAPVNLEIDLVARYVERLLQ 195


>gi|221632528|ref|YP_002521749.1| riboflavin synthase subunit alpha [Thermomicrobium roseum DSM 5159]
 gi|221157003|gb|ACM06130.1| riboflavin synthase, alpha subunit [Thermomicrobium roseum DSM
           5159]
          Length = 222

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTP-IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV +IG+++A+ P    G+RLR+         +LG SIA  G+CLTV  L+     
Sbjct: 2   MFTGIVEEIGRVLAIQPVSGGGLRLRIGCRTVVEGTRLGDSIAVDGVCLTVTDLAP---- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + ++VE+   T R + +    +G  +NLER++ +G R  GH V GH+D    I+ +   
Sbjct: 58  -DSFQVELQPVTVRRSTLGRIAVGDLVNLERALPVGGRFGGHYVQGHVDTVGRIVMMYRD 116

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++  R++ P    +++  +G + ++G SLTV     + F+V L+ +T E  T    + 
Sbjct: 117 GAALIVRIAAPAEAMRYVVERGFIAVDGASLTVQRRFPSEFEVSLVAYTQEHITLPRKRP 176

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G L+N+EVD + +Y+ +  AL  S
Sbjct: 177 GALVNLEVDIIAKYVEQFLALGAS 200


>gi|170750356|ref|YP_001756616.1| riboflavin synthase, alpha subunit [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656878|gb|ACB25933.1| riboflavin synthase, alpha subunit [Methylobacterium radiotolerans
           JCM 2831]
          Length = 207

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 90/207 (43%), Positives = 126/207 (60%), Gaps = 6/207 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G + +++     +R+ +  SY+ + + LG SIA AG CLT V + E  +  
Sbjct: 1   MFTGLVSDVGTVASVSGDGDLLRIAIRASYDPATIALGASIACAGPCLTAVSV-EPTAGG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+  AET   T + +W  GT INLERS+K+GD L GHLV+GH+DG  EI+  + + 
Sbjct: 60  CVFAVDAAAETLARTTVGAWVAGTRINLERSLKIGDELGGHLVTGHVDGVAEIVERETVT 119

Query: 121 DSMY-----CRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK 175
              +       L  P  L +FIA KGSVCL+G SLTVN V  + F VLLI HT++ TTW 
Sbjct: 120 ADAWGASERFTLRAPAALAKFIAEKGSVCLDGTSLTVNAVQGDLFSVLLIPHTLQVTTWG 179

Query: 176 MHKVGDLINIEVDSMMRYIARLYALNT 202
             + GD +N+EVD + RY ARL     
Sbjct: 180 ERRQGDRLNLEVDLIARYAARLTEARA 206


>gi|172059886|ref|YP_001807538.1| riboflavin synthase subunit alpha [Burkholderia ambifaria MC40-6]
 gi|171992403|gb|ACB63322.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria MC40-6]
          Length = 209

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 119/210 (56%), Gaps = 16/210 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVHAGGLDLADVALGDSIAIQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  -----TGFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           TT +  K GD +N+E+D + RY+ R+ + +
Sbjct: 174 TTLRNVKAGDKVNLEIDMIARYVERMLSAS 203


>gi|300858535|ref|YP_003783518.1| riboflavin synthase subunit alpha [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685989|gb|ADK28911.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302330805|gb|ADL20999.1| Riboflavin synthase alpha chain [Corynebacterium pseudotuberculosis
           1002]
          Length = 213

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 117/202 (57%), Gaps = 9/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GIV ++G ++++ P+   + L +          LG SIA  G+CLTV  + E     
Sbjct: 1   MFSGIVEEVGTMVSLEPLTDSIVLSIAAHKVLEGTSLGDSIAVNGVCLTVTDIQE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            ++  +V  E+   +++     GT +NLER+++   RLDGH+V GH+DGT E++  D   
Sbjct: 56  GFFSADVMQESLVRSSLGGLTAGTPVNLERALRADGRLDGHIVQGHVDGTAELISKDPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----KNFFDVLLIRHTIEETTWKM 176
                R +LP  L +++  KGS+ ++G SLTV+ +G     ++F+V LI  T++ TT   
Sbjct: 116 HWTVLRFTLPKELSRYVVEKGSISVDGTSLTVSGLGESEGNHWFEVSLIPTTLQSTTHGQ 175

Query: 177 HKVGDLINIEVDSMMRYIARLY 198
            ++GD +N+EVD + +Y+ R+ 
Sbjct: 176 CQLGDRVNLEVDVLAKYVERML 197


>gi|163803479|ref|ZP_02197351.1| riboflavin synthase subunit alpha [Vibrio sp. AND4]
 gi|159172739|gb|EDP57588.1| riboflavin synthase subunit alpha [Vibrio sp. AND4]
          Length = 217

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 77/205 (37%), Positives = 124/205 (60%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V     + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLTAITPKGEDITVTVEVGELDMSDVKLGDSIATNGVCLTVVDFG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D++Y  ++  ET   T  A++ +G  +NLE+++    R  GH+VSGH+DG   I+  + +
Sbjct: 56  DHYYSADLSLETLNKTGFAAYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGVIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVEMPAEIGKYVAEKGSITVDGISLTVNDLRKNGFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL   +  Q
Sbjct: 176 GRKVNLEVDVLARYMERLLQGHKEQ 200


>gi|41407237|ref|NP_960073.1| riboflavin synthase subunit alpha [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118462391|ref|YP_882548.1| riboflavin synthase subunit alpha [Mycobacterium avium 104]
 gi|41395588|gb|AAS03456.1| RibC [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118163678|gb|ABK64575.1| riboflavin synthase, alpha subunit [Mycobacterium avium 104]
          Length = 199

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 115/202 (56%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A   +A   RL +  +  T+    G SIA  G+CLTV  L      D
Sbjct: 1   MFTGIVEELGEVTARDVLADAARLTIRGAVVTADAGHGDSIAVNGVCLTVAEL----LPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  +  RL GH+V GH+DGT  I+      
Sbjct: 57  GRFSADVMGETLNRSNLGALQVGSRVNLERAAAVNSRLGGHIVQGHVDGTGRIVARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEVPPEVARYVVEKGSITVDGISLTVSGLGGEPRDWFEVSLIPTTRELTTLGGA 176

Query: 178 KVGDLINIEVDSMMRYIARLYA 199
            VG  +N+EVD + +Y+ RL +
Sbjct: 177 PVGTQVNLEVDVIAKYVERLMS 198


>gi|94311621|ref|YP_584831.1| riboflavin synthase subunit alpha [Cupriavidus metallidurans CH34]
 gi|93355473|gb|ABF09562.1| riboflavin synthase alpha chain [Cupriavidus metallidurans CH34]
          Length = 210

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 80/210 (38%), Positives = 120/210 (57%), Gaps = 15/210 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  +G+I +++P+     G+RLRV     + S + +G SIA  G C+TVV L   
Sbjct: 1   MFTGIVAAVGRIESVSPLGDVNAGVRLRVAAGDLDLSDVGIGDSIAIQGACMTVVTLG-- 58

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
                 ++V+V  E+   T          +NLE++++L DRL GHLVSGH+DG  E++  
Sbjct: 59  ---AGQFDVDVSRESLDKTVG--LDQPGRVNLEKALRLADRLGGHLVSGHVDGLGEVVRF 113

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEET 172
             +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+E T
Sbjct: 114 APVGESHELRIRAPRELGRYLAYKGSVVVNGVSLTVNNVSDEADGCVFSINLIPHTVEVT 173

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           T      G  +N+E+D + RY+ R+ + + 
Sbjct: 174 TLNELAPGKRVNLEIDLIARYVERMLSASA 203


>gi|300812785|ref|ZP_07093183.1| riboflavin synthase, alpha subunit [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300496237|gb|EFK31361.1| riboflavin synthase, alpha subunit [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 204

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 74/206 (35%), Positives = 116/206 (56%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MF+G+V+   +I  +    K + L V T   N + +K+G SIA  G CLTV   S+    
Sbjct: 1   MFSGLVSGKARIQRLEQEGKTIVLTVKTFPENLAGVKIGDSIAVNGCCLTVEAFSK---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + + V +  +T   T   +   G  +N+ERSV +G R +GH+VSGH+D TVE++ L   
Sbjct: 57  -DSFTVTMMPQTFAKTTFKNLQAGDQVNMERSVPVGGRFEGHIVSGHVDETVEVVDLKQN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            +++  R  LP  L++ +  +GSV +NG SLTV   G ++F V LI HT +ET     +V
Sbjct: 116 ENALELRFFLPDRLKKQVVPQGSVAINGTSLTVMNTGDDWFSVGLIPHTQDETNLSGLQV 175

Query: 180 GDLINIEVDSMMRYIA-RLYALNTSQ 204
           GD +N+E D + +Y+   L A   ++
Sbjct: 176 GDQVNLETDVLGKYVEANLAAFLKNE 201


>gi|225021366|ref|ZP_03710558.1| hypothetical protein CORMATOL_01385 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945748|gb|EEG26957.1| hypothetical protein CORMATOL_01385 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 193

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 66/200 (33%), Positives = 107/200 (53%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MF+GI+ +IG I  +TP     +L +  +  T+ +  G SIA  GICLTVV         
Sbjct: 1   MFSGIIEEIGTITTITPCGDSCKLHITAATVTTDIHSGDSIAVNGICLTVVDHDP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +     G  +NLER++ +  RL GH+V GH+D T  ++  +   
Sbjct: 56  TGFTADVMKETLDRSVLGHV--GDPVNLERALPVTGRLGGHIVQGHVDTTTTLIHREIGE 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R  LP  L +++  KGS+ +NG SLTV+ +G ++F+V LI  T+  T     + G
Sbjct: 114 HWHTLRFRLPPQLAKYVVEKGSIAINGTSLTVSAIGDDYFEVSLIPTTLTHTNLGTLQPG 173

Query: 181 DLINIEVDSMMRYIARLYAL 200
           D +N+E D + +++ +L A 
Sbjct: 174 DSVNLEADILAKHVEKLLAH 193


>gi|255264316|ref|ZP_05343658.1| riboflavin synthase, alpha subunit [Thalassiobium sp. R2A62]
 gi|255106651|gb|EET49325.1| riboflavin synthase, alpha subunit [Thalassiobium sp. R2A62]
          Length = 195

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 90/197 (45%), Positives = 127/197 (64%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG+++        +R R+ TSY+T+ + +G SIA  G+CLT ++L      D
Sbjct: 1   MFTGIITDIGEVVETEQRGD-LRARIKTSYDTATIDIGASIACDGVCLTAIKLG-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W++VE+ AE+   TN+ +W  G  +NLER++KLGD L GH+VSGH+DG  +++ +   G
Sbjct: 55  GWFDVEISAESVSKTNLTTWAPGKRLNLERALKLGDELGGHIVSGHVDGVAQVVDIKEEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT   TTW    +G
Sbjct: 115 DSTRVTLRAPEALAKFIAPKGSVALNGTSLTVNEVNGKDFGINFIPHTKVATTWGDVAMG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +N+E+D++ RY+ARL
Sbjct: 175 DPVNLEIDTLARYVARL 191


>gi|194290428|ref|YP_002006335.1| riboflavin synthase subunit alpha [Cupriavidus taiwanensis LMG
           19424]
 gi|193224263|emb|CAQ70272.1| RIBOFLAVIN SYNTHASE (ALPHA CHAIN) PROTEIN [Cupriavidus taiwanensis
           LMG 19424]
          Length = 207

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 81/212 (38%), Positives = 124/212 (58%), Gaps = 16/212 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++TP+      G+RLR+     + S + +G SIA  G C+TV+ ++ 
Sbjct: 1   MFTGIVAAVGRIESVTPLGAAADAGVRLRIAAGGLDLSDVIIGDSIAIQGACMTVIAMAP 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                + +EVEV  E+   T          +NLE++++L DRL GHLVSGH+DG  E++ 
Sbjct: 61  -----DAFEVEVSRESLDKTVG--LDRAGRVNLEKALRLADRLGGHLVSGHVDGLGEVVH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIRAPRELARYLAYKGSVVVNGVSLTVNRVADEADGCVFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
           TT +  K G  +N+E+D + RY+ R+ +   +
Sbjct: 174 TTLQELKPGARVNLEIDLIARYVERMLSAAQA 205


>gi|213963416|ref|ZP_03391671.1| riboflavin synthase, alpha subunit [Capnocytophaga sputigena Capno]
 gi|213953936|gb|EEB65263.1| riboflavin synthase, alpha subunit [Capnocytophaga sputigena Capno]
          Length = 194

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 110/199 (55%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGKI+ +      + L V +S+ T+++K+  S+AH G+CLTVV +       
Sbjct: 1   MFTGIIEEIGKIVRIEREQANLHLYVKSSF-TNELKIDQSVAHNGVCLTVVAID-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V   AET   T++ S  +G  +NLER + L  RLDGH+V GH D T     +    
Sbjct: 55  DVYRVTAIAETLAKTHLGSLQVGDAVNLERGMLLNTRLDGHIVQGHTDQTGTCSAIQEEA 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +    +  KGS+ +NGVSLTV    ++ F V +I +T+  T  +  ++G
Sbjct: 115 GSTRFTFEYDPSTGNVVIEKGSITVNGVSLTVVDATRDSFSVAVIPYTLAHTNLQHLQIG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
            ++N+E D + +Y+ARL  
Sbjct: 175 SIVNLEFDVIGKYVARLMQ 193


>gi|172040662|ref|YP_001800376.1| riboflavin synthase subunit alpha [Corynebacterium urealyticum DSM
           7109]
 gi|171851966|emb|CAQ04942.1| unnamed protein product [Corynebacterium urealyticum DSM 7109]
          Length = 198

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 62/198 (31%), Positives = 95/198 (47%), Gaps = 6/198 (3%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGI+ +IG +  +  +    R+RV  S   S   LG SI+  G+CLTV         D 
Sbjct: 4   FTGIIEEIGHVEKIESLPDAARIRVAASRVVSDADLGDSISVNGVCLTVTDFD-----DT 58

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V   T   T++ +   G  +NLER++    R  GH+V GH+DGT  +        
Sbjct: 59  GFTADVMKVTLDYTSLGTLSEGASVNLERAMSARGRFGGHVVQGHVDGTATLQDRVPSEH 118

Query: 122 SMYCRLS-LPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
               R       L  ++  KGS+ +NG SLT+  +    F+V LI  T+E T     + G
Sbjct: 119 WEVFRFQLDDPELATYLVKKGSIAINGTSLTIAELADGLFEVSLIPATLEATMLGELQPG 178

Query: 181 DLINIEVDSMMRYIARLY 198
           D +NIE D + +Y+  + 
Sbjct: 179 DKVNIECDVLAKYVRAML 196


>gi|225851426|ref|YP_002731660.1| riboflavin synthase subunit alpha [Persephonella marina EX-H1]
 gi|225645287|gb|ACO03473.1| riboflavin synthase, alpha subunit [Persephonella marina EX-H1]
          Length = 212

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 63/198 (31%), Positives = 109/198 (55%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G+I  +   + G+ + V         K+G SIA  G+CLTV  +       
Sbjct: 1   MFTGLIEEVGRITGIRYKSGGLSIDVKAEKILEGTKIGDSIAINGVCLTVTDI-----YS 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  ++  ET   T+     +G F+NLER++++ DRL GH+V GH+D T  I  +   G
Sbjct: 56  DGFSFDLSQETLNRTSFKDVKVGDFLNLERALRVSDRLGGHIVQGHVDTTGVITGISPSG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D     +  P +    +  KGS+ ++G+SLTVN +  +   + +I HTI+ T  +  KVG
Sbjct: 116 DHTIFTVQFPSDYRDLVVEKGSIAVDGISLTVNEINDSRVKINIIPHTIQNTNLRYRKVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++N+E D + +Y+  + 
Sbjct: 176 DVVNLEFDILGKYVLNML 193


>gi|206561396|ref|YP_002232161.1| riboflavin synthase subunit alpha [Burkholderia cenocepacia J2315]
 gi|198037438|emb|CAR53373.1| riboflavin synthase alpha chain [Burkholderia cenocepacia J2315]
          Length = 209

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 119/211 (56%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVIEKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DTTFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT++ 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNAVDDRADGCEFSINLIPHTVDV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  K GD +N+EVD + RY+ R+ + + 
Sbjct: 174 TTLRHVKAGDKVNLEVDMIARYVERMLSASQ 204


>gi|254507874|ref|ZP_05120004.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus 16]
 gi|219549247|gb|EED26242.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus 16]
          Length = 217

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 78/205 (38%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + + +KLG SIA  G+CLTVV  SE    
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDISVTVNAGKLDMADVKLGDSIATNGVCLTVVAFSE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y  ++  ET + T  A +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -NSYTADLSLETLQKTGFADYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVAMPQEIAKYVAEKGSITVDGISLTVNALRKNAFKLTIVPHTGEETTIADFNV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQQEQ 200


>gi|149179739|ref|ZP_01858244.1| riboflavin synthase subunit alpha [Bacillus sp. SG-1]
 gi|148851931|gb|EDL66076.1| riboflavin synthase subunit alpha [Bacillus sp. SG-1]
          Length = 218

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG I  +   +  M L ++       +KLG SI+  G CLTV   S      
Sbjct: 1   MFTGIIEEIGTIENLKKSSASMVLSILAKKVLEDVKLGDSISVNGTCLTVTSFSGRS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T++   G GT +NLER++    R  GH V+GH+DGT  I+   F+ 
Sbjct: 58  --FTVDVMPETFENTSLKLLGAGTKVNLERAMAANGRFGGHFVTGHVDGTGTIVSTQFVE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +P  L ++   +GSVCL+G SLTV  +G N   V LI  T  +T     KVG
Sbjct: 116 NALYITIEIPGELSRYFINRGSVCLDGTSLTVFEIGNNTITVSLIPQTRHDTILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++N+E D M +YI +      ++
Sbjct: 176 DIVNLECDMMAKYIYQFMNGGRTE 199


>gi|296395032|ref|YP_003659916.1| riboflavin synthase subunit alpha [Segniliparus rotundus DSM 44985]
 gi|296182179|gb|ADG99085.1| riboflavin synthase, alpha subunit [Segniliparus rotundus DSM
           44985]
          Length = 211

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 116/209 (55%), Gaps = 16/209 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G++  + P     +L +        +  G SIA  G+CLTVV    E    
Sbjct: 1   MFTGLVEELGEVAWLNPSGDAAQLAIRARVVVDGLGHGDSIAVNGVCLTVV----EQPEP 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET R T++ +   G+ ++LER++ LGDRL GHLV GH+DGT  +L      
Sbjct: 57  GMFVVDAMGETLRHTSVGALAPGSLVHLERALALGDRLGGHLVQGHVDGTGRVLSHTKGE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG------------KNFFDVLLIRHT 168
                R+SLP  L +++A KGS+ ++GVSLTV+ +G              +F+V LI  T
Sbjct: 117 QWDVVRISLPEELRKYVAHKGSITVDGVSLTVSAIGGPEQDGSADNEGITWFEVSLIPET 176

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARL 197
           I  TT   H  GD++N+EVD + +Y+ RL
Sbjct: 177 IRATTLGRHATGDVVNLEVDVIAKYVERL 205


>gi|269103254|ref|ZP_06155951.1| riboflavin synthase alpha chain [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163152|gb|EEZ41648.1| riboflavin synthase alpha chain [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 218

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 119/199 (59%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+TP    + + V +   + S +KLG SIA  G+CLTVV+L+ +   
Sbjct: 1   MFTGIIEAVGTITALTPKGADISVTVDSGKLDLSDVKLGDSIATNGVCLTVVQLTGK--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T  A++  G  +NLE+++    R  GH+VSGH+D   E++     
Sbjct: 58  --GYVADLSLETLKRTAFANYKAGQAVNLEKAMLPTTRFGGHMVSGHVDAVAEVIERTHT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P +L Q+IA KGS+ ++G+SLTVN +  + F + ++ HT  ETT +  KV
Sbjct: 116 GRAIEFWIKAPSHLAQYIAEKGSIAIDGISLTVNAIRGDEFKLTIVPHTAAETTMESFKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  INIEVD + RY+ RL 
Sbjct: 176 GRQINIEVDVIARYLERLM 194


>gi|258405544|ref|YP_003198286.1| riboflavin synthase subunit alpha [Desulfohalobium retbaense DSM
           5692]
 gi|257797771|gb|ACV68708.1| riboflavin synthase, alpha subunit [Desulfohalobium retbaense DSM
           5692]
          Length = 220

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G + A+       RLR+   ++ +  + G SIA  G+CLTV          
Sbjct: 1   MFTGLILGVGTVSALDKKGDESRLRIRPHFSLTDCEYGESIAVNGVCLTVETFGR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V   AET R +N+     G  +NLER++ +GDRL GHLVSGH+D    I  +   G
Sbjct: 56  DWFTVYASAETLRRSNLGGLRPGDAVNLERALAVGDRLGGHLVSGHVDCLARIEQITAAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S    L  P     F+  KGSVCL+G+SLTVN        V +I  T +ETT    +VG
Sbjct: 116 QSTAYTLGFPKQWGPFVVDKGSVCLDGISLTVNACTPTTLAVNIIPTTRKETTIASWQVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ ++ A
Sbjct: 176 SQVNMEVDIIGKYVQKMVA 194


>gi|56551371|ref|YP_162210.1| riboflavin synthase subunit alpha [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761017|ref|ZP_04759106.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753017|ref|YP_003225910.1| riboflavin synthase subunit alpha [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542945|gb|AAV89099.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374636|gb|EER64097.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552380|gb|ACV75326.1| riboflavin synthase, alpha subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 206

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 88/206 (42%), Positives = 123/206 (59%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+I ++T      R+R+ T Y    +  G SIA +G+CLTVV   +  +  
Sbjct: 1   MFTGIVTDIGEITSVTQEGD-RRIRIATEYPMDTVPTGSSIACSGVCLTVV--DKGTTPR 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NW+EV V  E+   T    W  G  +NLER++K+GD L GH+V+GH+DG  +++ +  +G
Sbjct: 58  NWFEVTVSGESVSRTAPGRWEKGQKLNLERALKIGDELGGHIVTGHVDGIGKVVSITAVG 117

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF----FDVLLIRHTIEETTWKM 176
           DS    +     +   IA KGSV L+GVSLTVN V        F + +I HT E+TT   
Sbjct: 118 DSHNFLIEAGPEVAPHIAEKGSVSLDGVSLTVNEVKDVDGKVLFSINIIPHTAEKTTLGD 177

Query: 177 HKVGDLINIEVDSMMRYIARLYALNT 202
            K GD +NIE+D + RY+AR+ AL  
Sbjct: 178 LKAGDFVNIEIDVLSRYLARMNALGN 203


>gi|323693356|ref|ZP_08107572.1| riboflavin synthase alpha subunit [Clostridium symbiosum WAL-14673]
 gi|323502600|gb|EGB18446.1| riboflavin synthase alpha subunit [Clostridium symbiosum WAL-14673]
          Length = 220

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/198 (30%), Positives = 95/198 (47%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +        L +         K G SIA  GICLTV  L       
Sbjct: 1   MFTGIVEEMGIVRGIVRGRYSAALDIQARTVLEGTKTGDSIAVNGICLTVTSL-----PA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +     G  +NLER++    R  GH+V+GH DG   I  +    
Sbjct: 56  GGFTADVMHETLDRSALLGLRRGMHVNLERAMPAAGRYGGHIVAGHADGVGTITRIRRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +++  +     + ++I  KGSV ++G+SLTV       F V +I HT+  T     +VG
Sbjct: 116 TAVWYTVRAEPAILRYIVEKGSVTIDGISLTVAKTDTVSFSVSVIPHTLRVTALGECRVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+E D + +Y+ +L 
Sbjct: 176 DSVNLETDIIAKYLEKLV 193


>gi|312883785|ref|ZP_07743504.1| riboflavin synthase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368534|gb|EFP96067.1| riboflavin synthase subunit alpha [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 216

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 75/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP  + + + +     + S +KLG SIA  G+CLTVV  ++    
Sbjct: 1   MFTGIIEAVGTLTELTPKGEDVSVTIDVGKLDMSDVKLGDSIAANGVCLTVVNFTQSS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET R T    + IG  +NLE+++    R  GH+VSGH+D   EI     +
Sbjct: 59  ---YSADLSLETLRKTGFNQYQIGRKLNLEKAMLPTTRFGGHIVSGHVDAVGEITERISV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G +    +S+P +L ++IA KGS+ ++GVSLTVN + K+ F + ++ HT +ETT    +V
Sbjct: 116 GRAWEFWVSVPADLTRYIAEKGSITVDGVSLTVNALRKDAFKLTIVPHTSKETTIASFEV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     S+
Sbjct: 176 GQAVNLEVDILARYMERLLTGRQSE 200


>gi|91217012|ref|ZP_01253975.1| riboflavin synthase subunit alpha [Psychroflexus torquis ATCC
           700755]
 gi|91184883|gb|EAS71263.1| riboflavin synthase subunit alpha [Psychroflexus torquis ATCC
           700755]
          Length = 197

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 105/203 (51%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++GKI  +      +   +  ++   ++K+  S+AH G+CLTVV +      D
Sbjct: 1   MFTGIIEEVGKISKIEVSKGNIDYTIQANF-AKELKIDQSVAHNGVCLTVVDIE-----D 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y+V    ET   +N+    IG +INLER +K+   LDGH+V GH+D T      +   
Sbjct: 55  GKYKVTAIEETLNKSNLNHLEIGHYINLERGMKMNAHLDGHIVQGHVDQTAVCQRAETKN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S     S    L      KGS+ +NGVSLTV     N F V +I  T E T +K    G
Sbjct: 115 GSWEYTFSYDPKLMNVTIEKGSITINGVSLTVVNSKLNEFSVAIIPFTYEHTNFKNLTEG 174

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D++N+E D + +Y+ RL  L  +
Sbjct: 175 DVVNLEFDVIGKYVKRLLELQNN 197


>gi|148380823|ref|YP_001255364.1| riboflavin synthase, alpha subunit [Clostridium botulinum A str.
           ATCC 3502]
 gi|148290307|emb|CAL84431.1| riboflavin synthase alpha chain [Clostridium botulinum A str. ATCC
           3502]
          Length = 216

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 113/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      
Sbjct: 1   MFTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFNS----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 56  NSFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 116 IATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D+INIE D + +YI +       +
Sbjct: 176 DIINIECDVLGKYIYKFMHFKKEE 199


>gi|308272934|emb|CBX29538.1| Riboflavin synthase alpha chain [uncultured Desulfobacterium sp.]
          Length = 221

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 78/203 (38%), Positives = 116/203 (57%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I ++    + G RL V T  N    ++G SIA  G CLTVV +  +   
Sbjct: 1   MFTGIIESLGTISSIRSSGRIGKRLAVETDINLDGTEIGDSIAVNGACLTVVEIERKR-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              ++V+V  ET   T + +   G   N+ER+++L DRLDGHLVSGHIDG  +I      
Sbjct: 59  ---FDVDVSPETLDKTILGNAKTGDRANIERALRLSDRLDGHLVSGHIDGIGKISRKKLT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+++     +P ++ ++I  KGSV ++GVSLTVN   + +F+V +I HT + TT  +   
Sbjct: 116 GNALIITFEVPVSVSRYIIKKGSVAVDGVSLTVNNCDEGWFEVSIIPHTAKLTTMGLKVE 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
            D +NIE D + +YI R     T
Sbjct: 176 NDPVNIETDMIGKYIERFVGSQT 198


>gi|261405998|ref|YP_003242239.1| riboflavin synthase subunit alpha [Paenibacillus sp. Y412MC10]
 gi|261282461|gb|ACX64432.1| riboflavin synthase, alpha subunit [Paenibacillus sp. Y412MC10]
          Length = 222

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG++  +    + M L +  +     +KLG S++  G+CLT   + +     
Sbjct: 1   MFTGLVEEIGEMRRIGRQGEAMLLSISANRIMDDLKLGDSVSVNGVCLTATAIDK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R TN+     G  +NLER++  G R  GH+V GH+DG   I  +    
Sbjct: 56  GVFTVDVMPETYRNTNLKELQPGGKVNLERAMAAGGRFGGHIVQGHVDGIGVIRSVKADQ 115

Query: 121 DSMYCRLSLPH-NLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++   +S  + ++ ++I  KGSV L+G+SLTV     + F V +I HT+ ET     K 
Sbjct: 116 NAVVYEISPANGDVFKYIIPKGSVTLDGISLTVVKTTDSSFTVSIIPHTLAETVLAYKKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD INIE D + +Y+  L    + 
Sbjct: 176 GDTINIECDILGKYVDHLLHYGSE 199


>gi|86741873|ref|YP_482273.1| riboflavin synthase subunit alpha [Frankia sp. CcI3]
 gi|86568735|gb|ABD12544.1| riboflavin synthase, alpha subunit [Frankia sp. CcI3]
          Length = 238

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/228 (31%), Positives = 110/228 (48%), Gaps = 29/228 (12%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH--- 57
           MFTGIV ++G + A+   ++   L +        +  G SIA  G+CLTV   +      
Sbjct: 1   MFTGIVEELGVVTAVDARSESAALTIACQTVLGDVSHGASIAVNGVCLTVTSFARPGLDG 60

Query: 58  --------------------SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDR 97
                                  + +  +V  ET   +++    +G  +NLER V+L DR
Sbjct: 61  GAETGTAGGPPGPPGPPGTTDGPSAFTADVMRETLVRSSLGKLAVGDRVNLERPVRLADR 120

Query: 98  LDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK 157
           L GHLV GH+DG   +L         + R++LP  L++++  KGSV ++GVSLTV  +  
Sbjct: 121 LGGHLVQGHVDGVGTVLDRQPGEGWEFVRVALPEGLDRYLVAKGSVTVDGVSLTVVDISP 180

Query: 158 N------FFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYA 199
                   F V LI  T+E TT      G L+NIEVD + +Y+ +L+A
Sbjct: 181 AGGDSPATFTVSLIPTTLELTTLGRRAPGSLVNIEVDVLAKYVEKLHA 228


>gi|302425320|gb|ADL39586.1| putative riboflavin synthase alpha subunit [Hyphomicrobium
           sulfonivorans]
          Length = 202

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 86/206 (41%), Positives = 113/206 (54%), Gaps = 8/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG++I       G    +   Y    +++G S+A  G CLT+  +  + +  
Sbjct: 1   MFTGIVTGIGEVI----GRDGGSFTIRCPYAAETLEIGGSMACNGCCLTMTSIRVDDAGA 56

Query: 61  ----NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
               + +  +V  ET+  T I SW  GT INLER + +G  L GHLV+GH+DG   I  +
Sbjct: 57  VAGSSIFTADVSNETSAKTTIDSWQPGTRINLERPLAMGQELGGHLVTGHVDGVARIADI 116

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKM 176
              GDS    +  P +L  +IA KGSV L+GVSLTVN V  N F V +I HT+  TTW  
Sbjct: 117 IADGDSRRFVIEAPDHLAPYIAPKGSVALDGVSLTVNEVSDNCFGVNIIPHTLTVTTWGA 176

Query: 177 HKVGDLINIEVDSMMRYIARLYALNT 202
              G  IN+EVD   RYIARL    T
Sbjct: 177 KTAGQSINLEVDLFSRYIARLLEFRT 202


>gi|254522990|ref|ZP_05135045.1| riboflavin synthase, alpha subunit [Stenotrophomonas sp. SKA14]
 gi|219720581|gb|EED39106.1| riboflavin synthase, alpha subunit [Stenotrophomonas sp. SKA14]
          Length = 221

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 6/199 (3%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           FTGI+  +G++ A   I   +R      +     +++G SIA  G+CLTV+         
Sbjct: 23  FTGIIEGVGRLAARESIGGDVRFTFNVGNLPFDNVQMGESIAINGVCLTVIAFD-----A 77

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++ +   ET  +T +     G  INLER+++  DRL GHLVSGH+DG  ++L +    
Sbjct: 78  SSFQADASTETLGLTTLGQLDEGAVINLERAMRPTDRLGGHLVSGHVDGLGQVLSIHEDA 137

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +   R + P +L ++IA KGS+C++GVSLTVN V    F+V LI HT+  T +    VG
Sbjct: 138 RAQRWRFAAPASLRRYIAKKGSICVDGVSLTVNEVDDEGFEVALIPHTVANTAFSASGVG 197

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E+D + RY+ RL  
Sbjct: 198 SAVNLEIDLVARYVERLLG 216



 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 40/97 (41%), Gaps = 5/97 (5%)

Query: 100 GHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNF 159
            +L +G I+G   +   + IG  +    ++ +     + +  S+ +NGV LTV     + 
Sbjct: 20  RYLFTGIIEGVGRLAARESIGGDVRFTFNVGNLPFDNVQMGESIAINGVCLTVIAFDASS 79

Query: 160 FDVLLIRHTIEETTWKMHKVGDLINIE-----VDSMM 191
           F       T+  TT      G +IN+E      D + 
Sbjct: 80  FQADASTETLGLTTLGQLDEGAVINLERAMRPTDRLG 116


>gi|219849512|ref|YP_002463945.1| riboflavin synthase subunit alpha [Chloroflexus aggregans DSM 9485]
 gi|219543771|gb|ACL25509.1| riboflavin synthase, alpha subunit [Chloroflexus aggregans DSM
           9485]
          Length = 203

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 69/199 (34%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG + ++T I  G  L V  +      + G SIA  G CLTV  L+     +
Sbjct: 1   MFTGIIEEIGTVESLTEIDGGWSLTVQATTVLQGTEQGHSIAVNGACLTVTALT-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V +  ET R TN+    IG  +NLERS+ +  R+ GH V GH+DGT  I      G
Sbjct: 56  STFTVGLSPETLRRTNLGDLRIGDGVNLERSLAVNGRIGGHFVQGHVDGTGVITAFHPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS++  ++   +L ++I  KG + ++G SLTV  V  + F  +L+ +T +  T     VG
Sbjct: 116 DSLWVTVATTPDLLRYIVPKGYIAVDGTSLTVVEVLPDVFTFMLVAYTQQHITLPRKPVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+EVD + +Y+ +   
Sbjct: 176 SRVNLEVDVLAKYVEKFIG 194


>gi|27380141|ref|NP_771670.1| riboflavin synthase subunit alpha [Bradyrhizobium japonicum USDA
           110]
 gi|27353295|dbj|BAC50295.1| riboflavin synthase alpha chain [Bradyrhizobium japonicum USDA 110]
          Length = 202

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 95/203 (46%), Positives = 126/203 (62%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTD+G+I++ TP A+G   RLR+  SY+ + +  G SIA  G+CLTVV  S    
Sbjct: 1   MFTGIVTDLGEIVSFTPTAQGQLHRLRIACSYDQTTIADGASIACNGVCLTVVA-SGVAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W++V+  AET  +T    W +GT +NLER++K+GD L GH+V+GH DG   I+  + 
Sbjct: 60  GKAWFDVDAAAETLALTTAKHWRVGTRLNLERALKIGDELGGHIVAGHADGIATIVSRED 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     LS    L +FIA KGS+ L+GVSLTVN V    F VL+I HT+  TT    K
Sbjct: 120 LPDMARFVLSTTRELARFIATKGSITLDGVSLTVNTVADVTFSVLIIPHTLTVTTIGGWK 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  +NIEVD M RY ARL  + 
Sbjct: 180 AGAEVNIEVDLMARYAARLTEMK 202


>gi|170703036|ref|ZP_02893864.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria
           IOP40-10]
 gi|170132060|gb|EDT00560.1| riboflavin synthase, alpha subunit [Burkholderia ambifaria
           IOP40-10]
          Length = 209

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 119/210 (56%), Gaps = 16/210 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  +E
Sbjct: 1   MFTGIVAAVGRIESINPLGASPDAGVRLTVHAGGLDLADVALGDSIAVQGACMTVIEKTE 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  -----TGFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTVDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALN 201
           TT +  K GD +N+E+D + RY+ R+ + +
Sbjct: 174 TTLRHVKAGDKVNLEIDMIARYVERMLSAS 203


>gi|25010823|ref|NP_735218.1| riboflavin synthase subunit alpha [Streptococcus agalactiae NEM316]
 gi|76787096|ref|YP_329495.1| riboflavin synthase subunit alpha [Streptococcus agalactiae A909]
 gi|161485615|ref|NP_687762.2| riboflavin synthase subunit alpha [Streptococcus agalactiae
           2603V/R]
 gi|23095202|emb|CAD46412.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562153|gb|ABA44737.1| riboflavin synthase, alpha subunit [Streptococcus agalactiae A909]
 gi|319744809|gb|EFV97149.1| riboflavin synthase subunit alpha [Streptococcus agalactiae ATCC
           13813]
          Length = 216

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/199 (32%), Positives = 112/199 (56%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G++  +    K  +L +        ++ G S+A  G+CLTV+  SE     
Sbjct: 1   MFTGIIEEMGQVSRIRNGIKSQQLSIDAPKLVPLLRKGDSVAVNGVCLTVLDKSETA--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   T++A+  + + +NLE +++   RL GH V GH+DG  +I  +    
Sbjct: 58  --FIADVMPESMMRTSLAALRLHSKVNLELALRSDSRLGGHFVLGHVDGVGKIEKIQKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   +  P ++  +I  KGSV L+G+SLTV    ++ F+V +I HT+ +T   + KVG
Sbjct: 116 IAVRFSIDAPPSIMSYIIEKGSVALDGISLTVVSFTEHSFEVSVIPHTMAQTNLSLKKVG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           DL+NIEVD + +Y  +  A
Sbjct: 176 DLLNIEVDVLGKYAEKFLA 194


>gi|297622518|ref|YP_003703952.1| riboflavin synthase subunit alpha [Truepera radiovictrix DSM 17093]
 gi|297163698|gb|ADI13409.1| riboflavin synthase, alpha subunit [Truepera radiovictrix DSM
           17093]
          Length = 220

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 111/210 (52%), Gaps = 19/210 (9%)

Query: 1   MFTGIVTDIGKIIAMTPI---AKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIV ++G+++   P       +R+ +        ++LG S+A +G CLT V L+E  
Sbjct: 1   MFTGIVEEVGRVVHTEPTEGAGGDLRVVIAARAVLEGLELGDSVAVSGCCLTAVALAE-- 58

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                + VE+  ET   T    W  G  +NLER+++L  RL GHLVSGH++G  E+  + 
Sbjct: 59  ---GAFTVELSKETLAKTAPR-WHPGARVNLERALQLSGRLGGHLVSGHVEGVGEVRRVR 114

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----------KNFFDVLLIRH 167
               +    +  P  L +++  KGSV ++GVSLTV  VG             F + LI H
Sbjct: 115 REPGAYVLTVRAPEALAKYLIPKGSVTVDGVSLTVVDVGGPGGSSPELAPTDFTLWLIPH 174

Query: 168 TIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           T+E TT    +VG  +N+E D + +Y+ RL
Sbjct: 175 TLELTTLGELEVGSRVNLEADLIAKYVERL 204


>gi|315179336|gb|ADT86250.1| riboflavin synthase subunit alpha [Vibrio furnissii NCTC 11218]
          Length = 218

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/205 (36%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDITISVNAGKLDMSDVKLGDSIATNGVCLTVVAFDS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -HSYSADLSLETLKKSGFADYKVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVAMPAELSKYVAEKGSMTVDGISLTVNDLRKNAFKLTIVPHTTQETTIDHFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYLERLLHGGREE 200


>gi|74318207|ref|YP_315947.1| riboflavin synthase subunit alpha [Thiobacillus denitrificans ATCC
           25259]
 gi|74057702|gb|AAZ98142.1| Lumazine-binding protein [Thiobacillus denitrificans ATCC 25259]
          Length = 201

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 109/201 (54%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG+I          R+ +     + S +  G SIA  G+CLT V L      
Sbjct: 1   MFTGIIQAIGRIHEYEARGADARMVIEGGGLDFSDVAPGDSIAVNGVCLTAVSL-----A 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V AET   T   + G    +NLE++++L DRL GHLVSGH+DG   +   + +
Sbjct: 56  AGSFTVDVSAETLSCTEGFTPGAE--VNLEKALRLADRLGGHLVSGHVDGVGTVHRFERV 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+S    +  P  L ++I  KGS+ +NGVSLTVN +    F + LI HT++ T  K  + 
Sbjct: 114 GESQLLEIDAPAALARYIIRKGSIAVNGVSLTVNHIDGARFALNLIPHTVDVTALKHLRP 173

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           G  +N+EVD + RY+ R+   
Sbjct: 174 GSRVNLEVDMIARYVERMTQF 194


>gi|146341343|ref|YP_001206391.1| riboflavin synthase subunit alpha [Bradyrhizobium sp. ORS278]
 gi|146194149|emb|CAL78170.1| riboflavin synthase alpha chain [Bradyrhizobium sp. ORS278]
          Length = 202

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 129/203 (63%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I+++TP  +G   RLR+ ++Y+ S +  G SIA+ G+CLTVV+ S    
Sbjct: 1   MFTGIVTDIGEIVSLTPRTEGKLHRLRIASAYDQSTIADGASIANNGVCLTVVQ-SGIAD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+  AET  +T    W +GT +NLER++K+GD L GH+VSGH+DG   I+  + 
Sbjct: 60  GKTWFEVDAAAETLALTTAKHWRVGTKLNLERALKIGDELGGHIVSGHVDGIATIVSREN 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D           L +FIA KGS+ L+GVSLTVN V +  F VL+I HT+  TT    +
Sbjct: 120 LPDMARFVFRTTRELARFIATKGSITLDGVSLTVNTVDELTFSVLIIPHTLAVTTLSSWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  +NIEVD M RY ARL  + 
Sbjct: 180 TGSEVNIEVDLMARYAARLTEMK 202


>gi|331005897|ref|ZP_08329248.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC1989]
 gi|330420293|gb|EGG94608.1| Riboflavin synthase alpha chain [gamma proteobacterium IMCC1989]
          Length = 213

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+++A+ P+   +RL + T       ++LG SIA  G+CLTV+  +     
Sbjct: 1   MFTGIIESVGQVVAVEPVEGDVRLHIDTAGLPMDAVQLGDSIATNGVCLTVIEKT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  +V  E+  +T I  W  GT +NLER++    RL GH+VSGH+DG  E++     
Sbjct: 56  ATGYRADVSVESLDLTTIREWQAGTTVNLERALTPESRLGGHIVSGHVDGIGEVVSRHPD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S    + +P ++ ++IA KGS+ ++G SLTVN V    FDV ++ HTI  T    ++ 
Sbjct: 116 ARSERFLMRVPASMAKYIAHKGSITIDGTSLTVNSVNGCEFDVNIVPHTIANTVMGRYET 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GTKVNLEVDVIARYLERLLLGDKA 199


>gi|257453180|ref|ZP_05618479.1| riboflavin synthase subunit alpha [Fusobacterium sp. 3_1_5R]
 gi|257467356|ref|ZP_05631667.1| riboflavin synthase subunit alpha [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315918486|ref|ZP_07914726.1| riboflavin synthase subunit alpha [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|317059714|ref|ZP_07924199.1| riboflavin synthase subunit alpha [Fusobacterium sp. 3_1_5R]
 gi|313685390|gb|EFS22225.1| riboflavin synthase subunit alpha [Fusobacterium sp. 3_1_5R]
 gi|313692361|gb|EFS29196.1| riboflavin synthase subunit alpha [Fusobacterium gonidiaformans
           ATCC 25563]
          Length = 215

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++++T     M++++         KLG SIA  G CLT V + +     
Sbjct: 1   MFTGLVEEMGRVLSITEGNHSMQIKIQCKKVLEGAKLGDSIATNGTCLTAVEIGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET + TN+       F+NLE+S+ L   L GHLV+G +D   +I  +   G
Sbjct: 56  DYFVADCMHETMKRTNLHRLKKSDFVNLEKSITLSTPLGGHLVTGDVDCEGKITNIRQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + LP    +++  KG V L+G SLTV  +G +   V LI H+ E       KVG
Sbjct: 116 IAKIYTVELPKYYMKYVVEKGRVTLDGASLTVMELGDSSLGVSLIPHSQEMIILGKKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D INIE D + +Y+ +L +    +
Sbjct: 176 DYINIETDLIGKYVEKLLSFPKQE 199


>gi|260767834|ref|ZP_05876769.1| riboflavin synthase alpha chain [Vibrio furnissii CIP 102972]
 gi|260617343|gb|EEX42527.1| riboflavin synthase alpha chain [Vibrio furnissii CIP 102972]
          Length = 218

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/205 (36%), Positives = 122/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDITISVNAGKLDMSDVKLGDSIATNGVCLTVVAFDS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 57  -HSYSADLSLETLKKSGFADYKVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNRV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVAMPAELSKYVAEKGSMTVDGISLTVNDLRKNAFKLTIVPHTTQETTIDHFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYLERLLHGGREE 200


>gi|166030623|ref|ZP_02233452.1| hypothetical protein DORFOR_00289 [Dorea formicigenerans ATCC
           27755]
 gi|166029625|gb|EDR48382.1| hypothetical protein DORFOR_00289 [Dorea formicigenerans ATCC
           27755]
          Length = 221

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++GK+  +        L V  +      K+G SIA  G+CLTV  L       
Sbjct: 1   MFTGIVEEVGKVRYIQLNGNSGVLAVKAAKVLEGTKIGDSIAVNGVCLTVTSLQP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET R +++ +  IG+++NLER++    R  GH+VSGHIDGT  I  +    
Sbjct: 56  DGFTADVMAETIRRSSLGNCKIGSYVNLERAMAADGRFGGHIVSGHIDGTGVIRSMIQEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     +   I  KGSVC++G+SLTV  V    F V +I HT EET       G
Sbjct: 116 NAVWVSIKTSQRILDLIVEKGSVCIDGISLTVAKVDDEGFQVSVIPHTGEETILLKKASG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           DL+N+E D + +Y+ +L  +   +
Sbjct: 176 DLVNLENDIIGKYVEKLMGIGKKE 199


>gi|90579823|ref|ZP_01235631.1| riboflavin synthase subunit alpha [Vibrio angustum S14]
 gi|90438708|gb|EAS63891.1| riboflavin synthase subunit alpha [Vibrio angustum S14]
          Length = 218

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/204 (37%), Positives = 121/204 (59%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    + + V + + + S +KLG SIA  G+CLTVV+L+ +   
Sbjct: 1   MFTGIIEAIGTITALTPKGADISVTVDSGNLDLSDVKLGDSIATNGVCLTVVKLTGK--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T  A +  G  +NLE+++    R  GH+VSGH+D   EI+     
Sbjct: 58  --GYVADLSLETLKRTAFAHYQAGQVVNLEKAMLPTTRFGGHMVSGHVDAVAEIIERHHT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT    K 
Sbjct: 116 GRAIEFWVKVPAHLAKYISEKGSVAVDGISLTVNEINGDEFKLTIVPHTALETTMDTFKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G +IN+EVD + RY+ RL   + +
Sbjct: 176 GRMINLEVDVIARYLERLMLGDKA 199


>gi|296170726|ref|ZP_06852299.1| riboflavin synthase subunit alpha [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894609|gb|EFG74345.1| riboflavin synthase subunit alpha [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 201

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/201 (35%), Positives = 113/201 (56%), Gaps = 7/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++     +A   RL +     TS    G SIA  G+CLTVV L      D
Sbjct: 1   MFTGIVEELGEVTGRDVLADAARLTIRGPVVTSDAGHGDSIAVNGVCLTVVEL----LPD 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  +  RL GH+V GH+DGT E++      
Sbjct: 57  GQFTADVMEETLNRSNLGALQVGSPVNLERAAAVNSRLGGHIVQGHVDGTGEVVGRAPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK---NFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G    ++F+V LI  T E TT    
Sbjct: 117 HWEVVRIGIPPAVARYVVEKGSITVDGISLTVSGLGTGPGDWFEVSLIPTTRELTTLGRA 176

Query: 178 KVGDLINIEVDSMMRYIARLY 198
            VG  +N+EVD + +Y+ RL 
Sbjct: 177 PVGTQVNLEVDVIAKYVERLM 197


>gi|226355048|ref|YP_002784788.1| riboflavin synthase subunit alpha [Deinococcus deserti VCD115]
 gi|226317038|gb|ACO45034.1| putative Riboflavin synthase alpha chain [Deinococcus deserti
           VCD115]
          Length = 219

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/211 (35%), Positives = 110/211 (52%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G++   T     + + V  +   + + LG SIA  G CLTV +  E     
Sbjct: 1   MFTGIIEQVGRVTRATEQEGNLTVTVAPAQMWNDVALGESIAVNGTCLTVTQWDE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V++  ET   T    W  G  +NLER++  G R  GH+VSGH+DG  EIL +D   
Sbjct: 56  TGFTVDLSHETLAKTAP-HWQPGDVVNLERAMTAGARFGGHVVSGHVDGVGEILQIDAQP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----------KNFFDVLLIRHTIE 170
            +    +  P +L +F+  KGSV ++GVSLTV  VG           + F + L+ HT+E
Sbjct: 115 GAYTMTVRAPADLARFLVPKGSVTVDGVSLTVVDVGGPAGSRADLRADEFTLWLVPHTLE 174

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
            T+    KVG  +N+E D M +Y+ RL  + 
Sbjct: 175 VTSLHTWKVGTKVNLEADQMAKYLERLLRMR 205


>gi|269965077|ref|ZP_06179242.1| Riboflavin synthase alpha chain [Vibrio alginolyticus 40B]
 gi|269830380|gb|EEZ84605.1| Riboflavin synthase alpha chain [Vibrio alginolyticus 40B]
          Length = 217

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 125/204 (61%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V T   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLAAITPKGEDITVTVETGTLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET + T  A + +G  +NLE+++    RL GH+VSGH+DG  EI+  + +
Sbjct: 57  -HYYSADLSLETLKKTGFADYQVGDKVNLEKAMLPTTRLGGHIVSGHVDGVGEIVERNSV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQE 199


>gi|255658130|ref|ZP_05403539.1| riboflavin synthase, alpha subunit [Mitsuokella multacida DSM
           20544]
 gi|260849437|gb|EEX69444.1| riboflavin synthase, alpha subunit [Mitsuokella multacida DSM
           20544]
          Length = 217

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/199 (37%), Positives = 112/199 (56%), Gaps = 9/199 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  +     G  L +      + + LG SIA  GICLTV      H   
Sbjct: 1   MFTGIIEEVGTVQRI----GGGSLAIAAETVLTDVHLGDSIAVNGICLTVTSFDRHH--- 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R T++A    G+ +NLER++ L  RL GH+VSGHIDGT  I  L+  G
Sbjct: 54  --FTADVMPETVRRTSLAELKKGSPVNLERALSLSSRLGGHIVSGHIDGTGSIRSLEREG 111

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  ++++   + + I  KGSV L+G+SLTV  V +  F V LI HT E T  +  K G
Sbjct: 112 NALLLKVAVEPAILRGIVEKGSVALDGISLTVAAVTEEDFTVSLIPHTREVTNLREKKAG 171

Query: 181 DLINIEVDSMMRYIARLYA 199
            ++NIE D + +Y+ ++  
Sbjct: 172 SILNIETDVIGKYVEKMMQ 190


>gi|262395033|ref|YP_003286887.1| riboflavin synthase subunit alpha [Vibrio sp. Ex25]
 gi|262338627|gb|ACY52422.1| riboflavin synthase alpha chain [Vibrio sp. Ex25]
          Length = 217

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 125/204 (61%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + + T   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLAAITPKGEDITVTIETGTLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET + T  A + +G  +NLE+++    RL GH+VSGH+DG  EI+  + +
Sbjct: 57  -HYYSADLSLETLKKTGFAEYQVGDKVNLEKAMLPTTRLGGHIVSGHVDGVGEIVERNLV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQE 199


>gi|26522746|dbj|BAC44850.1| riboflavin synthase [Photobacterium phosphoreum]
          Length = 218

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/199 (39%), Positives = 118/199 (59%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GKI A+TP    + + V +   + + +KLG SIA  G+CLTVV+L+ +   
Sbjct: 1   MFTGIIEAVGKISALTPKGADVSVTVDSGLLDLADVKLGDSIATNGVCLTVVKLTGK--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET   T  A++  G  +NLE+++    R  GH+VSGHID   E++    I
Sbjct: 58  --GYVADLSLETLNRTAFANYKAGQVVNLEKAMLATTRFGGHMVSGHIDAVAEVIERQHI 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  L ++I+ KGSV ++G+SLTVN V  N F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWIKVPPQLAKYISEKGSVAVDGISLTVNAVRGNEFKLTIVPHTAAETTMADFNV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  IN+EVD + RY+ RL 
Sbjct: 176 GRKINLEVDVIARYLERLM 194


>gi|325104549|ref|YP_004274203.1| riboflavin synthase, alpha subunit [Pedobacter saltans DSM 12145]
 gi|324973397|gb|ADY52381.1| riboflavin synthase, alpha subunit [Pedobacter saltans DSM 12145]
          Length = 194

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +GK++ +      + L + +  + +++K+  S+AH G+CLTVV L      D
Sbjct: 1   MFTGIIETLGKVVKIEKDQGNLHLTIRSDIS-NELKIDQSVAHNGVCLTVVSL-----AD 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V    ET   TN++    G  INLER + +  RLDGH+V GH+D T + + L    
Sbjct: 55  GQHTVTAIHETLLKTNLSELQEGNTINLERCMLMNGRLDGHIVQGHVDQTAKCVGLQEQN 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +       KGSVC+NG+SLTV     + F V +I +T E T     KVG
Sbjct: 115 GSWLFTFQYDTDKGNVTVEKGSVCVNGISLTVVNSQDDRFSVAIIPYTYEHTNLHEVKVG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ARL  
Sbjct: 175 STVNLEFDIIGKYVARLMQ 193


>gi|39935794|ref|NP_948070.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           CGA009]
 gi|39649647|emb|CAE28169.1| riboflavin synthase alpha chain [Rhodopseudomonas palustris CGA009]
          Length = 202

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 124/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  + P+A+G   RLR+  +Y+ S +  G SIA  GIC+TVV  S    
Sbjct: 1   MFTGIVTDIGEIETVKPVAQGQLHRLRIRCAYDQSTIADGASIASNGICMTVVG-SGTAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET   T   +W  GT +NLER++K+GD L GH+V+GH+DG  +++  + 
Sbjct: 60  GKTWYEVDAGAETLAKTTAKAWIAGTRLNLERALKIGDELGGHIVTGHVDGIAKVVAREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLETSRELARFIAPKGSVTLDGTSLTVNTVEDTKFSVLIIPHTLSATILGGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG  +NIEVD M RY ARL  + 
Sbjct: 180 VGSEVNIEVDLMARYAARLSEMK 202


>gi|229820257|ref|YP_002881783.1| riboflavin synthase, alpha subunit [Beutenbergia cavernae DSM
           12333]
 gi|229566170|gb|ACQ80021.1| riboflavin synthase, alpha subunit [Beutenbergia cavernae DSM
           12333]
          Length = 214

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 73/198 (36%), Positives = 105/198 (53%), Gaps = 8/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV  IG ++ +       RL V      +  ++G S+A  G+CLTV R        
Sbjct: 1   MFTGIVETIGVVVDLRADDDAARLTVR---GLAPERIGDSLAVDGVCLTVTRRD-----G 52

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +  E++V  ET R + + +   G  +NLER+V+   RLDGHLV GH+DG   ++      
Sbjct: 53  DEVELDVMPETLRRSTLGALRAGDRVNLERAVRADGRLDGHLVQGHVDGVGSLVRRAPGA 112

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                 L  P  L +++A KGS+ ++GVSLTV  VG   F V LI  T+  TT      G
Sbjct: 113 RWDDLELDAPAPLLRYVAEKGSIAVSGVSLTVTHVGGTTFGVSLIPSTLAGTTLGGLAPG 172

Query: 181 DLINIEVDSMMRYIARLY 198
           D +N+EVD + +Y+ RL 
Sbjct: 173 DRVNLEVDVVAKYVERLL 190


>gi|194336935|ref|YP_002018729.1| riboflavin synthase, alpha subunit [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309412|gb|ACF44112.1| riboflavin synthase, alpha subunit [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 218

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/205 (34%), Positives = 108/205 (52%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSY--NTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+ D+G++  +T    G+RLRV  S     + + +  S++  G C TVV L E   
Sbjct: 1   MFTGIIKDVGRVGGVTRRQGGLRLRVQFSNAAEFADLSVDESVSINGACQTVVALGE--- 57

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+   ET   T + S   G+ +NLER+V+  DRL GH V GH+D    +  +  
Sbjct: 58  --GWFEVDTVEETLSKTTLGSLHHGSLVNLERAVRPQDRLGGHFVLGHVDCAAVVEKIRE 115

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +G S    ++ P     FI   GS+ ++G+SLTV  +    F V +I +T  +TT    K
Sbjct: 116 LGSSREIWIAFPDAFSPFIVSAGSITIDGISLTVAKLEPLLFAVAVIPYTFAQTTINELK 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
            G  +N+E D + +Y+AR      S
Sbjct: 176 SGSRVNLEFDILGKYVARQLGRPPS 200


>gi|320011956|gb|ADW06806.1| riboflavin synthase, alpha subunit [Streptomyces flavogriseus ATCC
           33331]
          Length = 206

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 117/202 (57%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV L E     
Sbjct: 1   MFTGIVEELGEVTAVEKLDDASRFRLRGPVVTEGAKHGDSIAVNGVCLTVVDLGE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V AET   +++ +   G+ +NLER + LG RL GHLV GH+DGT  I+      
Sbjct: 56  NEFTADVMAETLDRSSLGALAPGSRVNLERPMALGGRLGGHLVQGHVDGTGHIVERKVSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +     +SLP  L +++  KGS+ ++GVSLTV   G +FF + LI  T+  TT  + + G
Sbjct: 116 NWELVTVSLPAGLARYVVEKGSITVDGVSLTVVDAGPDFFTISLIPTTLALTTLGLKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+EVD + +Y+ RL A  +
Sbjct: 176 DPVNLEVDVLAKYVERLLAHGS 197


>gi|37523173|ref|NP_926550.1| riboflavin synthase subunit alpha [Gloeobacter violaceus PCC 7421]
 gi|35214176|dbj|BAC91545.1| riboflavin synthase alpha chain [Gloeobacter violaceus PCC 7421]
          Length = 213

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 104/204 (50%), Gaps = 11/204 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G ++A+        + V  +     + LG SI+  GICLTVVR        
Sbjct: 1   MFTGIVEETGTLLAL----GSEEIAVRAAKVLKDVALGDSISVDGICLTVVRFDR----- 51

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +   +  ET   T +     G  +NLE +++ G +L GH+V+GHIDG    + +   G
Sbjct: 52  DSFTAGLSQETLDRTTLIGRIPGDAVNLESALRAGGKLGGHIVTGHIDGVGRCVAVHPAG 111

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK--NFFDVLLIRHTIEETTWKMHK 178
            S       P  + ++I  KGS+ ++G+SLTV       ++F V +I H+  ETT    K
Sbjct: 112 LSWEIDFEAPPAVARYIVEKGSIAIDGISLTVAACNTAGDWFRVAIIPHSFAETTLGAIK 171

Query: 179 VGDLINIEVDSMMRYIARLYALNT 202
            GD +N+E D + +Y+ +L   + 
Sbjct: 172 PGDPVNLEADLIGKYVEKLLGGSK 195


>gi|157374413|ref|YP_001473013.1| riboflavin synthase subunit alpha [Shewanella sediminis HAW-EB3]
 gi|157316787|gb|ABV35885.1| riboflavin synthase, alpha subunit [Shewanella sediminis HAW-EB3]
          Length = 220

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/203 (38%), Positives = 119/203 (58%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +  +   +RL V +   +   ++LG SIA  G+CLTVV       +
Sbjct: 1   MFTGIIESVGTLRKIERLGDDIRLNVASGKLDLGDVRLGDSIATNGVCLTVVEC-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++ AET  +T  A + +GT +NLE++V    RL GH+VSGH+DG   +    F 
Sbjct: 56  SDGYVADISAETVSLTGFAKYQVGTMVNLEKAVTPTTRLGGHMVSGHVDGIASVDDRQFR 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L+ P  L ++IA KGS+ ++GVSLTVN V  N F + ++ HT  ETT    K 
Sbjct: 116 GKAIEFWLTAPSILARYIAHKGSITIDGVSLTVNEVIDNRFRLTIVPHTAGETTLVSLKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           GD +NIEVD + R++ RL   ++
Sbjct: 176 GDAVNIEVDLIARHLERLMTYSS 198


>gi|262274778|ref|ZP_06052589.1| riboflavin synthase alpha chain [Grimontia hollisae CIP 101886]
 gi|262221341|gb|EEY72655.1| riboflavin synthase alpha chain [Grimontia hollisae CIP 101886]
          Length = 220

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 115/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +TP    + L V +   + S +KLG SIA  G+CLTVV L+     
Sbjct: 1   MFTGIIEAVGHIQKITPKGGDISLTVDSGKLDLSDVKLGDSIATNGVCLTVVALT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++  ET + T  A++  G  +NLE+++    R  GH+VSGH+DG   ++     
Sbjct: 56  GSGYVADLSGETLKRTAFATYKAGHRVNLEKAMLPTTRFGGHMVSGHVDGVATVVSRTQA 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   L  P  L +++A KGSV ++G+SLT+N V  N F + ++ HT  ETT +   V
Sbjct: 116 GRAIEFWLEAPAGLAKYLAEKGSVTIDGISLTINAVDGNRFKLTIVPHTALETTIEGFSV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +NIEVD + RY+ RL 
Sbjct: 176 GHQVNIEVDVIARYLERLM 194


>gi|218296565|ref|ZP_03497293.1| riboflavin synthase, alpha subunit [Thermus aquaticus Y51MC23]
 gi|218243107|gb|EED09639.1| riboflavin synthase, alpha subunit [Thermus aquaticus Y51MC23]
          Length = 194

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/199 (38%), Positives = 109/199 (54%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G ++ +      +R+R+        +K+G SIA  G CLT V +       
Sbjct: 1   MFTGLVEETGVVLEVQE-GPFLRVRIGARKVLEDLKVGDSIAVDGACLTAVAVD-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET R T   +W +G   NLER++K+GDRL GH V+GH+DG  E++ +    
Sbjct: 55  EGFWVELAQETLRRTAP-TWRVGHRPNLERALKVGDRLGGHFVTGHVDGVAELVEVREAP 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +       P    ++IA KGSV LNGVSLTV  +    F V LI HT+  T     +VG
Sbjct: 114 GAKDYFFRPPAEYARYIAEKGSVALNGVSLTVAGLAGEAFFVTLIPHTLAVTNLGGLRVG 173

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + RY+ RL  
Sbjct: 174 DGVNLEVDLIARYLERLVG 192


>gi|91225068|ref|ZP_01260290.1| riboflavin synthase subunit alpha [Vibrio alginolyticus 12G01]
 gi|91190011|gb|EAS76282.1| riboflavin synthase subunit alpha [Vibrio alginolyticus 12G01]
          Length = 217

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/204 (38%), Positives = 125/204 (61%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+TP  + + + V T   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEAVGKLAAITPKGEDITVTVETGTLDMSDVKLGDSIATNGVCLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++Y  ++  ET + T  A + +G  +NLE+++    RL GH+VSGH+DG  EI+  + +
Sbjct: 57  -HYYSADLSLETLKKTGFAEYQVGDKVNLEKAMLPTTRLGGHIVSGHVDGVGEIVERNSV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVAMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSEETTIDQFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQE 199


>gi|218283799|ref|ZP_03489722.1| hypothetical protein EUBIFOR_02316 [Eubacterium biforme DSM 3989]
 gi|218215605|gb|EEC89143.1| hypothetical protein EUBIFOR_02316 [Eubacterium biforme DSM 3989]
          Length = 217

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/200 (36%), Positives = 111/200 (55%), Gaps = 5/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK+  +    +   L V         ++G SIA  G+CLTV  + +     
Sbjct: 1   MFTGIVEEKGKVRYIQLTGESGILAVKAQKVLEGTRIGDSIAVNGVCLTVTAIQQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET R +++ S   G+ +NLER++    R  GH+VSGHIDGT  I  +    
Sbjct: 56  DGFCADVMAETIRRSSLGSCKAGSQVNLERAMAADGRFGGHIVSGHIDGTGVIRSMLREE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     +   I  KGSVC++G+SLTV  VG+  F V +I HT EETT      G
Sbjct: 116 NAIWVSIETSPQILHLIVEKGSVCIDGISLTVARVGEAGFQVSVIPHTGEETTLLEKVPG 175

Query: 181 DLINIEVDSMMRYIARLYAL 200
           DL+N+E D + +Y+ +L  +
Sbjct: 176 DLVNLENDVIGKYVEKLLGI 195


>gi|84394362|ref|ZP_00993083.1| riboflavin synthase subunit alpha [Vibrio splendidus 12B01]
 gi|218710375|ref|YP_002417996.1| riboflavin synthase subunit alpha [Vibrio splendidus LGP32]
 gi|84375021|gb|EAP91947.1| riboflavin synthase subunit alpha [Vibrio splendidus 12B01]
 gi|218323394|emb|CAV19571.1| Riboflavin synthase alpha chain [Vibrio splendidus LGP32]
          Length = 218

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/205 (36%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V   + + + +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLSAITPRGEDITVTVNVGNLDMADVKLGDSIATNGVCLTVVEYN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  DHSYSADLSLETLKKTGFVDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGSV ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWVEMPAEISKYVAQKGSVTVDGISLTVNDLRKNAFKLTIVPHTSSETTIDQFNV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQQE 200


>gi|124485224|ref|YP_001029840.1| riboflavin synthase subunit alpha [Methanocorpusculum labreanum Z]
 gi|124362765|gb|ABN06573.1| riboflavin synthase, alpha subunit [Methanocorpusculum labreanum Z]
          Length = 216

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/202 (30%), Positives = 108/202 (53%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  +        L +  +     + LG S+A  G+CLTV  L+ +    
Sbjct: 1   MFTGIVEEIGIVTKIMKGQNSSVLSIQGNRIFEDLTLGDSVAVNGVCLTVSGLNRQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ +  +ET   T++ +   G+ +NLER++    R  GH+V+GH+DGT  I  +    
Sbjct: 58  --FDADTTSETLARTSLGALRTGSSVNLERAMSANGRFGGHIVTGHVDGTGIISTIRRDE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +++   +    + ++I  KGS+ ++G+SLTV  V ++ F V +I HT + TT  M   G
Sbjct: 116 RTVWITFTAGPEILKYIVEKGSIAVDGISLTVAAVTQDSFSVAIIPHTEKSTTLLMKSQG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           + +N+E D + +Y+ R  A   
Sbjct: 176 ERVNLECDMIGKYVERFIAKRQ 197


>gi|294498064|ref|YP_003561764.1| riboflavin synthase subunit alpha [Bacillus megaterium QM B1551]
 gi|295703413|ref|YP_003596488.1| riboflavin synthase subunit alpha [Bacillus megaterium DSM 319]
 gi|294348001|gb|ADE68330.1| riboflavin synthase, alpha subunit [Bacillus megaterium QM B1551]
 gi|294801072|gb|ADF38138.1| riboflavin synthase, alpha subunit [Bacillus megaterium DSM 319]
          Length = 219

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 109/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGKI  +    + + L +        + LG SI+  G+CLTV   S+     
Sbjct: 1   MFTGIIEEIGKIKRIQKATEAIVLTIDAKTVLEDVNLGDSISVNGVCLTVTAYSQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + + +    +G+ +NLER++    R  GH VSGH+DG   I+     G
Sbjct: 56  NEFTVDVMPETIKASTLQLLTVGSRVNLERAMAANGRFGGHFVSGHVDGIGTIVSKTRKG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++ Y  + +   L +F+ +KGSV ++G SLT+  V    F + LI HT+  T     + G
Sbjct: 116 NAFYYEIQVDPELREFMMLKGSVSVDGTSLTIFDVSNQSFTISLIPHTVLHTVVGDKQRG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +NIE D + +Y+ ++    ++
Sbjct: 176 DKVNIECDMLAKYMHQMMTNKST 198


>gi|260495222|ref|ZP_05815350.1| riboflavin synthase, alpha subunit [Fusobacterium sp. 3_1_33]
 gi|260197279|gb|EEW94798.1| riboflavin synthase, alpha subunit [Fusobacterium sp. 3_1_33]
          Length = 253

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 36  MFTGLVEEKGNVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 90

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 91  DYFIADCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEG 150

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG V ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 151 IAKIYEIKISRKYMRYIVEKGRVTIDGASLTVISLTDDTFSVSLIPHTQEKIVLGSKKVG 210

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 211 DIVNIETDLVGKYIERFVYFDKLE 234


>gi|168493875|ref|ZP_02718018.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC3059-06]
 gi|169833622|ref|YP_001693698.1| riboflavin synthase subunit alpha [Streptococcus pneumoniae
           Hungary19A-6]
 gi|168996124|gb|ACA36736.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           Hungary19A-6]
 gi|183576140|gb|EDT96668.1| riboflavin synthase, alpha subunit [Streptococcus pneumoniae
           CDC3059-06]
          Length = 211

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/198 (34%), Positives = 116/198 (58%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGK+  +   ++  +L +  S   + + LG SIA  GICLTV   + +    
Sbjct: 1   MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNGICLTVTHFNHQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET   T +     G+ +NLER++ +  RL GH+V+GHIDGT +I  +    
Sbjct: 58  --FTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDGTGKISSIKKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ +++    +   I  KGS+ ++G+SLTV  V K  F V +I HT+E+T  K  +VG
Sbjct: 116 NAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHTLEQTILKSQQVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           + +N+E D + +Y+ +L 
Sbjct: 176 NTVNLENDILGKYVQKLM 193


>gi|330445268|ref|ZP_08308920.1| riboflavin synthase, alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489459|dbj|GAA03417.1| riboflavin synthase, alpha subunit [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 218

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G I A+TP    + + V +   + + +KLG SIA  G+CLTVV L+ +   
Sbjct: 1   MFTGIIEATGTITALTPKGADISVTVDSGKLDLADVKLGDSIATNGVCLTVVALTGK--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T  A +  G  +NLE+++    R  GH+VSGH+D   EI+     
Sbjct: 58  --GYVADLSLETIKRTAFADYKAGQVVNLEKAMLPTTRFGGHMVSGHVDAVAEIIERHQT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT    K 
Sbjct: 116 GRAIEFWVKAPAHLAKYISEKGSVAVDGISLTVNEINGDEFKLTIVPHTALETTMDAFKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  IN+EVD + RY+ RL   + +
Sbjct: 176 GRKINLEVDVIARYLERLMLGDKA 199


>gi|114332462|ref|YP_748684.1| riboflavin synthase subunit alpha [Nitrosomonas eutropha C91]
 gi|114309476|gb|ABI60719.1| riboflavin synthase, alpha subunit [Nitrosomonas eutropha C91]
          Length = 201

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 111/199 (55%), Gaps = 7/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  + P    +R+ +     + + + +G SIA  G CLT+    E    
Sbjct: 1   MFTGIIKAVGRIRHVYPKEDAVRIHIDPGKLDLTDVAIGDSIAVNGACLTLTAFEE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   T+      G  +NLE++++  DRLDGHLVSGH++G  E++     
Sbjct: 57  -GCFTVDVSGETLSCTH-GLDIPGNPVNLEKALRFSDRLDGHLVSGHVEGVGEVVQFTQA 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD     +  P  L ++I  KGS+ ++GVSLTVN V     ++ LI HT+  TT+K  + 
Sbjct: 115 GDRCLLAIQPPPQLFKYIIPKGSITIDGVSLTVNQVASERVEINLIPHTLANTTFKQFEP 174

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+E D + +Y+ARL 
Sbjct: 175 GKKVNLETDMIAKYVARLL 193


>gi|189500550|ref|YP_001960020.1| riboflavin synthase subunit alpha [Chlorobium phaeobacteroides BS1]
 gi|189495991|gb|ACE04539.1| riboflavin synthase, alpha subunit [Chlorobium phaeobacteroides
           BS1]
          Length = 218

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/202 (38%), Positives = 109/202 (53%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS--YNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIV DIG I A+      +R+ V     +  + + +  S+A  G C TVV L     
Sbjct: 1   MFTGIVKDIGTIAAIRSQGTSLRITVRYKNRHEFNDLAIDESVAINGACQTVVALG---- 56

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
            D  ++V+   ET + T +  +  G  +NLER+V+  DRL GH V GH+D    +L +  
Sbjct: 57  -DGTFDVDTIGETLKKTTLGYFVPGVSVNLERAVRPSDRLGGHFVQGHVDCVGTVLGVYD 115

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +G S   R+S P     FI   GS+ ++GVSLTV  V  N F V +I +T E TT    K
Sbjct: 116 LGGSREIRISFPDEFMPFIVPVGSIAIDGVSLTVANVKANSFSVAIIPYTFENTTINNLK 175

Query: 179 VGDLINIEVDSMMRYIARLYAL 200
            GD +N+E D + +YIAR  +L
Sbjct: 176 DGDRLNLEFDILGKYIARQQSL 197


>gi|37197788|dbj|BAC93626.1| riboflavin synthase alpha chain [Vibrio vulnificus YJ016]
          Length = 239

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 128/205 (62%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V T   + S +KLG SIA  G+CLTV+  S+ H  
Sbjct: 22  MFTGIIEAVGTLAAITPRGEDITVTVNTGKLDMSDVKLGDSIATNGVCLTVIDFSDRH-- 79

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  E+ + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 80  ---YSADLSLESLKKTGFANYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 136

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 137 GRAIEFWVAMPESLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGDETTINDFQV 196

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     +Q
Sbjct: 197 GRKVNLEVDVLARYMERLLLGQQAQ 221


>gi|99081971|ref|YP_614125.1| riboflavin synthase subunit alpha [Ruegeria sp. TM1040]
 gi|99038251|gb|ABF64863.1| riboflavin synthase alpha subunit [Ruegeria sp. TM1040]
          Length = 201

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 97/205 (47%), Positives = 128/205 (62%), Gaps = 12/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I  +      +R R+ T+Y+TS + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGTITELEQAGD-LRARIQTAYDTSSIDMGASIASDGVCLTVVALGP----- 54

Query: 61  NWYEVEVWAETNRITNI------ASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           +WY+V++ AET   TNI        W +G  +NLER++K+GD L GH+VSGH+DG  E++
Sbjct: 55  DWYDVQISAETTSKTNIDARGTHKGWFVGKRVNLERALKVGDELGGHIVSGHVDGVAEVV 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW 174
            +   GDS    L  P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW
Sbjct: 115 AMRDEGDSTRVTLRAPKELARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKEVTTW 174

Query: 175 KMHKVGDLINIEVDSMMRYIARLYA 199
               VGDLIN+E+D++ RY+ARL  
Sbjct: 175 GDVAVGDLINLEIDTLARYVARLQE 199


>gi|317056286|ref|YP_004104753.1| riboflavin synthase subunit alpha [Ruminococcus albus 7]
 gi|315448555|gb|ADU22119.1| riboflavin synthase, alpha subunit [Ruminococcus albus 7]
          Length = 214

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/198 (33%), Positives = 105/198 (53%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ + G +  +        +R+         K+G SIA  G+CLTV     +    
Sbjct: 1   MFTGLIEETGTVCEVCRNGNASFIRIAAEKVLEGTKVGDSIAVNGVCLTVTEHDGK---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ +   G+ ++LER++    R  GH+VSGHIDGT  +  +   G
Sbjct: 57  -IFRADVMNETLSRSSLGTLKQGSKVDLERAMSAEGRFGGHIVSGHIDGTGTVSNIKQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++   +S    L ++I  KGSV L+G+SLTV  V    F V +I HT E+T     KVG
Sbjct: 116 IAVRYTISADEKLLRYIVEKGSVTLDGISLTVAAVTDTDFTVSVIPHTAEQTILPYKKVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D+INIE D + +Y+ +L 
Sbjct: 176 DIINIETDIIGKYVEKLL 193


>gi|94500358|ref|ZP_01306890.1| riboflavin synthase subunit alpha [Oceanobacter sp. RED65]
 gi|94427393|gb|EAT12371.1| riboflavin synthase subunit alpha [Oceanobacter sp. RED65]
          Length = 217

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G++         + + + + S + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEAQGRVERKQEKDGDLMVTISSHSLDYSDVKLGDSIAVNGVCLTVVA-----QN 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N ++ ++  ET   T  +   +G  +NLE+++    RL GH+VSGH+DG  E++     
Sbjct: 56  GNAFDADISNETLSYTRWSDIQVGETVNLEKALMPTSRLGGHIVSGHVDGIGEVMSRQED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P +L+++IA KGS+ ++G+SLTVN V  + F++ ++ HT +ETT    K 
Sbjct: 116 ARSIRFLVKAPQDLDKYIAHKGSITVDGISLTVNKVTTDGFELNIVPHTAKETTLYKTKP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +++EVD + RY+ RL     +
Sbjct: 176 GDKVHLEVDVIARYLERLINPQQT 199


>gi|260775294|ref|ZP_05884191.1| riboflavin synthase alpha chain [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608475|gb|EEX34640.1| riboflavin synthase alpha chain [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 216

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/205 (37%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIIEAVGTLTAITPKGEDISVTVEVGKLDMSDVKLGDSIATNGVCLTVVDFNSTS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET   T    + +G  +NLE+++    R  GH+VSGH+DG  EI   + +
Sbjct: 59  ---YSADLSLETLNKTGFTDYQVGGKVNLEKAMLPTTRFGGHIVSGHVDGVGEITERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P  L +++A KGSV ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVSMPEELSKYVAEKGSVTVDGISLTVNALRKNAFKLTIVPHTGEETTIADFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQKEQ 200


>gi|239917589|ref|YP_002957147.1| riboflavin synthase, alpha subunit [Micrococcus luteus NCTC 2665]
 gi|281413924|ref|ZP_06245666.1| riboflavin synthase, alpha subunit [Micrococcus luteus NCTC 2665]
 gi|239838796|gb|ACS30593.1| riboflavin synthase, alpha subunit [Micrococcus luteus NCTC 2665]
          Length = 218

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 109/204 (53%), Gaps = 9/204 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIA--KGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVT +G ++A+   A      L +        +  G S+A  G+CLT   L E   
Sbjct: 1   MFTGIVTHLGTVVALEHDAAADTALLTLDAGGALDGLPAGGSLAVDGVCLT--ALDEPTE 58

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               +  ++  +T R+T++     G  +NLER ++  D LDGH+V GH+DGT E+L +  
Sbjct: 59  RPGVFRADLMGQTLRMTSLGDRAPGDRVNLERCLRPTDHLDGHVVQGHVDGTGEVLAVTP 118

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK-----NFFDVLLIRHTIEETT 173
            G     R+ LP  L +++  +G++ L GVSLTV  V       ++F+V +I  T+E TT
Sbjct: 119 HGAWTTLRIGLPARLARYVPAQGAIALQGVSLTVTAVSDPGAAAHWFEVGIIPATLEATT 178

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
               + GD +N+E D + RY  RL
Sbjct: 179 LGALRPGDRVNLETDVLARYAERL 202


>gi|327440065|dbj|BAK16430.1| riboflavin synthase alpha chain [Solibacillus silvestris StLB046]
          Length = 211

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G +  ++   + M L +  S     ++LG SIA  G+CLTV     +H   
Sbjct: 1   MFTGIIEELGTVETISQSTQAMELAIRASKILEDVQLGDSIAVNGVCLTV-----KHFSP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET + T++     G  +NLER++    R  GH+VSGH+DG   I     + 
Sbjct: 56  TVFLADVMPETVKATSLQQLAAGMPVNLERAMSANGRFGGHIVSGHVDGIATIQRKRPVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  L++  +L      KGS+ ++G SLT+  V   F  + LI HT E+T     K G
Sbjct: 116 NAVYIDLAMEKHLIAECIKKGSITVDGTSLTIFEVTDTFITISLIPHTYEQTVLGYKKPG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D++NIE D + +Y+ +     T
Sbjct: 176 DVVNIETDLIGKYVKKHLQNQT 197


>gi|307265417|ref|ZP_07546973.1| riboflavin synthase, alpha subunit [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919531|gb|EFN49749.1| riboflavin synthase, alpha subunit [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 207

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/201 (33%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +       ++ +  S      K+G SIA  G+CLTV  +S+E    
Sbjct: 1   MFTGIIEETGTVKNIIH-GTFTKIVIKCSKVLEGTKIGDSIAVNGVCLTVTNISDES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +N+     G+ +NLER++++G R+ GH+V+GHID   +I+      
Sbjct: 57  --FAADVMPETMRASNLKDLKTGSIVNLERALQVGRRMGGHIVTGHIDCVGKIIDKRQEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++   ++++     ++I  KGS+ ++G+SLTV   G ++F V +I HT+ +TT     VG
Sbjct: 115 NAFIFKIAINKEFTKYIVRKGSIAVDGISLTVVEDGDDYFTVSIIPHTMLKTTLGYKSVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD + +Y+ +L A  
Sbjct: 175 DSVNIEVDILSKYVEKLIAQK 195


>gi|83648597|ref|YP_437032.1| riboflavin synthase subunit alpha [Hahella chejuensis KCTC 2396]
 gi|83636640|gb|ABC32607.1| riboflavin synthase, alpha subunit [Hahella chejuensis KCTC 2396]
          Length = 222

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 114/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V ++G + A+   +    L +  T      ++LG SIA  G+CLTV  +S +   
Sbjct: 1   MFTGLVEEVGVVNAIRQQSGDWVLEIGATGSFMEGVRLGDSIAVNGVCLTVTAMSGKS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  +V  ET+  T+IA+W  G  +NLE++++L  RL GH VSGH+DG  E+L     
Sbjct: 59  ---FRADVSRETSAHTSIAAWRAGVRVNLEKALQLSARLGGHFVSGHVDGVGELLSKQED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P  L ++IA KGS+ ++GVSLTVN V  +   + ++ HT   TT    KV
Sbjct: 116 ARSLRLAIRAPEELLRYIAAKGSITVDGVSLTVNDVAGSEMSLNIVPHTAYATTLGGLKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G L+++EVD + RY  RL 
Sbjct: 176 GSLVHLEVDLLARYTERLL 194


>gi|300741402|ref|ZP_07071423.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
           [Rothia dentocariosa M567]
 gi|300380587|gb|EFJ77149.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
           [Rothia dentocariosa M567]
          Length = 425

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 103/214 (48%), Gaps = 14/214 (6%)

Query: 1   MFTGIVTDIGKIIAMTP-------IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRL 53
           MFTGI+  +G + ++ P             + +      S +  G S+A  G+CLT V  
Sbjct: 1   MFTGIIGALGTVESVQPVYNAQGASTGAAYITINAGDIVSDLDHGGSLAVNGVCLTAV-- 58

Query: 54  SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
            E+      +      ET   TN+ +   G+ +NLER +    R DGH+V GH+DG   +
Sbjct: 59  DEDSIEPQQFRAYAMGETLTRTNLGTLTQGSVVNLERCMPASGRFDGHVVQGHVDGIATV 118

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHT 168
             +         R S+P  L  ++  KGS+ ++GVSLTV  V  +     +F+V LI  T
Sbjct: 119 TSITEHDAWCTVRFSIPQELAPYLVEKGSIAVSGVSLTVTAVSASVESAPWFEVGLIPET 178

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           +  T      VGD +N+E D++ +Y+ARL  +  
Sbjct: 179 LSATNLGQLTVGDTVNLETDALAKYVARLMEMRN 212


>gi|300022487|ref|YP_003755098.1| riboflavin synthase, subunit alpha [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524308|gb|ADJ22777.1| riboflavin synthase, alpha subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 197

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 81/201 (40%), Positives = 116/201 (57%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++TD+G++I       G    + T+Y       G SI   G+CLT   + +  +  
Sbjct: 1   MFTGLITDVGEVI----DKSGGTFTLRTAYALRPEDAGISICCNGVCLTATSI-KPLASG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET   + ++ W  G+ +NLERS+K GD L GH+VSGH+DG  +I+ +   G
Sbjct: 56  SEFSVDVSNETLAKSTLSDWATGSRVNLERSLKAGDELGGHIVSGHVDGVAKIVSITQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S       P +L ++IA KGSV L+G SLTVN V +N F V LI H++  TTW     G
Sbjct: 116 ASKRFLFEAPEHLSRYIAPKGSVALDGTSLTVNEVSENRFGVNLIPHSLTVTTWGGKTPG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           DL+N+EVD   RY+ARL    
Sbjct: 176 DLVNLEVDVFARYVARLMEFR 196


>gi|19712720|gb|AAL93633.1| Riboflavin synthase alpha chain [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 251

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 34  MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 88

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 89  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLATPLGGHLVTGDVDCEGEIVSITQEG 148

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 149 VAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 208

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI +    +  +
Sbjct: 209 DIVNIETDLVGKYIEKFVYFDKLE 232


>gi|148976616|ref|ZP_01813303.1| riboflavin synthase subunit alpha [Vibrionales bacterium SWAT-3]
 gi|145963967|gb|EDK29225.1| riboflavin synthase subunit alpha [Vibrionales bacterium SWAT-3]
          Length = 218

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/205 (35%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + + ++LG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLSAITPRGEDITVTVNVGKLDMADVQLGDSIATNGVCLTVVEFN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  DHSYSADLSLETLKKTGFVDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWVEMPAEISKYVAQKGSITVDGISLTVNDLRKNAFKLTIVPHTSSETTIDQFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQQE 200


>gi|312139594|ref|YP_004006930.1| riboflavin synthase alpha chain ribc [Rhodococcus equi 103S]
 gi|311888933|emb|CBH48246.1| riboflavin synthase alpha chain RibC [Rhodococcus equi 103S]
          Length = 203

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 115/201 (57%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A   +A   R  V     TS    G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEELGEIVAKEDLADAARFTVKGPLVTSDAGHGDSIAVNGVCLTVVDV----LDG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ S GIG+ +NLER+  +  RL GH+V GH+DGT E++      
Sbjct: 57  EAFTADVMRETLVRSSLGSLGIGSRVNLERAAAVNSRLGGHIVQGHVDGTGEVISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVN----LVGKNFFDVLLIRHTIEETTWKM 176
           +    R+SLP ++ +++  KGS+ ++GVSLTV+      G  +F++ LI  T+  TT   
Sbjct: 117 NWTVVRISLPSSISRYVVEKGSITVDGVSLTVSALGGEPGDEYFEISLIPTTLGLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARL 197
            + G  +N+EVD + +Y+ RL
Sbjct: 177 AEPGTPVNLEVDVIAKYVERL 197


>gi|304320113|ref|YP_003853756.1| riboflavin synthase subunit alpha [Parvularcula bermudensis
           HTCC2503]
 gi|303299016|gb|ADM08615.1| riboflavin synthase subunit alpha [Parvularcula bermudensis
           HTCC2503]
          Length = 197

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 60/202 (29%), Positives = 98/202 (48%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ ++G ++  +    G  L +  +     +  G SIA  G+CL+V   +      
Sbjct: 1   MFTGLIEEMGTLLDRSMTEGGATLTIEAAKVLEGVAFGDSIAVEGVCLSVTSFTP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V +  ET   T + +   G  +NLERS+    R+ GH V GH+DGT  I  +   G
Sbjct: 56  SQFTVGLAPETLSRTTLGALSFGAPLNLERSLTPVSRMGGHYVQGHVDGTGRIHTVKADG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++  R+     L ++I  KG + ++G SLTV  V    F + LI HT    T    + G
Sbjct: 116 DALLIRIDCGPELLKYIVPKGYIAVDGTSLTVIDVDDAGFTLTLIAHTQPLVTLGKKREG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+E D + +Y  +      
Sbjct: 176 DPVNLETDILGKYAEKFLQGGK 197


>gi|257386621|ref|YP_003176394.1| riboflavin synthase subunit alpha [Halomicrobium mukohataei DSM
           12286]
 gi|257168928|gb|ACV46687.1| riboflavin synthase, alpha subunit [Halomicrobium mukohataei DSM
           12286]
          Length = 192

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 68/198 (34%), Positives = 108/198 (54%), Gaps = 6/198 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G++ A+   A G RLR+ +     ++  G SI+ +G CLTV    EE    
Sbjct: 1   MFTGIVEATGEVRAVEDTADGRRLRIGSP--FEELSHGQSISVSGACLTV----EEFEPG 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+ V +  ET   T       G  +NLER++    R DGH+V GH+D T  +  ++ +G
Sbjct: 55  EWFSVFLAEETIDRTFFDEIAEGDELNLERAMPADGRFDGHIVQGHVDATATVEEIERVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SLP ++E+++  KGS+ ++G+SLTV    ++ F V +I  T + TT      G
Sbjct: 115 EDWRFTFSLPADIERYVVEKGSITVDGISLTVADRREDSFSVAIIPTTYDVTTLSEKSPG 174

Query: 181 DLINIEVDSMMRYIARLY 198
           D  ++EVD + +Y+ R+ 
Sbjct: 175 DAAHLEVDVVAKYVERMV 192


>gi|309780820|ref|ZP_07675561.1| riboflavin synthase, alpha subunit [Ralstonia sp. 5_7_47FAA]
 gi|308920502|gb|EFP66158.1| riboflavin synthase, alpha subunit [Ralstonia sp. 5_7_47FAA]
          Length = 217

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 77/207 (37%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  ++P+      G+RL +       + + LG SIA  G C+TVV    
Sbjct: 1   MFTGIVAAVGRIETVSPLGDNADAGVRLSIDAGGLPLADVALGDSIAIQGACMTVVA--- 57

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               DN +EV+V  E+   T          +NLE++++L D + GHLVSGH+DG   +  
Sbjct: 58  --KADNRFEVDVSRESLSKTVG--LEGPGEVNLEKALRLADHIGGHLVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              + +S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+  
Sbjct: 114 FAPVNESHELRVRAPAELGKYLAYKGSVVVNGVSLTVNTVRDDADGCEFSINLIPHTVAV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLY 198
           TT K  K G  +N+E+D + RY+ R+ 
Sbjct: 174 TTLKHLKAGSQVNLEIDLIARYVERML 200


>gi|237809264|ref|YP_002893704.1| riboflavin synthase, alpha subunit [Tolumonas auensis DSM 9187]
 gi|237501525|gb|ACQ94118.1| riboflavin synthase, alpha subunit [Tolumonas auensis DSM 9187]
          Length = 219

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 119/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+ P  + + +RV +   + S +KLG SIA  G+CLTVV L+     
Sbjct: 1   MFTGIIEAVGTLAALQPKGEDISVRVKSGKLDLSDVKLGDSIATNGVCLTVVELT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + Y  ++  ET + ++   +  G  +NLER++    RL GHLVSGH+DG  EI+ +  +
Sbjct: 56  GDGYVADLSLETLQRSSFVYYQAGQKVNLERALTPDTRLGGHLVSGHVDGVGEIVSVKPL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G +    +  P  L ++IA KGS+ ++G+SLTVN +    F + ++ HT  ETT    + 
Sbjct: 116 GRAKEYWIKAPDELAKYIAEKGSITVDGISLTVNAIDGARFKLTIVPHTSGETTVDEWQA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL   + +
Sbjct: 176 GVKVNLEVDVIARYLERLLLGDKA 199


>gi|108799356|ref|YP_639553.1| riboflavin synthase subunit alpha [Mycobacterium sp. MCS]
 gi|119868472|ref|YP_938424.1| riboflavin synthase subunit alpha [Mycobacterium sp. KMS]
 gi|108769775|gb|ABG08497.1| riboflavin synthase, alpha subunit [Mycobacterium sp. MCS]
 gi|119694561|gb|ABL91634.1| riboflavin synthase, alpha subunit [Mycobacterium sp. KMS]
          Length = 203

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 67/207 (32%), Positives = 111/207 (53%), Gaps = 8/207 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++    +    RL +     T+    G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEEVGEVVGKEDLTDAARLVIRGPVVTADAGHGDSIAVNGVCLTVVEI----QPG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++   G+G+ +NLER+  +  RL GH+V GH+DGT  ++      
Sbjct: 57  GVFSADVMGETLDRSSLGDVGVGSRVNLERAAAVNSRLGGHIVQGHVDGTGHVIARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNL----VGKNFFDVLLIRHTIEETTWKM 176
                R++LP  L +++  KGS+ ++GVSLTV+        ++F+V LI  T E T    
Sbjct: 117 HWEVVRIALPTALARYVVEKGSITVDGVSLTVSALGRASENDWFEVSLIPTTRELTILGT 176

Query: 177 HKVGDLINIEVDSMMRYIARLYALNTS 203
             +G  +N+EVD + +Y+ RL + +  
Sbjct: 177 APIGTRVNLEVDVIAKYVERLMSTSRE 203


>gi|126732571|ref|ZP_01748369.1| riboflavin synthase subunit alpha [Sagittula stellata E-37]
 gi|126707017|gb|EBA06085.1| riboflavin synthase subunit alpha [Sagittula stellata E-37]
          Length = 198

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 94/200 (47%), Positives = 127/200 (63%), Gaps = 9/200 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G++ A+      +R R+ TSY T+ + +G SIA  G+CLTV+ L       
Sbjct: 1   MFTGIITDVGEVRALERRGD-LRARIGTSYETASIDMGASIACNGVCLTVIGLG-----A 54

Query: 61  NWYEVEVWAETNRITNIAS---WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
           +W+EV++ AET   TNI     W  G+ INLER++K+GD L GH+VSGH+DG   ++ + 
Sbjct: 55  DWFEVDISAETLSKTNIGGNDGWTEGSKINLERALKVGDELGGHIVSGHVDGVATVIGMA 114

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
             GDS       P  L +FIA KGSV LNG SLTVN V    F +  I HT E TTW + 
Sbjct: 115 DEGDSTRVTFDAPTELARFIAPKGSVALNGTSLTVNEVDDTTFGINFIPHTKEVTTWGLT 174

Query: 178 KVGDLINIEVDSMMRYIARL 197
            VGD IN+E+D++ RY+ARL
Sbjct: 175 AVGDRINLEIDTLARYVARL 194


>gi|323491729|ref|ZP_08096907.1| riboflavin synthase subunit alpha [Vibrio brasiliensis LMG 20546]
 gi|323314091|gb|EGA67177.1| riboflavin synthase subunit alpha [Vibrio brasiliensis LMG 20546]
          Length = 217

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDISVTVDVGKLDMSDVKLGDSIATNGVCLTVVEFNSTS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET   T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLETLDKTGFTDYSAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P ++ +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT    +V
Sbjct: 116 GRAIEFWVSMPGDIAKYVAEKGSITVDGISLTVNALRKNQFKLTIVPHTGEETTIADFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSREEQ 200


>gi|116670236|ref|YP_831169.1| riboflavin synthase subunit alpha [Arthrobacter sp. FB24]
 gi|116610345|gb|ABK03069.1| riboflavin synthase, alpha subunit [Arthrobacter sp. FB24]
          Length = 222

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/206 (35%), Positives = 111/206 (53%), Gaps = 11/206 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+ + G+++++         +R+    +T  + LG SIA  G+CLT   +  +   
Sbjct: 1   MFTGIIAEQGRVLSVERNGDVSATVRLHAPGSTEGLALGGSIAVNGVCLTATAIDGKD-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+V  ET   + I     G  +NLER V  G RLDGH+V GH+DG  E+L  + +
Sbjct: 59  ---FSVDVMGETLVRSTIGELDAGDTVNLERCVPAGGRLDGHVVQGHVDGVGELLEREAL 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK-----NFFDVLLIRHTIEETTW 174
           G+    R  +P  L ++IA KGS+ ++GVSLTV  V        +F+V LI  T+ ET  
Sbjct: 116 GNWDRLRFGVPVRLARYIAEKGSIAVDGVSLTVTAVSDASEPAPWFEVGLIPTTLAETGL 175

Query: 175 KMHKVGDLINIEVDSMMRYIARLYAL 200
               +G  +N+EVD + +Y  RL A 
Sbjct: 176 GAKSLGSRVNLEVDVLAKYTERLLAF 201


>gi|162139875|ref|YP_744827.2| riboflavin synthase subunit alpha [Granulibacter bethesdensis
           CGDNIH1]
          Length = 207

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 85/200 (42%), Positives = 117/200 (58%), Gaps = 7/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSY-NTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIVT +G +  ++P+  G  MRL + T     +    G SIA +G CLTVV      
Sbjct: 1   MFTGIVTGLGSVATISPLEGGSDMRLTITTPEGFLTGAVTGASIACSGCCLTVVEF---- 56

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
           + D  +  EV AET   T + SW   + INLER++K+GD L GH+VSGH+DG  E++F+ 
Sbjct: 57  AGDTAFVAEVSAETLSKTTLGSWHQNSMINLERALKIGDELGGHIVSGHVDGVAEVIFVL 116

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
               S   R   P +L ++IA KGS+ ++GVSLTVN V  + F V +I HT   TT    
Sbjct: 117 PEHGSTRMRFRAPSHLARYIAQKGSIAVDGVSLTVNEVENDVFGVNVIPHTCSVTTIGTL 176

Query: 178 KVGDLINIEVDSMMRYIARL 197
             G  +NIE+D + RY+ RL
Sbjct: 177 VAGSRVNIEIDMLARYVDRL 196


>gi|27363796|ref|NP_759324.1| riboflavin synthase subunit alpha [Vibrio vulnificus CMCP6]
 gi|161486647|ref|NP_933655.2| riboflavin synthase subunit alpha [Vibrio vulnificus YJ016]
 gi|27359913|gb|AAO08851.1| riboflavin synthase, alpha subunit [Vibrio vulnificus CMCP6]
          Length = 218

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 128/205 (62%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V T   + S +KLG SIA  G+CLTV+  S+ H  
Sbjct: 1   MFTGIIEAVGTLAAITPRGEDITVTVNTGKLDMSDVKLGDSIATNGVCLTVIDFSDRH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  E+ + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLESLKKTGFANYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVAMPESLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGDETTINDFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     +Q
Sbjct: 176 GRKVNLEVDVLARYMERLLLGQQAQ 200


>gi|253996013|ref|YP_003048077.1| riboflavin synthase subunit alpha [Methylotenera mobilis JLW8]
 gi|253982692|gb|ACT47550.1| riboflavin synthase, alpha subunit [Methylotenera mobilis JLW8]
          Length = 211

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 79/204 (38%), Positives = 119/204 (58%), Gaps = 8/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I    P+   M L +   + + S + LG SIA  G CLTV+ +SE H  
Sbjct: 1   MFTGIIQSVGAITQANPVGADMHLSIASAALDMSDVNLGDSIAVNGTCLTVINMSESH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E  V  ET  +T          +NLE++++L DRL GHLVSGH+DG  ++L    +
Sbjct: 59  ---FEAHVSQETLSVTVG--LDKPHPVNLEKALRLSDRLGGHLVSGHVDGVGKVLKFQSL 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+     +  PH + ++I++KGS+C+NGVSLTVN +  + F + LI HT+E TT  +   
Sbjct: 114 GECWQLDIRAPHAISKYISIKGSICVNGVSLTVNKISGDDFSINLIPHTLEHTTLDLLSE 173

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ R+   +T 
Sbjct: 174 GSPVNLEVDQIARYVERMTQWSTE 197


>gi|163754504|ref|ZP_02161626.1| riboflavin synthase, alpha subunit [Kordia algicida OT-1]
 gi|161325445|gb|EDP96772.1| riboflavin synthase, alpha subunit [Kordia algicida OT-1]
          Length = 198

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/200 (36%), Positives = 113/200 (56%), Gaps = 4/200 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I  +    + + + V +   T+++K+  S+AH G+CLTVV     +  +
Sbjct: 1   MFTGIIEELGVITHLEREKENLHITVQSGL-TNELKIDQSVAHNGVCLTVVD---RNLDE 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N Y V    ET   TN+ +W +   +NLER++KLGDRLDGH+V GH+D       ++   
Sbjct: 57  NTYVVTAIQETLDKTNVGNWQVNDRVNLERAMKLGDRLDGHIVQGHVDQVATCTSVEESN 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S Y       +L      KGS+ +NG SLTV    +N F V +I +T   T ++  KVG
Sbjct: 117 GSWYYTFEYDSSLNNITIEKGSITVNGTSLTVVNSERNSFSVAIIPYTYSHTVFQYMKVG 176

Query: 181 DLINIEVDSMMRYIARLYAL 200
            ++N+E D + +Y+ARL  L
Sbjct: 177 SIVNLEFDVIGKYVARLQGL 196


>gi|23008227|ref|ZP_00049760.1| COG0307: Riboflavin synthase alpha chain [Magnetospirillum
           magnetotacticum MS-1]
          Length = 212

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 88/208 (42%), Positives = 122/208 (58%), Gaps = 8/208 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+VTD+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVTDVGRVVSIEGSDRLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGTG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID-------GTVEI 113
             + V+  AET   T +++W  GT +NLERS+KLGD + GHLV+GH+D            
Sbjct: 60  CRFAVDAAAETLARTTVSAWREGTRVNLERSLKLGDEMGGHLVTGHVDGVAEILARETVT 119

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
              +  G S    L  P  L  FIA KGSVCL+G SLTVN V    F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPAALAGFIAEKGSVCLDGTSLTVNAVSGTDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALN 201
           W   + GD IN+EVD + RY ARL    
Sbjct: 180 WDERRAGDRINLEVDLIARYAARLAEAR 207


>gi|326390343|ref|ZP_08211902.1| riboflavin synthase, alpha subunit [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993620|gb|EGD52053.1| riboflavin synthase, alpha subunit [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 207

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +       ++ +  S      K+G SIA  G+CLTV  +S E    
Sbjct: 1   MFTGIIEETGTVKNIIH-GTFTKIVIKCSKVLEGTKIGDSIAVNGVCLTVTNMSNES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +N+    IG  +NLER++++G R+ GH+V+GHID   +I+      
Sbjct: 57  --FVADVMPETMRASNLKDLKIGNIVNLERALQVGRRMGGHIVTGHIDCAGKIIDKRQEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++   ++++     ++I  KGS+ ++G+SLTV   G ++F V +I HT+ +TT    +VG
Sbjct: 115 NAFIFKIAINKEFTKYIVRKGSIAVDGISLTVVEDGDDYFTVSIIPHTMLKTTLGYKRVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD + +Y+ +L A  
Sbjct: 175 DSVNIEVDILSKYVEKLIAQK 195


>gi|257462875|ref|ZP_05627281.1| riboflavin synthase subunit alpha [Fusobacterium sp. D12]
 gi|317060499|ref|ZP_07924984.1| riboflavin synthase subunit alpha [Fusobacterium sp. D12]
 gi|313686175|gb|EFS23010.1| riboflavin synthase subunit alpha [Fusobacterium sp. D12]
          Length = 215

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++++T     M++++         KLG SIA  G CLT V + +     
Sbjct: 1   MFTGLVEEMGRVLSITEGNHSMQIKIQCKKVLEGAKLGDSIATNGTCLTAVEIGK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N++  +   ET + TN+       F+NLE+S+ L   L GHLV+G +D   +I+ +   G
Sbjct: 56  NYFVADCMHETMKRTNLHRLKKSDFVNLEKSITLSTPLGGHLVTGDVDCEGKIIEIRQDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + LP    +++  KG V L+G SLTV  +G+    V LI H+ E       KVG
Sbjct: 116 IAKIYTVELPKQYMKYVVEKGRVTLDGASLTVMELGEYTLGVSLIPHSQEMIILGKKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D IN+E D + +Y+ +L +    +
Sbjct: 176 DYINVETDLIGKYVEKLLSFPKQE 199


>gi|300712065|ref|YP_003737879.1| riboflavin synthase subunit alpha [Halalkalicoccus jeotgali B3]
 gi|299125748|gb|ADJ16087.1| riboflavin synthase subunit alpha [Halalkalicoccus jeotgali B3]
          Length = 200

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 69/196 (35%), Positives = 110/196 (56%), Gaps = 6/196 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G+++A T    G+RLR+   +  S+++ G S++  G CLTV    E     
Sbjct: 1   MFTGIVEATGEVLARTETDDGLRLRIGCPF-ASELEGGQSVSVNGACLTVEDHDEA---- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V + AET   T +     G  +NLER++    R DGH+V GH+DG  E++ ++ +G
Sbjct: 56  -GFSVFLAAETVSRTYLGELREGERVNLERAMPADGRFDGHVVQGHVDGVGEVVGIEAVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SLP +L  ++  KGS+ ++G+SLTV  +    F V +I  T  ETT    +VG
Sbjct: 115 EDWRFTFSLPDDLANYVVEKGSITVDGISLTVASLSAGEFTVAIIPTTYGETTLSGKEVG 174

Query: 181 DLINIEVDSMMRYIAR 196
           D +++E D + +Y+ R
Sbjct: 175 DPVHLEADVIAKYVER 190


>gi|325676731|ref|ZP_08156405.1| riboflavin synthase subunit alpha [Rhodococcus equi ATCC 33707]
 gi|325552513|gb|EGD22201.1| riboflavin synthase subunit alpha [Rhodococcus equi ATCC 33707]
          Length = 203

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 115/201 (57%), Gaps = 8/201 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A   +A   R  V     TS    G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEELGEIVAKEDLADAARFTVKGPLVTSDAGHGDSIAVNGVCLTVVDV----LDG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++ S GIG+ +NLER+  +  RL GH+V GH+DGT E++      
Sbjct: 57  EAFTADVMRETLVRSSLGSLGIGSRVNLERAAAVNSRLGGHIVQGHVDGTGEVISRSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVN----LVGKNFFDVLLIRHTIEETTWKM 176
           +    R+SLP ++ +++  KGS+ ++GVSLTV+      G  +F++ LI  T+  TT   
Sbjct: 117 NWTVVRISLPSSISRYVVEKGSITVDGVSLTVSALCGEPGDEYFEISLIPTTLGLTTLGA 176

Query: 177 HKVGDLINIEVDSMMRYIARL 197
            + G  +N+EVD + +Y+ RL
Sbjct: 177 AEPGTPVNLEVDVIAKYVERL 197


>gi|164687267|ref|ZP_02211295.1| hypothetical protein CLOBAR_00908 [Clostridium bartlettii DSM
           16795]
 gi|164603691|gb|EDQ97156.1| hypothetical protein CLOBAR_00908 [Clostridium bartlettii DSM
           16795]
          Length = 218

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G +  +T   K  ++R+  +     + LG SIA  G+CLTV  +       
Sbjct: 1   MFTGIVEEVGIVKNITASGKSGKIRICANKVLEDVHLGDSIAVNGVCLTVCEI-----FQ 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET R TN+++    + +NLER++ L  R  GH+V+GH+D T  I+      
Sbjct: 56  NEFVADVMMETVRATNLSTLTRNSKVNLERAMSLSSRFGGHIVTGHVDTTGTIVDFKKEE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +    +   ++  KGS+ ++GVSLTV  V K    V +I HT E TT    KVG
Sbjct: 116 NAVWISIKADEDFLDYVVYKGSITIDGVSLTVAYVDKKILKVSIIPHTKESTTLLGKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           DL+N+E D + +Y+ R  +L+  
Sbjct: 176 DLVNLESDIIGKYVKRFTSLSNE 198


>gi|258645657|ref|ZP_05733126.1| riboflavin synthase, alpha subunit [Dialister invisus DSM 15470]
 gi|260403023|gb|EEW96570.1| riboflavin synthase, alpha subunit [Dialister invisus DSM 15470]
          Length = 216

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 104/203 (51%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG+I  +       RL +         K G SIA  G CLTV+         
Sbjct: 1   MFTGLVEEIGQIKKVDRTGSSCRLTIACHKVLEGTKAGDSIAVNGTCLTVMAFD-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V  ET R T  + +  GT +NLER+++  DRL GH+V GH+D T  IL  +  G
Sbjct: 56  STFSCDVTPETMRRTAFSLFASGTPVNLERALRFCDRLGGHIVLGHVDFTGRILSSEKEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            ++    S      ++I  KGSV ++GVSLTV   G + F + LI HT   T     ++G
Sbjct: 116 IALNLTFSAEEKYMKYILEKGSVAVDGVSLTVAKRGDSSFMISLIPHTGSLTVLSAKRIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           + +NIE D + +YI +L      
Sbjct: 176 EPVNIECDYLGKYIEQLMQKEHE 198


>gi|113868805|ref|YP_727294.1| riboflavin synthase subunit alpha [Ralstonia eutropha H16]
 gi|113527581|emb|CAJ93926.1| riboflavin synthase alpha chain [Ralstonia eutropha H16]
          Length = 206

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 122/207 (58%), Gaps = 15/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  +G+I ++TP+     G+RL +     + S + +G SIA  G C+TV+ ++  
Sbjct: 1   MFTGIVAAVGRIDSVTPLGAADAGVRLHIAAGGLDLSDVIIGDSIAIQGACMTVIAMAP- 59

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
               + ++VEV  E+   T          +NLE++++L DRL GHLVSGH+DG  E++  
Sbjct: 60  ----DSFDVEVSRESLDKTVG--LESTGRVNLEKALRLADRLGGHLVSGHVDGLGEVVHF 113

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEET 172
             +G+S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+E T
Sbjct: 114 APVGESHELRIRAPRELARYLAYKGSVVVNGVSLTVNRVNDEADGCVFSINLIPHTVEVT 173

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYA 199
           T +  K G  +N+E+D + RY+ R+ +
Sbjct: 174 TLQELKPGARVNLEIDLIARYVERMLS 200


>gi|90424161|ref|YP_532531.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           BisB18]
 gi|90106175|gb|ABD88212.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           BisB18]
          Length = 202

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 92/203 (45%), Positives = 128/203 (63%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+TD G+I A+TP A+G   RLR+   Y+ + +  G SIA  GICLTVV    ++ 
Sbjct: 1   MFTGIITDQGEITALTPTAQGSLHRLRIACGYDRAGIADGASIAANGICLTVVGSGLDNG 60

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET  +T+   W +GT +NLER++K+GD L GH+V+GH+DG   ++  + 
Sbjct: 61  K-TWYEVDAGAETLAVTSAKHWRVGTRLNLERALKIGDELGGHIVTGHVDGIATVVSREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + +     L+   +L +FIA KGSV L+GVSLTVN      F VL+I HT+E TT    +
Sbjct: 120 LPEMARFELTTSRDLARFIAAKGSVTLDGVSLTVNTAVDTTFSVLIIPHTLEVTTLSNWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  IN+E+D M RY ARL  + 
Sbjct: 180 PGSAINLEIDLMARYAARLAEMK 202


>gi|310822847|ref|YP_003955205.1| riboflavin synthase subunit alpha [Stigmatella aurantiaca DW4/3-1]
 gi|309395919|gb|ADO73378.1| Riboflavin synthase, alpha subunit [Stigmatella aurantiaca DW4/3-1]
          Length = 216

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 109/202 (53%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D+G +  +        L + TS       LG SIA  G CLTVV         
Sbjct: 1   MFTGLIQDVGVVERVV-TGGMTDLWLRTSLGAGSFALGESIAVDGACLTVVE-----RGG 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + ++V+   ET R T +     GT +NLER++ LGDRL GHLV+GH+D   E+L     G
Sbjct: 55  DTFKVQAAPETLRRTTMGELRPGTRVNLERAMALGDRLGGHLVAGHVDAVSEVLETRPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S      LP  L  +   KGSV ++G+SLTVN V  + F V LI  T E TT +   VG
Sbjct: 115 GSWVMAFRLPQELAPYFIDKGSVAVDGISLTVNAVLSDRFTVQLIPETQERTTLRAKAVG 174

Query: 181 DLINIEVDSMMRYIARLYALNT 202
             +N+E D + +Y+ARL++L  
Sbjct: 175 ARVNLEADMIGKYVARLFSLRQ 196


>gi|288817689|ref|YP_003432036.1| riboflavin synthase alpha chain [Hydrogenobacter thermophilus TK-6]
 gi|288787088|dbj|BAI68835.1| riboflavin synthase alpha chain [Hydrogenobacter thermophilus TK-6]
 gi|308751287|gb|ADO44770.1| riboflavin synthase, alpha subunit [Hydrogenobacter thermophilus
           TK-6]
          Length = 207

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 75/204 (36%), Positives = 118/204 (57%), Gaps = 7/204 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V D+GK+  +   +KG  L V+TS    ++K+G SIA  G+CLTV ++      D
Sbjct: 1   MFTGLVEDVGKVKNIKISSKGGTLEVITS--LKEIKVGDSIAVNGVCLTVTKVE-----D 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +    ++  ET R +N++   +G  +NLER++K+GDRL GH++ GH+D T  I     +G
Sbjct: 54  SIISFDLSPETLRRSNLSKAFVGDLVNLERAIKVGDRLGGHILLGHVDFTSRIESFRSVG 113

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D    ++ +P     +   KGSV ++G+SLTVN V  N   + +I HT + T  K  K G
Sbjct: 114 DHYELKIYIPDEWILYFVEKGSVGIDGISLTVNTVEGNLISLNIIPHTYQNTNLKGRKEG 173

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIEVD + +Y+    +    +
Sbjct: 174 DHVNIEVDILGKYVINYLSKRRER 197


>gi|251796360|ref|YP_003011091.1| riboflavin synthase, subunit alpha [Paenibacillus sp. JDR-2]
 gi|247543986|gb|ACT01005.1| riboflavin synthase, alpha subunit [Paenibacillus sp. JDR-2]
          Length = 223

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/204 (31%), Positives = 104/204 (50%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G +  +    + M L V  S  T  + LG SI+  G+CLTV+         
Sbjct: 1   MFTGLVEEVGTLRRVKKQGEAMVLTVEASKVTEGVALGDSISVNGVCLTVISFDRTS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             ++ +V  ET R +N+     G  +NLER++  G R  GH+V GH+DG   I   +   
Sbjct: 58  --FDADVMPETYRKSNLHQLRPGQDVNLERAMLAGGRFGGHIVQGHVDGVGMITGRETDA 115

Query: 121 DSMYCRLS-LPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++   +      + +++  KGS+ ++G+SLTV       F V +I HT+ ET     K 
Sbjct: 116 NAVVFAIRLSDDEMMRYVIPKGSITIDGISLTVVSTNATGFSVSVIPHTLGETALMNKKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD +NIE D + +Y+  L     +
Sbjct: 176 GDSVNIECDVIGKYVDHLLHYKPA 199


>gi|86147436|ref|ZP_01065748.1| riboflavin synthase subunit alpha [Vibrio sp. MED222]
 gi|85834729|gb|EAQ52875.1| riboflavin synthase subunit alpha [Vibrio sp. MED222]
          Length = 218

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + + +KLG SIA  G+CLTVV  +     
Sbjct: 1   MFTGIVEAVGTLSAITPRGEDITVTVNVGHLDMADVKLGDSIATNGVCLTVVEYN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           D+ Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 56  DHSYSADLSLETLKKTGFVDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  + +++A KGSV ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWVEMPAEISKYVAQKGSVTVDGISLTVNDLRKNAFKLTIVPHTSSETTIDQFNV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLQGQQQE 200


>gi|148255995|ref|YP_001240580.1| riboflavin synthase subunit alpha [Bradyrhizobium sp. BTAi1]
 gi|146408168|gb|ABQ36674.1| riboflavin synthase alpha chain [Bradyrhizobium sp. BTAi1]
          Length = 202

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 126/203 (62%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I+++TP  +G   RLR+  SY+ + +  G SIA+ G+CLTVV+ S    
Sbjct: 1   MFTGIVTDIGEIVSLTPRTEGKLHRLRIACSYDQATIADGASIANNGVCLTVVQ-SGVLD 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+  AET  +T    W +GT +NLER++K+GD L GH+VSGH+DG   I+  + 
Sbjct: 60  GKTWFEVDAAAETLALTTARHWRVGTRLNLERALKIGDELGGHIVSGHVDGIATIVSREN 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D           L +FIA KGS+ L+GVSLTVN V    F VL+I HT+  TT     
Sbjct: 120 LPDMARFVFKTTRELARFIATKGSITLDGVSLTVNTVDDLTFSVLIIPHTLSVTTLSSWH 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  +NIEVD M RY ARL  + 
Sbjct: 180 AGSDVNIEVDLMARYAARLTEMK 202


>gi|283458200|ref|YP_003362818.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Rothia mucilaginosa
           DY-18]
 gi|283134233|dbj|BAI64998.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase [Rothia mucilaginosa
           DY-18]
          Length = 480

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 70/207 (33%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+  +G + ++TPI       L +      + ++ G S+A  G+CLT + L     
Sbjct: 51  MFTGIIGALGTVESITPIEGSDAAYLTLNAGDIVADLEHGGSLAVNGVCLTAIDLD--QL 108

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               +      ET R TN+ +   G  +NLER +  G RLDGH+V GH+D    +  +  
Sbjct: 109 QPGQFRAYAMGETLRRTNLGNLNPGDTVNLERCLPAGGRLDGHVVQGHVDAVGTLASVTA 168

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETT 173
                  R +LP  L   +A KGS+ ++GVSLTV  V        +F+V LI  T++ T 
Sbjct: 169 HEAWSTLRFNLPTELAPLLAEKGSIAVSGVSLTVTAVSAPGETPAWFEVGLIPETLKATN 228

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYAL 200
               KVGD +N+E D++ +Y+ RL A 
Sbjct: 229 LGALKVGDSVNLETDALAKYVQRLTAF 255


>gi|255325995|ref|ZP_05367083.1| riboflavin synthase alpha chain/3,4-dihydroxy-2-butanone
           4-phosphate synthase [Rothia mucilaginosa ATCC 25296]
 gi|255296886|gb|EET76215.1| riboflavin synthase alpha chain/3,4-dihydroxy-2-butanone
           4-phosphate synthase [Rothia mucilaginosa ATCC 25296]
          Length = 430

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 70/207 (33%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG--MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+  +G + ++TPI       L +      + ++ G S+A  G+CLT + L     
Sbjct: 1   MFTGIIGALGTVESITPIEGSDAAYLTLNAGDIVADLEHGGSLAVNGVCLTAIDLD--QL 58

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               +      ET R TN+ +   G  +NLER +  G RLDGH+V GH+D    +  +  
Sbjct: 59  QPGQFRAYAMGETLRRTNLGNLNPGDTVNLERCLPAGGRLDGHVVQGHVDAVGTLASVTA 118

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETT 173
                  R +LP  L   +A KGS+ ++GVSLTV  V        +F+V LI  T++ T 
Sbjct: 119 HEAWSTLRFNLPTELAPLLAEKGSIAVSGVSLTVTAVSEPGETPAWFEVGLIPETLKATN 178

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYAL 200
               KVGD +N+E D++ +Y+ RL A 
Sbjct: 179 LGALKVGDSVNLETDALAKYVQRLTAF 205


>gi|256819239|ref|YP_003140518.1| riboflavin synthase, alpha subunit [Capnocytophaga ochracea DSM
           7271]
 gi|256580822|gb|ACU91957.1| riboflavin synthase, alpha subunit [Capnocytophaga ochracea DSM
           7271]
          Length = 194

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 110/199 (55%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGKI+ +      + L V +S+ T+++K+  S+AH G+CLTVV +       
Sbjct: 1   MFTGIIEEIGKIVQIEREEANLHLYVKSSF-TNELKIDQSVAHNGVCLTVVAID-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V   AET   T++ S  +G  +NLER + L  RLDGH+V GHID T     +    
Sbjct: 55  DVYRVTAIAETLAKTHLGSLQVGDAVNLERGMLLNTRLDGHIVQGHIDQTGTCSAIQEEA 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +    +  KGS+ +NGVSLTV     + F V +I +T+  T  +  ++G
Sbjct: 115 GSTRFTFEYDPSTGNVVIEKGSITVNGVSLTVIDATSHSFSVAVIPYTLAHTNLQYLQIG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
            ++N+E D + +Y+ARL  
Sbjct: 175 SVVNLEFDVIGKYVARLMQ 193


>gi|329929770|ref|ZP_08283446.1| riboflavin synthase, alpha subunit [Paenibacillus sp. HGF5]
 gi|328935748|gb|EGG32209.1| riboflavin synthase, alpha subunit [Paenibacillus sp. HGF5]
          Length = 222

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 108/204 (52%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG++  +    + M L +  +     +KLG S++  G+CLT   + +     
Sbjct: 1   MFTGLVEEIGEMRRIGRQGEAMLLSISANRIMDDLKLGDSVSVNGVCLTATAIDK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R TN+     G  +NLER++  G R  GH+V GH+DG   I  +    
Sbjct: 56  GVFTVDVMPETYRNTNLKELQPGGKVNLERAMAAGGRFGGHIVQGHVDGIGVIRSVKADQ 115

Query: 121 DSMYCRLSLPH-NLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           +++   +S    ++ ++I  KGSV L+G+SLTV     + F V +I HT+ ET     K 
Sbjct: 116 NAVVYEISPTDGDVFKYIIPKGSVTLDGISLTVVKTTDSSFTVSIIPHTLAETVLAYKKA 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           GD INIE D + +Y+  L    + 
Sbjct: 176 GDTINIECDILGKYVDHLLHYGSE 199


>gi|311113484|ref|YP_003984706.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
           [Rothia dentocariosa ATCC 17931]
 gi|310944978|gb|ADP41272.1| 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
           [Rothia dentocariosa ATCC 17931]
          Length = 464

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 104/214 (48%), Gaps = 14/214 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM-------RLRVMTSYNTSKMKLGCSIAHAGICLTVVRL 53
           MFTGI+  +G + ++ P+            + +      S +  G S+A  G+CLT V  
Sbjct: 40  MFTGIIGALGTVESVQPVYDAQGTSTGAAYITINAGDIVSDLDHGGSLAVNGVCLTAV-- 97

Query: 54  SEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEI 113
            E+      +      ET   TN+ +   G+ +NLER +    R DGH+V GH+DG   +
Sbjct: 98  DEDSIEPQQFRAYAMGETLTRTNLGTLTQGSIVNLERCMPANGRFDGHVVQGHVDGIATV 157

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHT 168
             +         R S+P  L  ++  KGS+ ++GVSLTV  V  +     +F+V LI  T
Sbjct: 158 TSITEHDAWCTIRFSIPQELAPYLVEKGSIAVSGVSLTVTAVSASAESAPWFEVGLIPET 217

Query: 169 IEETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           +  T      VGD +N+E D++ +Y+ARL  +  
Sbjct: 218 LSTTNLGQLTVGDTVNLETDALAKYVARLMEMRN 251


>gi|192291383|ref|YP_001991988.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           TIE-1]
 gi|192285132|gb|ACF01513.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 202

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 93/203 (45%), Positives = 124/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  + P+A+G   RLR+  +Y+ + +  G SIA  GIC+TVV  S    
Sbjct: 1   MFTGIVTDIGEIETVKPVAQGQLHRLRIRCAYDQTTIADGASIASNGICMTVVG-SGTAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET   T   +W  GT +NLER++K+GD L GH+V+GH+DG  +++  + 
Sbjct: 60  GKTWYEVDAGAETLAKTTAKAWTAGTRLNLERALKIGDELGGHIVTGHVDGIAKVVAREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLETSRELARFIAPKGSVTLDGTSLTVNTVEDTKFSVLIIPHTLSATILGGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG  +NIEVD M RY ARL  + 
Sbjct: 180 VGSEVNIEVDLMARYAARLSEMK 202


>gi|326382173|ref|ZP_08203865.1| riboflavin synthase subunit alpha [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198903|gb|EGD56085.1| riboflavin synthase subunit alpha [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 214

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 109/202 (53%), Gaps = 10/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G++ A   + +  R R+     TS    G SIA  G+CLTV  L E     
Sbjct: 1   MFTGIVEERGEVTARDDLTEAARFRIRGPLVTSDASFGDSIAVNGVCLTVTELGEGE--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V AET   +++   G G  +NLER++  G R  GH+V GH+DG   I  +    
Sbjct: 58  --FTVDVMAETLERSSLDRLGPGASVNLERAMAAGGRFGGHIVQGHVDGVGVIASVSPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN-----FFDVLLIRHTIEETTWK 175
           +    R+ LP  L +++  KGS+ ++G+SLTV+ +G +     + +V LI  T+ ET   
Sbjct: 116 NWTVVRVQLPAQLSRYVVEKGSITIDGISLTVSAIGSDREYGDWLEVSLIPTTLAETNLG 175

Query: 176 MHKVGDLINIEVDSMMRYIARL 197
               G  +N+EVD + +Y+ RL
Sbjct: 176 DAAAGVRVNLEVDVIAKYVERL 197


>gi|289523034|ref|ZP_06439888.1| riboflavin synthase, alpha subunit [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503577|gb|EFD24741.1| riboflavin synthase, alpha subunit [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 218

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 64/198 (32%), Positives = 111/198 (56%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  IG ++++        L +     + ++ L  S++ +G CL+VV+        
Sbjct: 1   MFTGLVETIGIVLSLDRRGDVTNLTIEAPEISGELALNESVSVSGACLSVVKRER----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  E+  ET  +T +        +NLER++K+GDRL GH+V GH++G   +  +    
Sbjct: 56  SCFVAEMMGETVTVTKLGFLKPFDKVNLERALKVGDRLGGHIVLGHVEGVGFVSGISRKT 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++  R+    +L ++I  KGS+ ++GVSLTV  V +N F V +I  T++ TT    KVG
Sbjct: 116 ETIALRVKADPSLIRYILPKGSIAVDGVSLTVIDVEENLFTVGVIPSTLKLTTLGDLKVG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D++N+E D + +YI R  
Sbjct: 176 DMVNLETDIIGKYIERFL 193


>gi|327484785|gb|AEA79192.1| Riboflavin synthase alpha chain [Vibrio cholerae LMA3894-4]
          Length = 217

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 118/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL  +   
Sbjct: 176 GRRVNLEVDVLARYMERLLQVQQE 199


>gi|150388846|ref|YP_001318895.1| riboflavin synthase subunit alpha [Alkaliphilus metalliredigens
           QYMF]
 gi|149948708|gb|ABR47236.1| riboflavin synthase, alpha subunit [Alkaliphilus metalliredigens
           QYMF]
          Length = 218

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 74/203 (36%), Positives = 118/203 (58%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG + A+   +K  +L +       ++KLG SI+  G+CLTVV   +     
Sbjct: 1   MFTGLIEEIGTVEAVRKGSKSAQLTIKAKQVVERVKLGDSISTNGVCLTVVEFGQ----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET R +N+ +   G+ +NLER++KLGDRL GH+VSGHIDG   I  ++   
Sbjct: 56  NGFTVDVMPETMRRSNLKNVKHGSSVNLERALKLGDRLGGHMVSGHIDGVGIIQGIEEED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++ +  +  P    +++  KGS+ ++G SLTV  V +    V +I  T +ETT    KVG
Sbjct: 116 NATWVTIKAPIGTLKYVIEKGSIAIDGTSLTVAYVDQETLKVSIIPLTRDETTLLSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           + +N+E D + +YI RL     +
Sbjct: 176 EEVNLECDMVGKYIERLTMFKEA 198


>gi|325283810|ref|YP_004256351.1| riboflavin synthase, alpha subunit [Deinococcus proteolyticus MRP]
 gi|324315619|gb|ADY26734.1| riboflavin synthase, alpha subunit [Deinococcus proteolyticus MRP]
          Length = 224

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 109/214 (50%), Gaps = 16/214 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI++ +G++        G+ LR+  +     ++LG SIA  G CLTV         D
Sbjct: 1   MFTGIISQVGRVAHSEQKNGGVSLRIAPAELWPDLELGESIACNGTCLTVTDWD-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V++  ET   T    W  G  +NLER+++ GDR  GH+VSGH+DG  EI+ +    
Sbjct: 56  TTFGVDLSQETLAKTAP-HWNAGDLLNLERAMRAGDRFGGHIVSGHVDGVGEIVSVSPAE 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----------KNFFDVLLIRHTIE 170
            +    +  P  L  ++  KGS+ ++GVSLT+   G          +N F + L+ HT+E
Sbjct: 115 GAYVMVVRAPDFLAPYLMPKGSITVDGVSLTIVDSGGPAGSRPDLAENEFTLWLVPHTLE 174

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
            TT      G  +N+E D M +Y+ RL A    +
Sbjct: 175 VTTLHAWAPGRPVNLEADQMAKYLDRLLAFREGR 208


>gi|15805191|ref|NP_293878.1| riboflavin synthase subunit alpha [Deinococcus radiodurans R1]
 gi|6457822|gb|AAF09743.1|AE001878_2 riboflavin synthase, alpha subunit [Deinococcus radiodurans R1]
          Length = 214

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 69/213 (32%), Positives = 110/213 (51%), Gaps = 16/213 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  IG++         + + +  +   + + LG SIA  G CLTV    E+    
Sbjct: 1   MFTGIIEQIGRVTHAAEQNGNLAVTIAPTQMWADLVLGESIACGGTCLTVTGWDEQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V++  ET   T    W  G  +NLER++    R  GH+VSGH+DG  E+L +    
Sbjct: 58  --FCVDLSRETLAKTAP-HWEAGQEVNLERAMTAQARFGGHIVSGHVDGVGEVLEVREEP 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----------NFFDVLLIRHTIE 170
            +   R+  P +L +++  KGSV ++GVSLT+  VG           + F + L+ HT+E
Sbjct: 115 GAYTMRVRAPRSLAKYLTPKGSVTVDGVSLTLVDVGGPAGSRPEWPLDEFTLWLVPHTLE 174

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALNTS 203
            TT K  + G  +N+E D + +Y+ RL A+  +
Sbjct: 175 VTTLKHWRAGTRVNLEADQVAKYVERLLAVGAA 207


>gi|298529748|ref|ZP_07017151.1| riboflavin synthase, alpha subunit [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511184|gb|EFI35087.1| riboflavin synthase, alpha subunit [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 218

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 67/199 (33%), Positives = 102/199 (51%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G++ A        R  +   +  S  + G SIA  G+CLT    S      
Sbjct: 1   MFTGLIQGTGRVAATEKKGLETRFTIRPGFVLSDPRPGESIAVNGVCLTAENFSR----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V   A+T  +T++   G G+ +NLER++ LGDRL GH+VSGH+D    +  +   G
Sbjct: 56  DAFHVYASAQTISVTSLKDLGTGSHVNLERALALGDRLGGHIVSGHVDCLARVEDIRADG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S    L  P  L   +  KGSV L+GVSLT+   G  +  V +I  T +ETT    K G
Sbjct: 116 ESRRITLVFPEELSPQVIDKGSVALDGVSLTITGCGPGWLQVNIIPATWKETTLAGWKKG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+  +  
Sbjct: 176 TQVNMETDLIGKYVQNMLG 194


>gi|297559836|ref|YP_003678810.1| riboflavin synthase, subunit alpha [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296844284|gb|ADH66304.1| riboflavin synthase, alpha subunit [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 210

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 69/208 (33%), Positives = 110/208 (52%), Gaps = 13/208 (6%)

Query: 1   MFTGIVTDIGKIIAMTP---IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEH 57
           MFTGIV ++G+++++       + + L V     +S    G SIA  G+CLTVV   E  
Sbjct: 1   MFTGIVEELGEVVSIQAAGTTGEAVLLTVRGPLVSSDAAHGDSIAVNGVCLTVVDRGE-- 58

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
                +  +V  E+   +++     G+ +NLER+ +   RL GH+V GH+DGT  +L  +
Sbjct: 59  ---GTFTADVMKESLDRSSLGGLTPGSPVNLERAARADGRLGGHIVQGHVDGTAALLSRN 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEET 172
              +    R  LP +L  ++  KGS+ ++G SLTV+ V        FF+V LI  T+  T
Sbjct: 116 PGDNWDVLRFGLPAHLSPYVVEKGSITVDGTSLTVSAVSEPGAEDEFFEVSLIPETLRAT 175

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYAL 200
           T      G  +NIEVD + +Y+ R+ A+
Sbjct: 176 TLGGLVTGATVNIEVDVIAKYVERITAV 203


>gi|149187996|ref|ZP_01866291.1| riboflavin synthase subunit alpha [Vibrio shilonii AK1]
 gi|148837984|gb|EDL54926.1| riboflavin synthase subunit alpha [Vibrio shilonii AK1]
          Length = 217

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 77/204 (37%), Positives = 119/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G +  +TP  + + + V     + S +KLG SIA  G+CLTV   +     
Sbjct: 1   MFTGIIEAVGTLKGITPKGEDISIHVEVGKLDMSDVKLGDSIATNGVCLTVTSFT----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           DN Y  ++  ET + T  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 56  DNSYHADLSVETLKKTGFAHYSVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVDRQQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P  L +++A KGS+ ++G+SLTVN V K+ F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVQMPSELGKYVAEKGSITVDGISLTVNDVRKDAFKLTIVPHTSEETTIDNFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  IN+EVD + RY+ RL     S
Sbjct: 176 GRKINLEVDVLARYMERLLQSKAS 199


>gi|218899273|ref|YP_002447684.1| riboflavin synthase, alpha subunit [Bacillus cereus G9842]
 gi|218541723|gb|ACK94117.1| riboflavin synthase, alpha subunit [Bacillus cereus G9842]
          Length = 214

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 104/204 (50%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  M    + M+L +      S + LG SIA  GICLTV   +      
Sbjct: 1   MFTGIVEELGTIANMQQSGEAMKLTIHAKKILSDVHLGDSIAVNGICLTVTNFT-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET + T++      + +NLER++    R  GH VSGHIDG   IL      
Sbjct: 56  TSFTVDAMPETMQSTSLRMLKPHSKVNLERAMSANGRFGGHFVSGHIDGIGTILTKKQHY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++++   L  +   KGS+ ++G SLT+  + +    + LI HT+ E+       G
Sbjct: 116 NAVYYKIAISDELLHYCLHKGSIAVDGTSLTIFDIDEASITISLIPHTVSESVIGEKNAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R       +
Sbjct: 176 DIVNIECDMIGKYIERFITKPAKR 199


>gi|299067740|emb|CBJ38949.1| Riboflavin synthase (alpha chain) [Ralstonia solanacearum CMR15]
          Length = 217

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 77/207 (37%), Positives = 113/207 (54%), Gaps = 16/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  IG+I  + P+A     G+RL +       + + LG SIA  G C+TVV  ++
Sbjct: 1   MFTGIVAAIGRIETVEPLAANAQAGVRLGIHAGGLPLADVALGDSIAIQGACMTVVAKND 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
            H     ++V+V  E+   T          +NLE++++L D + GHLVSGH+DG   +  
Sbjct: 61  TH-----FDVDVSRESLSKTIG--LDRPGEVNLEKALRLADHIGGHLVSGHVDGLGTVSH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              +G+S   R+     L ++ A KGSV +NGVSLTVN V        F + LI HT+  
Sbjct: 114 FVPVGESYELRVRTSPELGRYFAYKGSVVVNGVSLTVNSVRDDATGCEFSINLIPHTLAV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLY 198
           TT K   VG  +N+E+D + RY+ R+ 
Sbjct: 174 TTLKHLAVGSQVNLEIDLIARYVERML 200


>gi|260588250|ref|ZP_05854163.1| riboflavin synthase, alpha subunit [Blautia hansenii DSM 20583]
 gi|260541388|gb|EEX21957.1| riboflavin synthase, alpha subunit [Blautia hansenii DSM 20583]
          Length = 213

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  +      + L V        MK+G SIA  G+CLTV  L       
Sbjct: 1   MFTGIIEEIGTVHKIKKGQLSVVLEVCAKTVLEDMKIGDSIAVNGVCLTVTAL-----YS 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +A+   G  +NLER++    R  GH+VSGHIDGT +I+++    
Sbjct: 56  GSFVADVMHETLNRSALAALIPGGHVNLERAMSASGRFGGHIVSGHIDGTGKIVYIQKDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +     + +++  KGSV ++G+SLT+    ++ F +  I HT+ +T     K G
Sbjct: 116 NAVWFTIHTNPEIMRYVVEKGSVAIDGISLTIAKADRDRFSISAIPHTVRQTVLNERKEG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
           D +N+E D + +Y+ +  +   +
Sbjct: 176 DSVNLEADIVGKYVGKFLSFKQN 198


>gi|153954786|ref|YP_001395551.1| RibE [Clostridium kluyveri DSM 555]
 gi|219855246|ref|YP_002472368.1| hypothetical protein CKR_1903 [Clostridium kluyveri NBRC 12016]
 gi|146347644|gb|EDK34180.1| RibE [Clostridium kluyveri DSM 555]
 gi|219568970|dbj|BAH06954.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 217

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 114/204 (55%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V +IG+I+ +       R+ + +     ++KLG SIA  G CLTV   +      
Sbjct: 1   MFTGLVEEIGQILEIKNGENSSRITISSRKVLEEVKLGDSIAVNGACLTVTSFT-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V AET R +N+      + +NLER+VK+G+RL GH+V+GHIDG   +  +    
Sbjct: 56  NSFTVDVMAETLRKSNLKLLRRNSNVNLERAVKVGERLGGHIVTGHIDGIGRVKDIKKED 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            + +  +  P  L +++  KGSV L+GVSLT+  V ++   V LI HT  +T  +    G
Sbjct: 116 IATWLVIKPPLELLKYMVSKGSVALDGVSLTIAEVHEDCISVSLIPHTKAQTILQYKSAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D IN+E D + +YI  L     ++
Sbjct: 176 DEINVECDLIGKYIENLILRKETE 199


>gi|260886862|ref|ZP_05898125.1| riboflavin synthase, alpha subunit [Selenomonas sputigena ATCC
           35185]
 gi|330839339|ref|YP_004413919.1| riboflavin synthase, alpha subunit [Selenomonas sputigena ATCC
           35185]
 gi|260863461|gb|EEX77961.1| riboflavin synthase, alpha subunit [Selenomonas sputigena ATCC
           35185]
 gi|329747103|gb|AEC00460.1| riboflavin synthase, alpha subunit [Selenomonas sputigena ATCC
           35185]
          Length = 217

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 72/198 (36%), Positives = 110/198 (55%), Gaps = 9/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G   A+  +A G  + +        + LG SIA  GICLTV      H   
Sbjct: 1   MFTGIIEEVG---ALERLAGG-EIAIRAEKVLEDVALGDSIAVNGICLTVTHFDAAH--- 53

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R T++A    G+ +NLER++ L  RL GH+VSGHIDG   I  +   G
Sbjct: 54  --FTADVMPETVRRTSLAELKRGSRVNLERALTLRSRLGGHIVSGHIDGVGTIAAMQEEG 111

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +    ++ +++  KGSV L+G+SLTV  V    F V LI HT E T  +  ++G
Sbjct: 112 NAILLTVRASADVLRYVVEKGSVALDGISLTVACVSAADFTVSLIPHTREITNLREKRMG 171

Query: 181 DLINIEVDSMMRYIARLY 198
             +NIE D + +Y+ +L+
Sbjct: 172 SRLNIETDILGKYVEKLF 189


>gi|167038696|ref|YP_001661681.1| riboflavin synthase subunit alpha [Thermoanaerobacter sp. X514]
 gi|297543535|ref|YP_003675837.1| riboflavin synthase subunit alpha [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|300913744|ref|ZP_07131061.1| riboflavin synthase, alpha subunit [Thermoanaerobacter sp. X561]
 gi|307723239|ref|YP_003902990.1| riboflavin synthase subunit alpha [Thermoanaerobacter sp. X513]
 gi|166852936|gb|ABY91345.1| riboflavin synthase, alpha subunit [Thermoanaerobacter sp. X514]
 gi|296841310|gb|ADH59826.1| riboflavin synthase, alpha subunit [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|300890429|gb|EFK85574.1| riboflavin synthase, alpha subunit [Thermoanaerobacter sp. X561]
 gi|307580300|gb|ADN53699.1| riboflavin synthase, alpha subunit [Thermoanaerobacter sp. X513]
          Length = 207

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 117/201 (58%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +T      ++ +  S    + K+G SIA  G+CLTV  +S+E    
Sbjct: 1   MFTGIIEETGTVKNITH-GTFTKIVIKCSKVLEETKIGDSIAVNGVCLTVTNISDES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +N+     G+ +NLER++++G R+ GH+V+GHID   +I+      
Sbjct: 57  --FAADVMPETMRASNLKDLKTGSIVNLERALQVGRRMGGHIVTGHIDCVGKIIEKRQEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++   ++++     ++IA KGS+ ++G+SLTV   G ++F V +I HT+ +TT     VG
Sbjct: 115 NAFIFKIAINEKFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTMLKTTLGYKGVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD + +Y+ +L    
Sbjct: 175 DSVNIEVDILSKYVEKLIGKK 195


>gi|75761018|ref|ZP_00741021.1| Riboflavin synthase alpha chain [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74491504|gb|EAO54717.1| Riboflavin synthase alpha chain [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 214

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 103/204 (50%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  M    + M+L +      S + LG SIA  GICLTV   +      
Sbjct: 1   MFTGIVEELGTIANMQRSGEAMKLTIHAKKILSDVHLGDSIAVNGICLTVTNFT-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+    T + T++      + +NLER++    R  GH VSGHIDG   IL      
Sbjct: 56  TSFTVDAMPVTMQSTSLRMLKPHSKVNLERAMSANGRFGGHFVSGHIDGIGTILTKKQHY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++++   L  +   KGS+ ++G SLT+  + +    + LI HT+ E+       G
Sbjct: 116 NAVYYKIAISDELLHYCLHKGSIAVDGTSLTIFDIDEASITISLIPHTVSESVIGEKNAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R       +
Sbjct: 176 DIVNIECDMIGKYIERFITKPAKR 199


>gi|312898693|ref|ZP_07758083.1| riboflavin synthase, alpha subunit [Megasphaera micronuciformis
           F0359]
 gi|310620612|gb|EFQ04182.1| riboflavin synthase, alpha subunit [Megasphaera micronuciformis
           F0359]
          Length = 213

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 76/197 (38%), Positives = 107/197 (54%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I  M   A  +RL V          +G SIA  G+CLTV  ++      
Sbjct: 1   MFTGIIEETGTIAGMERQADSIRLTVRADKVLENTIIGDSIAVNGVCLTVTSMTSSS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R ++      G+ +NLER+V +G RL GH+VSGHIDGT  +  +   G
Sbjct: 58  --FCADVMHETMRRSSFKDIRNGSTVNLERAVAVGGRLGGHIVSGHIDGTGTVSRIVRDG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    ++   +L +FI  KGSVC++GVSLTV  V    F V LI HT   TT    K G
Sbjct: 116 IAHVYYITASDDLLRFIVEKGSVCIDGVSLTVVSVTDTEFSVSLIPHTSGHTTLSEKKAG 175

Query: 181 DLINIEVDSMMRYIARL 197
            ++N+E D + +YI +L
Sbjct: 176 SVVNLETDVIAKYIMKL 192


>gi|218233340|ref|YP_002368915.1| riboflavin synthase subunit alpha [Bacillus cereus B4264]
 gi|218161297|gb|ACK61289.1| riboflavin synthase, alpha subunit [Bacillus cereus B4264]
          Length = 214

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  M    + M+L +      S + LG SIA  GICLTV   +      
Sbjct: 1   MFTGIVEELGTIANMQQSGEAMKLTIHAKKILSDVHLGDSIAVNGICLTVTNFT-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET + T++      + +NLER++    R  GH VSGHIDG   IL      
Sbjct: 56  TSFTVDAMPETMQSTSLRMLKPHSKVNLERAMAANGRFGGHFVSGHIDGIGTILNKKQHY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++++  +L ++   KGS+ ++G SLT+  + ++   + LI HT+ E+       G
Sbjct: 116 NAVYYKIAISDDLLRYCLQKGSIAVDGTSLTIFDIDESSITISLIPHTVSESVIGEKNAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R     T +
Sbjct: 176 DIVNIECDMIGKYIERFITKPTKR 199


>gi|268317613|ref|YP_003291332.1| riboflavin synthase, alpha subunit [Rhodothermus marinus DSM 4252]
 gi|262335147|gb|ACY48944.1| riboflavin synthase, alpha subunit [Rhodothermus marinus DSM 4252]
          Length = 212

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 61/194 (31%), Positives = 102/194 (52%), Gaps = 6/194 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G+I  + P+  G RL +  ++    ++   S+A  G+CLTVV    +    
Sbjct: 1   MFTGIIEEVGQIARIDPLGGGRRLTIRANF-AGALRPDQSVAVNGVCLTVVAADAQ---- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VEV  ET R T +     G  +NLER++    RLDGH V GH+D T E++ ++   
Sbjct: 56  -TFTVEVVEETLRKTTLGRLTDGMPVNLERALPADGRLDGHFVQGHVDTTGEVVSVEVEE 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
                R+  P     ++   GS+ ++G+SLTV  + +    V +I HT  +T     + G
Sbjct: 115 TDRLYRIRFPRAFRPYLIPTGSIAIDGISLTVARLEEETLTVAIIPHTFRKTNVSTWQPG 174

Query: 181 DLINIEVDSMMRYI 194
             +N+E D + +Y+
Sbjct: 175 TPVNLEFDMIGKYV 188


>gi|315186246|gb|EFU20007.1| riboflavin synthase, alpha subunit [Spirochaeta thermophila DSM
           6578]
          Length = 213

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/198 (33%), Positives = 107/198 (54%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  +     G+ +RV        +++G S+A  G+CLTV  L E     
Sbjct: 1   MFTGIVREIGVVREVRREGGGLVVRVEGPGVVGVLEVGASVAVDGVCLTVTALDER---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   + +    +G  +NLE ++ +G+RL GHLVSGH+DG   ++  +   
Sbjct: 57  -TFRADVSYETAARSTLGGVRVGRRVNLEPALAVGERLGGHLVSGHVDGVGRVMVRERRS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
              Y  + +P  L ++IA K SV ++GVSLTV       F V++I HT+  TT    + G
Sbjct: 116 GGEYFAVWVPPELRKYIAPKASVAVDGVSLTVAEKLPEGFSVVVIPHTLAVTTLSDRRQG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           + +N+E D + +Y+  L 
Sbjct: 176 EPVNLECDILAKYVESLL 193


>gi|229524272|ref|ZP_04413677.1| riboflavin synthase alpha chain [Vibrio cholerae bv. albensis
           VL426]
 gi|229337853|gb|EEO02870.1| riboflavin synthase alpha chain [Vibrio cholerae bv. albensis
           VL426]
          Length = 227

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     +   +KLG SIA  G+CLTVV   +    
Sbjct: 11  MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 68

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 69  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 125

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 126 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 185

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 186 GRRVNLEVDVLARYMERLLQGQQE 209


>gi|206971375|ref|ZP_03232326.1| riboflavin synthase, alpha subunit [Bacillus cereus AH1134]
 gi|206734147|gb|EDZ51318.1| riboflavin synthase, alpha subunit [Bacillus cereus AH1134]
          Length = 214

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 107/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G I  M    + M+L +      S + LG SIA  GICLTV   +      
Sbjct: 1   MFTGIVEELGTIANMQQSGEAMKLTIHAKKILSDVHLGDSIAVNGICLTVTNFT-----T 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+   ET + T++      + +NLER++    R  GH VSGHIDG   IL      
Sbjct: 56  TSFTVDAMPETMQSTSLRMLKPHSKVNLERAMAANGRFGGHFVSGHIDGIGTILNKKQHY 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y ++++   L ++   KGS+ ++G SLT+  + ++   + LI HT+ E+       G
Sbjct: 116 NAVYYKIAISDELLRYCLQKGSIAVDGTSLTIFDIDESSITISLIPHTVSESVIGEKNAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R     T +
Sbjct: 176 DIVNIECDMIGKYIERFITKPTKR 199


>gi|15642268|ref|NP_231901.1| riboflavin synthase subunit alpha [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121586177|ref|ZP_01675968.1| riboflavin synthase, alpha subunit [Vibrio cholerae 2740-80]
 gi|121729761|ref|ZP_01682200.1| riboflavin synthase, alpha subunit [Vibrio cholerae V52]
 gi|147673055|ref|YP_001217784.1| riboflavin synthase subunit alpha [Vibrio cholerae O395]
 gi|153216171|ref|ZP_01950310.1| riboflavin synthase, alpha subunit [Vibrio cholerae 1587]
 gi|153823260|ref|ZP_01975927.1| riboflavin synthase, alpha subunit [Vibrio cholerae B33]
 gi|153828200|ref|ZP_01980867.1| riboflavin synthase, alpha subunit [Vibrio cholerae 623-39]
 gi|227082394|ref|YP_002810945.1| riboflavin synthase, alpha subunit [Vibrio cholerae M66-2]
 gi|229507657|ref|ZP_04397162.1| riboflavin synthase alpha chain [Vibrio cholerae BX 330286]
 gi|229512148|ref|ZP_04401627.1| riboflavin synthase alpha chain [Vibrio cholerae B33]
 gi|229513911|ref|ZP_04403373.1| riboflavin synthase alpha chain [Vibrio cholerae TMA 21]
 gi|229519283|ref|ZP_04408726.1| riboflavin synthase alpha chain [Vibrio cholerae RC9]
 gi|229522215|ref|ZP_04411632.1| riboflavin synthase alpha chain [Vibrio cholerae TM 11079-80]
 gi|229607161|ref|YP_002877809.1| riboflavin synthase subunit alpha [Vibrio cholerae MJ-1236]
 gi|254226774|ref|ZP_04920348.1| riboflavin synthase, alpha subunit [Vibrio cholerae V51]
 gi|254849399|ref|ZP_05238749.1| riboflavin synthase subunit alpha [Vibrio cholerae MO10]
 gi|255747036|ref|ZP_05420981.1| riboflavin synthase alpha chain [Vibrio cholera CIRS 101]
 gi|262161420|ref|ZP_06030530.1| riboflavin synthase alpha chain [Vibrio cholerae INDRE 91/1]
 gi|262168269|ref|ZP_06035966.1| riboflavin synthase alpha chain [Vibrio cholerae RC27]
 gi|262190239|ref|ZP_06048513.1| riboflavin synthase alpha chain [Vibrio cholerae CT 5369-93]
 gi|297580913|ref|ZP_06942838.1| riboflavin synthase [Vibrio cholerae RC385]
 gi|298500356|ref|ZP_07010161.1| riboflavin synthase, alpha subunit [Vibrio cholerae MAK 757]
 gi|9656832|gb|AAF95414.1| riboflavin synthase, alpha subunit [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121549589|gb|EAX59613.1| riboflavin synthase, alpha subunit [Vibrio cholerae 2740-80]
 gi|121628512|gb|EAX60998.1| riboflavin synthase, alpha subunit [Vibrio cholerae V52]
 gi|124114429|gb|EAY33249.1| riboflavin synthase, alpha subunit [Vibrio cholerae 1587]
 gi|125620712|gb|EAZ49072.1| riboflavin synthase, alpha subunit [Vibrio cholerae V51]
 gi|126519221|gb|EAZ76444.1| riboflavin synthase, alpha subunit [Vibrio cholerae B33]
 gi|146314938|gb|ABQ19477.1| riboflavin synthase, alpha subunit [Vibrio cholerae O395]
 gi|148876289|gb|EDL74424.1| riboflavin synthase, alpha subunit [Vibrio cholerae 623-39]
 gi|227010282|gb|ACP06494.1| riboflavin synthase, alpha subunit [Vibrio cholerae M66-2]
 gi|227014166|gb|ACP10376.1| riboflavin synthase, alpha subunit [Vibrio cholerae O395]
 gi|229341140|gb|EEO06145.1| riboflavin synthase alpha chain [Vibrio cholerae TM 11079-80]
 gi|229343972|gb|EEO08947.1| riboflavin synthase alpha chain [Vibrio cholerae RC9]
 gi|229349092|gb|EEO14049.1| riboflavin synthase alpha chain [Vibrio cholerae TMA 21]
 gi|229352113|gb|EEO17054.1| riboflavin synthase alpha chain [Vibrio cholerae B33]
 gi|229355162|gb|EEO20083.1| riboflavin synthase alpha chain [Vibrio cholerae BX 330286]
 gi|229369816|gb|ACQ60239.1| riboflavin synthase alpha chain [Vibrio cholerae MJ-1236]
 gi|254845104|gb|EET23518.1| riboflavin synthase subunit alpha [Vibrio cholerae MO10]
 gi|255735438|gb|EET90838.1| riboflavin synthase alpha chain [Vibrio cholera CIRS 101]
 gi|262023161|gb|EEY41865.1| riboflavin synthase alpha chain [Vibrio cholerae RC27]
 gi|262028731|gb|EEY47385.1| riboflavin synthase alpha chain [Vibrio cholerae INDRE 91/1]
 gi|262033884|gb|EEY52350.1| riboflavin synthase alpha chain [Vibrio cholerae CT 5369-93]
 gi|297534739|gb|EFH73575.1| riboflavin synthase [Vibrio cholerae RC385]
 gi|297541049|gb|EFH77103.1| riboflavin synthase, alpha subunit [Vibrio cholerae MAK 757]
          Length = 217

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRRVNLEVDVLARYMERLLQGQQE 199


>gi|169237115|ref|YP_001690315.1| riboflavin synthase subunit alpha [Halobacterium salinarum R1]
 gi|167728181|emb|CAP14969.1| riboflavin synthase alpha subunit [Halobacterium salinarum R1]
          Length = 211

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 70/205 (34%), Positives = 112/205 (54%), Gaps = 8/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +     G RLR+  +        G SI+  G+CLTV    E     
Sbjct: 1   MFTGIIEETGTVERVVDDDDGRRLRIAVT-GFGAFSHGESISVGGVCLTVEDWGE----- 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ V   AET   T +++   G  +NLER++    RLDGH+V GH+D T E++ ++ +G
Sbjct: 55  DWFSVFTAAETLSKTTLSAVSSGDRVNLERALPADGRLDGHVVQGHVDTTTEVVDIEQVG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKN--FFDVLLIRHTIEETTWKMHK 178
           +      +LP    Q++A KGS+ L+G+SLTV  +      F V +I  T E T+     
Sbjct: 115 EDWTFTFALPDGHAQYVAPKGSIALDGISLTVADIDDEAGTFSVAVIPTTYELTSLSERS 174

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
            GD +N+EVD + +Y+ R+ + ++S
Sbjct: 175 PGDRVNVEVDVLAKYVERMASYDSS 199


>gi|187778553|ref|ZP_02995026.1| hypothetical protein CLOSPO_02148 [Clostridium sporogenes ATCC
           15579]
 gi|187772178|gb|EDU35980.1| hypothetical protein CLOSPO_02148 [Clostridium sporogenes ATCC
           15579]
          Length = 217

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 115/204 (56%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++GKI  +      + + +  S   + + LG S+A  G+CLTV   +     +
Sbjct: 1   MFTGIVEEVGKISKIEEGKDFLHITIEGSKVLNPLNLGDSVAVNGVCLTVTNFN-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET + +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G
Sbjct: 56  SSFTADVMAETLKKSSLKTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINIKKEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +     L +++  KGSV L+GVSLT+  + +  F V LI HT EET      +G
Sbjct: 116 IATLLEVKTKETLLKYMVPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILMNKNIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D+INIE D + +YI +   L   +
Sbjct: 176 DIINIECDILGKYIYKFMHLKKEE 199


>gi|254246079|ref|ZP_04939400.1| Riboflavin synthase alpha chain [Burkholderia cenocepacia PC184]
 gi|124870855|gb|EAY62571.1| Riboflavin synthase alpha chain [Burkholderia cenocepacia PC184]
          Length = 209

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 119/211 (56%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVIEKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DTTFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN +        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  + GD +N+EVD + RY+ R+ + + 
Sbjct: 174 TTLRHVQAGDKVNLEVDMIARYVERMLSASQ 204


>gi|315125801|ref|YP_004067804.1| riboflavin synthase subunit alpha [Pseudoalteromonas sp. SM9913]
 gi|315014315|gb|ADT67653.1| riboflavin synthase subunit alpha [Pseudoalteromonas sp. SM9913]
          Length = 217

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 115/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV   GKI  +      + +R+ + + + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIVEATGKIALLQKKQGDLAIRIQSKNLDMSDVKLGDSIATNGVCLTVVD-----KH 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  ++  ET  +T  A + +G  +NLE++++   RL GHLVSGH+DG   I  ++  
Sbjct: 56  IDGFSADLSNETISLTGFAHYALGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITAINAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   NL ++I  KGSVC++G+SLTVN V  N F + ++ HT  +TT    +V
Sbjct: 116 ARATEYWLATDENLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSGQTTIADFQV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTQVNLEVDQIARYLERLV 194


>gi|289577286|ref|YP_003475913.1| riboflavin synthase, subunit alpha [Thermoanaerobacter italicus
           Ab9]
 gi|289526999|gb|ADD01351.1| riboflavin synthase, alpha subunit [Thermoanaerobacter italicus
           Ab9]
          Length = 207

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 69/201 (34%), Positives = 118/201 (58%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +T      ++ +  S    + K+G SIA  G+CLTV  +S+E    
Sbjct: 1   MFTGIIEETGTVKNITH-GTFTKIVIKCSKVLEETKIGDSIAVNGVCLTVTNISDES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +N+    IG+ +NLER++++G R+ GH+V+GHID   +I+      
Sbjct: 57  --FAADVMPETMRASNLKDLKIGSIVNLERALQVGRRMGGHIVTGHIDCVGKIIEKRQEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++   ++++     ++IA KGS+ ++G+SLTV   G ++F V +I HT+ +TT     VG
Sbjct: 115 NAFIFKIAINEKFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTMLKTTLGYKGVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD + +Y+ +L    
Sbjct: 175 DSVNIEVDILSKYVEKLIGKK 195


>gi|229542332|ref|ZP_04431392.1| riboflavin synthase, alpha subunit [Bacillus coagulans 36D1]
 gi|229326752|gb|EEN92427.1| riboflavin synthase, alpha subunit [Bacillus coagulans 36D1]
          Length = 215

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/198 (35%), Positives = 109/198 (55%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  +    + ++L V        ++LG SIA  G+CLTV   +      
Sbjct: 1   MFTGIIEEIGILKRVERGPRSLKLAVQARTVLQDVRLGDSIAVNGVCLTVTSYTP----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   T +A   IG+ +NLER++  G R  GH V+GH+DGT  +     + 
Sbjct: 56  NAFTADVMPETFFSTALAGLNIGSKVNLERAMAAGGRFGGHFVTGHVDGTGTVCLKQRME 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  +S+P +L  F+  KGSV L+G SLTV         V L+ HT + T     K+G
Sbjct: 116 NAVYITISVPSSLSAFLIPKGSVALDGTSLTVFGAADGQLTVSLVPHTQQHTILPEKKIG 175

Query: 181 DLINIEVDSMMRYIARLY 198
           D +NIE D + +Y+A L+
Sbjct: 176 DAVNIECDILAKYMAGLF 193


>gi|126435014|ref|YP_001070705.1| riboflavin synthase subunit alpha [Mycobacterium sp. JLS]
 gi|126234814|gb|ABN98214.1| riboflavin synthase, alpha subunit [Mycobacterium sp. JLS]
          Length = 203

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/207 (32%), Positives = 111/207 (53%), Gaps = 8/207 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+++    +    RL +     T+    G SIA  G+CLTVV +       
Sbjct: 1   MFTGIVEEVGEVVGKEDLTDAARLVIRGPVVTADSGHGDSIAVNGVCLTVVEI----QPG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +++   G+G+ +NLER+  +  RL GH+V GH+DGT  ++      
Sbjct: 57  GVFSADVMGETLDRSSLGDVGVGSRVNLERAAAVNSRLGGHIVQGHVDGTGHVIARTPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNL----VGKNFFDVLLIRHTIEETTWKM 176
                R++LP  L +++  KGS+ ++GVSLTV+        ++F+V LI  T E T    
Sbjct: 117 HWEVVRIALPTALARYVVEKGSITVDGVSLTVSALGRASENDWFEVSLIPTTRELTILGT 176

Query: 177 HKVGDLINIEVDSMMRYIARLYALNTS 203
             +G  +N+EVD + +Y+ RL + +  
Sbjct: 177 APIGTRVNLEVDVIAKYVERLMSTSRE 203


>gi|148654181|ref|YP_001281274.1| riboflavin synthase subunit alpha [Psychrobacter sp. PRwf-1]
 gi|148573265|gb|ABQ95324.1| riboflavin synthase, alpha subunit [Psychrobacter sp. PRwf-1]
          Length = 200

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 79/202 (39%), Positives = 117/202 (57%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   G + ++T +   +RL + +   + S +KLG SIA  GICLTVV +      
Sbjct: 1   MFTGIIESTGTLKSITEVGGDVRLVIESDDLDFSDVKLGDSIASNGICLTVVDMDS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y V+V  ET   T + +W  G  +NLE+++    R  GH+VSGH+DG   +  +   
Sbjct: 57  -NSYAVDVSRETLAKTAMNNWQQGDTLNLEKAMLPTTRFGGHMVSGHVDGVGTVEVMTED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK-MHK 178
             S+Y  +S+P  L+++ A KGS+ ++G+SLT NLV  N   + +I HT E T      K
Sbjct: 116 ARSIYIEISIPEALKKYAATKGSITVDGISLTTNLVKDNIICLNIIPHTAEVTNIARHWK 175

Query: 179 VGDLINIEVDSMMRYIARLYAL 200
           VG  +NIEVD + RY+ RL A+
Sbjct: 176 VGGPVNIEVDLIARYLERLTAV 197


>gi|282857767|ref|ZP_06266976.1| riboflavin synthase, alpha subunit [Pyramidobacter piscolens W5455]
 gi|282584437|gb|EFB89796.1| riboflavin synthase, alpha subunit [Pyramidobacter piscolens W5455]
          Length = 217

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 68/204 (33%), Positives = 107/204 (52%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V  +G I+A++        RV   +   ++K G S+A +G+C TV          
Sbjct: 1   MFTGLVEAVGTIVAVSRRGDVTVFRVGAPF-AGELKRGESVAVSGVCTTVTERD-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + VE+  ET   +  +    G  +NLER++    RLDGH V+GH+DGT  ++ L    
Sbjct: 55  ASFAVELTGETMNASRFSFVTTGERVNLERALPADGRLDGHFVAGHVDGTALVMSLRRGR 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    L+LP +L +++  KGS+C++GVSLTV  V  N   V +I  T+  TT      G
Sbjct: 115 HAADLWLNLPQDLARYVVRKGSLCVDGVSLTVAAVEGNACSVAVIPETLARTTLGTLAAG 174

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +N+E D + RY+ +L  L   +
Sbjct: 175 KKVNVETDLIARYVEKLMGLEAPR 198


>gi|237738552|ref|ZP_04569033.1| riboflavin synthase subunit alpha [Fusobacterium sp. 2_1_31]
 gi|229424205|gb|EEO39252.1| riboflavin synthase subunit alpha [Fusobacterium sp. 2_1_31]
          Length = 218

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNSGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 IAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVHFDKLE 199


>gi|149186472|ref|ZP_01864785.1| riboflavin synthase subunit alpha [Erythrobacter sp. SD-21]
 gi|148830061|gb|EDL48499.1| riboflavin synthase subunit alpha [Erythrobacter sp. SD-21]
          Length = 205

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 109/205 (53%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVT IG I ++       R+ V   ++   + +G SIA +G+CLTVV L      D
Sbjct: 1   MFTGIVTAIGTIESVEQRGDT-RVEVACPFDPDTIDIGASIACSGVCLTVVTLGGTKG-D 58

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
                +V  ET   T    W  G  +NLE +++LGD L GHLV+GH+D   E +     G
Sbjct: 59  ARIGFDVSGETVSRTVPGMWEQGRKLNLEPALRLGDELGGHLVTGHVDTVGEAVSKREEG 118

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEETTWK 175
            S +  + +      F+A KGS+ ++GVSLTVN V     G   F + +I HT E TT  
Sbjct: 119 GSWHFAIRISRAFAPFVAEKGSITVDGVSLTVNNVRDRTDGTCDFALNIIPHTAEVTTLG 178

Query: 176 MHKVGDLINIEVDSMMRYIARLYAL 200
                D +N+E+D + RY+ R+ +L
Sbjct: 179 DLSESDSVNLEIDVLARYLRRMQSL 203


>gi|134280348|ref|ZP_01767059.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 305]
 gi|134248355|gb|EBA48438.1| riboflavin synthase, alpha subunit [Burkholderia pseudomallei 305]
          Length = 211

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 118/211 (55%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPI----AKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I A+TPI      G+RL +     + + + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGRIEAITPIAASPDAGVRLTLRAGGLDLADVALGDSIAIQGACMTVVAKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                + ++VEV  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----ADTFDVEVSRESLNRTVG--LAEPGDVNLEKALRAHDRLGGHIVSGHVDGLGTVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT+E 
Sbjct: 114 FAPVGESHELRVLAPRELGRYLAYKGSITVNGVSLTVNSVDDRDDGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +    G  +N+E+D + RY+ R+ + + 
Sbjct: 174 TTLRHLTAGAKVNLEIDMIARYVERMLSASQ 204


>gi|332534977|ref|ZP_08410795.1| riboflavin synthase alpha chain [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332035595|gb|EGI72087.1| riboflavin synthase alpha chain [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 217

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 114/199 (57%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI  +      + +R+ +   + + +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEATGKIALLQKKQGDLAIRIQSADLDMTDVKLGDSIATNGVCLTVVD-----KH 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  ++  ET  +T  A + +G  +NLE++++   RL GHLVSGH+DG   I  +   
Sbjct: 56  IDGFSADLSNETISLTGFAHYALGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITSITAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   NL ++I  KGSVC++G+SLTVN V  N F + ++ HT E+TT    KV
Sbjct: 116 ARATEYWLTTDENLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSEQTTIAHFKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTQVNLEVDQIARYLERLI 194


>gi|319789428|ref|YP_004151061.1| riboflavin synthase, alpha subunit [Thermovibrio ammonificans HB-1]
 gi|317113930|gb|ADU96420.1| riboflavin synthase, alpha subunit [Thermovibrio ammonificans HB-1]
          Length = 213

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 74/197 (37%), Positives = 111/197 (56%), Gaps = 5/197 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V ++G+++     +KG  L V     +   KLG SIA  G+CLTV ++       
Sbjct: 1   MFTGLVEEVGEVVRFGRSSKGGTLLVEAPLCSQGTKLGDSIAVNGVCLTVTKVE-----G 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N  E  V  ET + +N++    G  +NLER++KLGDRL GHL+ GH+D T +I  +   G
Sbjct: 56  NRLEFFVSPETLKRSNLSQLRPGFRVNLERALKLGDRLGGHLLLGHVDTTTKIEGIRREG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS      LP +    +  KGS+ ++G+SLTV  +    F V +I HT+  T  K  K G
Sbjct: 116 DSFLFLFKLPRSFSHLLVEKGSIGIDGISLTVAGLFPTTFSVAVIPHTLNNTNLKFRKPG 175

Query: 181 DLINIEVDSMMRYIARL 197
           + +N+E D + +Y+ RL
Sbjct: 176 ETVNLEFDVIGKYVVRL 192


>gi|237743880|ref|ZP_04574361.1| riboflavin synthase subunit alpha [Fusobacterium sp. 7_1]
 gi|229432911|gb|EEO43123.1| riboflavin synthase subunit alpha [Fusobacterium sp. 7_1]
          Length = 218

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG V ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 IAKIYEIKISRKYMRYIVEKGRVTIDGASLTVISLTDDTFSVSLIPHTQEKIVLGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVYFDKLE 199


>gi|94984409|ref|YP_603773.1| riboflavin synthase subunit alpha [Deinococcus geothermalis DSM
           11300]
 gi|94554690|gb|ABF44604.1| riboflavin synthase, alpha subunit [Deinococcus geothermalis DSM
           11300]
          Length = 214

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 104/211 (49%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV  +G++         + + V        ++LG SIA  G CLTV    E     
Sbjct: 1   MFTGIVEQVGRVARAEERGGTLTVTVTPERLWPDLELGESIAVNGTCLTVTGWDE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  ++  ET + T   +W +G  +NLER++    R  GH+VSGH+DG  EIL +    
Sbjct: 56  TGFTADLSRETLKKTAP-NWHVGAHLNLERAMTAAARFGGHVVSGHVDGIGEILEVREDS 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG----------KNFFDVLLIRHTIE 170
            S    +    +L +++  KGSV ++GVSLTV   G           N F + L+ HT+ 
Sbjct: 115 GSCTVTVRAAPHLARYLVPKGSVTVDGVSLTVVDTGGPGGSRTDLAPNEFTLWLVPHTLA 174

Query: 171 ETTWKMHKVGDLINIEVDSMMRYIARLYALN 201
            TT    + G ++N+E D + +Y+ RL  + 
Sbjct: 175 VTTLGGWRKGTVVNLEADQLAKYVERLLLMR 205


>gi|89093484|ref|ZP_01166432.1| riboflavin synthase subunit alpha [Oceanospirillum sp. MED92]
 gi|89082174|gb|EAR61398.1| riboflavin synthase subunit alpha [Oceanospirillum sp. MED92]
          Length = 222

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 71/205 (34%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I  +   +  MRL V T   + + +KLG SIA  G+CLT V L      
Sbjct: 1   MFTGIIEAVGTIAGIEEQSGDMRLYVRTGELDLADVKLGDSIATNGVCLTAVEL-----P 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET   T   +  +G  +NLE+++    RL GH+V+GH+DG  EI+     
Sbjct: 56  GDGFVADVSRETLAHTRFHTLSVGERVNLEKALMPTSRLGGHIVTGHVDGLGEIVERKED 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             S+   +  P N+++++A KGSV ++G+SLTVN +    F++ ++ HT +ET    +  
Sbjct: 116 ARSIRFSVKAPANIQRYLAAKGSVTVDGISLTVNAIDGECFELNIVPHTAQETIMTEYVP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G L+++EVD + RY+ RL     ++
Sbjct: 176 GRLVHLEVDIIARYLERLIGHGQAE 200


>gi|332296596|ref|YP_004438519.1| riboflavin synthase, alpha subunit [Thermodesulfobium narugense DSM
           14796]
 gi|332179699|gb|AEE15388.1| riboflavin synthase, alpha subunit [Thermodesulfobium narugense DSM
           14796]
          Length = 197

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 115/201 (57%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ D+G+II+ +P   G ++++        +K+  SIA  G+CLTV +++ +    
Sbjct: 1   MFTGIIEDVGQIISFSPQGYGYKIKISFKKQFDDLKISDSIAVDGVCLTVTKINGQS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +E ++  ET  +T       G  +NLER++K   R  GH+V GH+D   +I  +    
Sbjct: 58  --FEADISKETVSVTTFKHLKAGMKVNLERAMKHDSRFGGHIVLGHVDAVGKIASIKSEK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    +  P  L+++IA KGS+ +NG+SLT+  V +N FDV LI  TI+ET+    KVG
Sbjct: 116 LNTILTVEFPLQLKKYIAHKGSIAINGISLTIAAVKENSFDVALIPLTIKETSLSDKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
            L+NIEVD + RYI  L    
Sbjct: 176 SLVNIEVDVISRYIENLLKYK 196


>gi|296327622|ref|ZP_06870166.1| riboflavin synthase subunit alpha [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155268|gb|EFG96041.1| riboflavin synthase subunit alpha [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 218

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLATPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 VAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVYFDKLE 199


>gi|71280235|ref|YP_267481.1| riboflavin synthase subunit alpha [Colwellia psychrerythraea 34H]
 gi|71145975|gb|AAZ26448.1| riboflavin synthase, alpha subunit [Colwellia psychrerythraea 34H]
          Length = 232

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 126/207 (60%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G I A+   A+G RL + T+  + S +KLG SIA  GICLTVV  +     
Sbjct: 1   MFTGIIEAVGTISAINVNAQGARLVIATNSLDMSDVKLGDSIATNGICLTVVDFNNGKG- 59

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
           +  Y  +V  ET + T  A + +G+ +NLE+++    R  GH+VSGH+DG  EIL ++  
Sbjct: 60  NGSYSADVSNETLQRTGFAGYKVGSKVNLEKAMLASTRFGGHMVSGHVDGVSEILAINNN 119

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV--------GKNFFDVLLIRHTIEE 171
           G+S+   LS+P +L  +IA KGSV ++G SLTVN +         +  F + ++ HT++E
Sbjct: 120 GNSIEYWLSMPSDLAHYIAEKGSVTIDGTSLTVNALAEEGSKGHSQGSFRLTIVPHTVKE 179

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLY 198
           T +  ++VG  +NIEVD + RY+ RL 
Sbjct: 180 TIFAEYQVGSKVNIEVDLIARYLERLL 206


>gi|291461024|ref|ZP_06026498.2| riboflavin synthase, alpha subunit [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379395|gb|EFE86913.1| riboflavin synthase, alpha subunit [Fusobacterium periodonticum
           ATCC 33693]
          Length = 226

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 9   MFTGLVEEKGSVISLNSGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 63

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 64  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEG 123

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 124 IAKIYEVKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 183

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 184 DIVNIETDLVGKYIERFVYFDKLE 207


>gi|289705540|ref|ZP_06501932.1| riboflavin synthase, alpha subunit [Micrococcus luteus SK58]
 gi|289557769|gb|EFD51068.1| riboflavin synthase, alpha subunit [Micrococcus luteus SK58]
          Length = 218

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 109/204 (53%), Gaps = 9/204 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIA--KGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVT +G ++++   A      L +        +  G S+A  G+CLT   L     
Sbjct: 1   MFTGIVTHLGTVVSLEHDAAADTALLTLDAGGALDGLPAGGSLAVDGVCLT--ALDGPAE 58

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
               +  ++  +T R+T++     G  +NLER ++  D LDGH+V GH+DGT E+L +  
Sbjct: 59  RPGVFRADLMGQTLRMTSLGDRAPGDRVNLERCLRPTDHLDGHVVQGHVDGTGEVLAVTP 118

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK-----NFFDVLLIRHTIEETT 173
            G     R+ LP  L +++  +G++ L GVSLTV  V       ++F+V +I  T+E TT
Sbjct: 119 HGAWTTLRIGLPARLARYVPAQGAIALQGVSLTVTAVSDPGAAAHWFEVGIIPATLEATT 178

Query: 174 WKMHKVGDLINIEVDSMMRYIARL 197
             + + GD +N+E D + RY  RL
Sbjct: 179 LGVLRPGDRVNLETDVLARYAERL 202


>gi|170732273|ref|YP_001764220.1| riboflavin synthase subunit alpha [Burkholderia cenocepacia MC0-3]
 gi|169815515|gb|ACA90098.1| riboflavin synthase, alpha subunit [Burkholderia cenocepacia MC0-3]
          Length = 209

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 119/211 (56%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     + + + LG SIA  G C+TV+  + 
Sbjct: 1   MFTGIVAAVGRIESIAPLGTSADAGVRLTVQAGGLDLADVALGDSIAIQGACMTVIEKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  ++V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 60  ----DTTFDVDVSRESLNRTVG--LAQPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVSR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN +        F + LI HT+E 
Sbjct: 114 FAPVGESHELRIVAPRELGRYLAYKGSITVNGVSLTVNTIDDRADGCEFSINLIPHTVEV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  + GD +N+EVD + RY+ R+ + + 
Sbjct: 174 TTLRHVQAGDKVNLEVDMIARYVERMLSASQ 204


>gi|241763273|ref|ZP_04761330.1| riboflavin synthase, alpha subunit [Acidovorax delafieldii 2AN]
 gi|241367548|gb|EER61835.1| riboflavin synthase, alpha subunit [Acidovorax delafieldii 2AN]
          Length = 211

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 77/207 (37%), Positives = 116/207 (56%), Gaps = 14/207 (6%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGI+T +G+I  + P+      G RL + T  N    + LG SIA  G C+TV  LS 
Sbjct: 1   MFTGIITGMGRIATVLPLGDSAVHGKRLTIETPDNYLDDVALGDSIALNGACMTVTTLSP 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  + V+V AE+   T  A       +NLE++++  DRL GH+VSGH+DG  ++  
Sbjct: 61  SSQ---QFTVDVSAESLDKT--AGLDKPGVVNLEKALRANDRLGGHMVSGHVDGLGDVTH 115

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              +G+S   R+  P +L +++A KGS+ +NGVSLTVN +          + LI HT++ 
Sbjct: 116 FAQVGESWELRVLAPRDLGRYLAYKGSITVNGVSLTVNRISDRPDGCEASINLIPHTVQN 175

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLY 198
           T     +VG  +N+EVD + RY+AR+ 
Sbjct: 176 TALGELRVGSRVNLEVDLIARYVARMM 202


>gi|315224676|ref|ZP_07866499.1| riboflavin synthase subunit alpha [Capnocytophaga ochracea F0287]
 gi|314945304|gb|EFS97330.1| riboflavin synthase subunit alpha [Capnocytophaga ochracea F0287]
          Length = 194

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 71/199 (35%), Positives = 110/199 (55%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IGKI+ +      + L V +S+ T+++K+  S+AH G+CLTVV +       
Sbjct: 1   MFTGIIEEIGKIVQIEREEANLHLYVKSSF-TNELKIDQSVAHNGVCLTVVAID-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + Y V   AET   T++ S  +G  +NLER + L  RLDGH+V GHID T     +    
Sbjct: 55  DVYRVTAIAETLAKTHLGSLQVGDAVNLERGMLLNTRLDGHIVQGHIDQTGTCSAIQEEA 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S         +    +  KGS+ +NGVSLTV     + F V +I +T+  T  +  ++G
Sbjct: 115 GSTRFTFEYDPSTGNVVIEKGSITVNGVSLTVIDATFHSFSVAVIPYTLAHTNLQYLQIG 174

Query: 181 DLINIEVDSMMRYIARLYA 199
            ++N+E D + +Y+ARL  
Sbjct: 175 SVVNLEFDVIGKYVARLMQ 193


>gi|229528729|ref|ZP_04418119.1| riboflavin synthase alpha chain [Vibrio cholerae 12129(1)]
 gi|229332503|gb|EEN97989.1| riboflavin synthase alpha chain [Vibrio cholerae 12129(1)]
          Length = 217

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++  KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVVEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRRVNLEVDVLARYMERLLQGQQE 199


>gi|320157205|ref|YP_004189584.1| riboflavin synthase subunit alpha [Vibrio vulnificus MO6-24/O]
 gi|319932517|gb|ADV87381.1| riboflavin synthase alpha chain [Vibrio vulnificus MO6-24/O]
          Length = 218

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 127/205 (61%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V T   + S +KLG SIA  G+CLTV+  S+ H  
Sbjct: 1   MFTGIIEAVGTLAAITPRGEDITVTVDTGKLDMSDVKLGDSIATNGVCLTVIDFSDRH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  E+ + T  A++ +G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YSADLSLESLKKTGFANYQVGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNQV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P +L +++A KGS+ ++G+SLTVN + KN F + ++ HT +ETT    +V
Sbjct: 116 GRAIEFWVVMPESLSKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGDETTINDFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL     +Q
Sbjct: 176 GRKVNLEVDVLARYMERLLLGQQTQ 200


>gi|163738653|ref|ZP_02146067.1| riboflavin synthase, alpha subunit [Phaeobacter gallaeciensis
           BS107]
 gi|161387981|gb|EDQ12336.1| riboflavin synthase, alpha subunit [Phaeobacter gallaeciensis
           BS107]
          Length = 197

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 95/203 (46%), Positives = 130/203 (64%), Gaps = 8/203 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG I  +      +R R+ T Y+T+ + +G SIA  G+CLTV+ L      D
Sbjct: 1   MFTGIVTDIGIITELEQQGD-LRARIRTGYDTATIDIGASIASDGVCLTVIALG-----D 54

Query: 61  NWYEVEVWAETNRITNIAS--WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
           +WY+V++ AET   TNI    W +G  +NLER++K+GD L GH+VSGH+DG  E++ +  
Sbjct: 55  DWYDVQISAETVSKTNIGGNGWTVGKRVNLERALKVGDELGGHIVSGHVDGVAEVVDIRD 114

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW    
Sbjct: 115 EGDSTRVTLRAPEDLARFIAPKGSVALNGTSLTVNDVEGCDFGINFIPHTKEVTTWGDVA 174

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           VG+ +N+E+D++ RY+ARL+  +
Sbjct: 175 VGNAVNLEIDTLARYVARLHEAS 197


>gi|93007293|ref|YP_581730.1| riboflavin synthase subunit alpha [Psychrobacter cryohalolentis K5]
 gi|92394971|gb|ABE76246.1| riboflavin synthase, alpha subunit [Psychrobacter cryohalolentis
           K5]
          Length = 223

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 78/206 (37%), Positives = 112/206 (54%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ +M P    +RL + +   + S +KLG SIA  GICLTVV        
Sbjct: 1   MFTGIIESVGKVKSMQPTGGDIRLTIESDGLDFSDVKLGDSIASNGICLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y V+V  ET   T +     G  +NLE+++    R  GH+V+GH+DG   +  L   
Sbjct: 57  -NHYSVDVSRETIARTALEDLKPGHLVNLEKAMLPTTRFGGHIVAGHVDGVGIVSKLQKD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK-MHK 178
             S+Y  + +P  L  + A KGS+ L+G+SLT NLV  N   + +I HT + T       
Sbjct: 116 ARSIYIEIEIPKELVHYTATKGSITLDGISLTTNLVRDNIVSLNIIPHTAQVTNIAQHWL 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
           +G  +N+EVD + RY+ RL   N SQ
Sbjct: 176 IGSKVNVEVDIVARYLERLL--NKSQ 199


>gi|134095548|ref|YP_001100623.1| riboflavin synthase subunit alpha [Herminiimonas arsenicoxydans]
 gi|133739451|emb|CAL62502.1| riboflavin synthase alpha chain [Herminiimonas arsenicoxydans]
          Length = 205

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 82/212 (38%), Positives = 119/212 (56%), Gaps = 15/212 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK---GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV  +GKI A++P+     G RL V       + + LG SI   G C+TVV  +E 
Sbjct: 1   MFTGIVAAVGKITAISPLGDQAAGHRLTVDAGGLPLADVALGDSITLNGACMTVVAKTE- 59

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
               + +EV+V  E+   T          +NLE++V L +RL GHLVSGH+DG   +   
Sbjct: 60  ----STFEVDVSRESLNCTTG--LDAIGEVNLEKAVTLSERLGGHLVSGHVDGLGTVQKF 113

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEET 172
           + +G+S    +  P  L +FIAVKGS+ +NGVSLTVN V        F V LI HT++ T
Sbjct: 114 EPVGESWLLVVKAPKELAKFIAVKGSIVINGVSLTVNTVADGADACEFSVNLIPHTVQVT 173

Query: 173 TWKMHKVGDLINIEVDSMMRYIARLYALNTSQ 204
           T K  + G  +N+E+D + RY+ R+   + ++
Sbjct: 174 TLKHLQTGSKVNLEIDLIARYVERMLTWSRAE 205


>gi|317154510|ref|YP_004122558.1| riboflavin synthase subunit alpha [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316944761|gb|ADU63812.1| riboflavin synthase, alpha subunit [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 225

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 69/199 (34%), Positives = 111/199 (55%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G++ A        RLR+   +  S ++ G SIA  G CLTV     E   +
Sbjct: 1   MFTGLIMGMGRVEAADARGAETRLRIRALFPLSDIEAGESIAVNGTCLTV-----ETFGN 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+      ET  +T++ +  +G+ +NLER++ +GDR  GH+V+GH+D   E+  +   G
Sbjct: 56  GWFTAYASRETLSVTSLGALKVGSQVNLERAMAMGDRFGGHIVAGHVDCLAEVAGVRPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   RL+ P    + +  KGSV L+G+SLTVN  G ++ +V +I  T E TT      G
Sbjct: 116 ESRIYRLTFPLAQGRHVIPKGSVALDGISLTVNDCGPDWLEVNIIPKTQEATTIAGWTPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R+ A
Sbjct: 176 RRVNMETDIIGKYVERMVA 194


>gi|163852583|ref|YP_001640626.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           PA1]
 gi|240139917|ref|YP_002964394.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           AM1]
 gi|163664188|gb|ABY31555.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           PA1]
 gi|240009891|gb|ACS41117.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           AM1]
          Length = 212

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 87/208 (41%), Positives = 123/208 (59%), Gaps = 8/208 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSVEGSERLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID-------GTVEI 113
             + V+  AET   T + +W  GT +NLERS+KLGD L GHLV+GH+D            
Sbjct: 60  CRFSVDAAAETLARTTVGAWREGTRLNLERSLKLGDELGGHLVTGHVDGVAEILARETVT 119

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
              +  G S    L  P  L  FIA KGS+CL+G SLTVN V  + F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPAALAGFIAEKGSICLDGTSLTVNAVSGHDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALN 201
           W+  + GD IN+EVD + RY ARL    
Sbjct: 180 WEERREGDRINLEVDLLARYAARLAETR 207


>gi|169827592|ref|YP_001697750.1| riboflavin synthase subunit alpha [Lysinibacillus sphaericus C3-41]
 gi|168992080|gb|ACA39620.1| Riboflavin synthase alpha chain [Lysinibacillus sphaericus C3-41]
          Length = 218

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV DIG I A+      M++ V +S  T  ++LG SIA  G+CLTV   +++    
Sbjct: 7   MFTGIVEDIGTIKALQSNKNSMKITVHSSKVTEDVRLGDSIAVNGVCLTVTHFTDQE--- 63

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
               ++V  ET + TN+    +G  +NLER++    R  GH V+GH+D   +IL    + 
Sbjct: 64  --LTMDVMPETVKATNLHQLAVGDPVNLERAMPANGRFGGHFVAGHVDAVGKILRKRPVA 121

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + L   L  F   KGS+ ++G SLT+  V  N+  + LI HT +ET   M K+G
Sbjct: 122 NAVYIDIELSEELTSFCIPKGSITIDGTSLTIFHVESNYVTISLIPHTYKETILGMKKIG 181

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +NIE D + +YI         +
Sbjct: 182 AFVNIETDLVGKYIVNQLKNGQDK 205


>gi|254286059|ref|ZP_04961020.1| riboflavin synthase, alpha subunit [Vibrio cholerae AM-19226]
 gi|150423969|gb|EDN15909.1| riboflavin synthase, alpha subunit [Vibrio cholerae AM-19226]
          Length = 217

 Score =  167 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 72/204 (35%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     N   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLNMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRRVNLEVDVLARYMERLLQGQQE 199


>gi|256846008|ref|ZP_05551466.1| riboflavin synthase, alpha subunit [Fusobacterium sp. 3_1_36A2]
 gi|256719567|gb|EEU33122.1| riboflavin synthase, alpha subunit [Fusobacterium sp. 3_1_36A2]
          Length = 218

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLATPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 IAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGNKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVYFDKLE 199


>gi|86749754|ref|YP_486250.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris HaA2]
 gi|86572782|gb|ABD07339.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           HaA2]
          Length = 202

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 95/203 (46%), Positives = 125/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I A+TP A+G   RLR+  SY+ + +  G SIA  GIC+TVV  S    
Sbjct: 1   MFTGIVTDIGEIEALTPTAQGQLHRLRIGCSYDQATIADGASIASNGICMTVVG-SGTAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET  +T    WG+GT +NLER++K+GD L GH+V+GH+DG   ++  + 
Sbjct: 60  GRTWYEVDAGAETLALTTAKHWGVGTRLNLERALKIGDELGGHIVTGHVDGIATVVARED 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + +     L     L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPEMARFTLETTRELARFIAPKGSVTLDGTSLTVNTVEGTRFSVLIIPHTLSATILGGWR 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
           V   +NIEVD M RY ARL  + 
Sbjct: 180 VDSEVNIEVDLMARYAARLSEMK 202


>gi|296332261|ref|ZP_06874723.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674963|ref|YP_003866635.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296150575|gb|EFG91462.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413207|gb|ADM38326.1| riboflavin synthase subunit alpha [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 215

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 70/198 (35%), Positives = 112/198 (56%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G I +M      M L +  S     + LG SIA  GICLTV   ++     
Sbjct: 1   MFTGIIEETGTIESMKKAGHSMALTIKCSKILEDVHLGDSIAVNGICLTVTDFTK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N + V+V  ET + T++     G+ +NLER++    R  GH VSGH+DGT EI  ++   
Sbjct: 56  NQFTVDVMPETVKATSLNDLSKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEERS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +  +L + + +KGS+ ++GVSLT+  + ++   + LI HTI ETT+    +G
Sbjct: 116 NAVYYDVKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHTISETTFSEKTIG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +NIE D + +Y+ R  
Sbjct: 176 SKVNIECDMIGKYMYRFL 193


>gi|218531423|ref|YP_002422239.1| riboflavin synthase, subunit alpha [Methylobacterium
           chloromethanicum CM4]
 gi|218523726|gb|ACK84311.1| riboflavin synthase, alpha subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 212

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 123/208 (59%), Gaps = 8/208 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSVEGSERLRRIVIESAYDPAGIALGASIACSGPCLTAVTV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID-------GTVEI 113
             + V+  AET   T + +W  GT +NLERS+KLGD L GHLV+GH+D            
Sbjct: 60  CRFSVDAAAETLARTTVGAWREGTRLNLERSLKLGDELGGHLVTGHVDGVAEILVRETVT 119

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
              +  G +    L  P  L  FIA KGS+CL+G SLTVN V  + F VLLI H++  TT
Sbjct: 120 GEDNPWGATERFTLRAPAALAGFIAEKGSICLDGTSLTVNAVSGHDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALN 201
           W+  + GD IN+EVD + RY ARL    
Sbjct: 180 WEDRREGDRINLEVDLLARYAARLAETR 207


>gi|289581078|ref|YP_003479544.1| riboflavin synthase, subunit alpha [Natrialba magadii ATCC 43099]
 gi|289530631|gb|ADD04982.1| riboflavin synthase, alpha subunit [Natrialba magadii ATCC 43099]
          Length = 208

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 66/206 (32%), Positives = 106/206 (51%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + G+I+       G+RLR+      + +  G SI+ +G+CLTV R  +     
Sbjct: 1   MFTGIVEETGEIVGRERTEDGLRLRIAADAVATGVTHGQSISVSGVCLTVERYDD----G 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EV +  ET   T +     G  +NLER++    R DGH+V GH+D    +  ++ + 
Sbjct: 57  AWFEVFLATETVERTYLGDLEEGDTVNLERAMPANGRFDGHIVQGHVDAVATVSNIESVE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-----NLVGKNFFDVLLIRHTIEETTWK 175
           +  +    LP    +++  KGS+ L+G+SLTV         ++   V +I  T E TT  
Sbjct: 117 EDWFFEFELPAGYGRYVVEKGSITLDGISLTVADLETTEDEQDRVTVAIIPTTYELTTLS 176

Query: 176 MHKVGDLINIEVDSMMRYIARLYALN 201
              +GD I++EVD + +Y+ RL    
Sbjct: 177 EKAIGDPIHLEVDVLSKYVERLLESR 202


>gi|256027508|ref|ZP_05441342.1| riboflavin synthase subunit alpha [Fusobacterium sp. D11]
 gi|289765471|ref|ZP_06524849.1| riboflavin synthase subunit alpha [Fusobacterium sp. D11]
 gi|289717026|gb|EFD81038.1| riboflavin synthase subunit alpha [Fusobacterium sp. D11]
          Length = 218

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 109/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFIADCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG V ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 IAKIYEIKISRKYMRYIVEKGRVTIDGASLTVISLTDDTFSVSLIPHTQEKIVLGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVYFDKLE 199


>gi|77919047|ref|YP_356862.1| riboflavin synthase subunit alpha [Pelobacter carbinolicus DSM
           2380]
 gi|77545130|gb|ABA88692.1| riboflavin synthase, alpha subunit [Pelobacter carbinolicus DSM
           2380]
          Length = 216

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 63/198 (31%), Positives = 111/198 (56%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ D+G +      A+  ++ V T+   +++ +G SIA  G+CLTV         +
Sbjct: 1   MFTGLIEDLGVLKRFQKTAQSGKITVATAIPMAEIVMGESIAVNGVCLTVTDFG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+   TN+     G+ +NLER++KL DRL GH+VSGH+D    +       
Sbjct: 56  GTFTADVSPESLSRTNLGQLQAGSRVNLERALKLSDRLGGHIVSGHVDALGLVTKRFQDQ 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   + +  +  + +  KGSV ++G+SLTVN V +  F + +I H++ +TT +  + G
Sbjct: 116 NAVRFTIEVAESQMRLLVEKGSVTVDGISLTVNSVAERSFGIAVIPHSLSKTTLQWCEPG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +NIE D + +Y+ RL 
Sbjct: 176 TQVNIETDILGKYVERLL 193


>gi|330815803|ref|YP_004359508.1| Riboflavin synthase, alpha subunit [Burkholderia gladioli BSR3]
 gi|327368196|gb|AEA59552.1| Riboflavin synthase, alpha subunit [Burkholderia gladioli BSR3]
          Length = 211

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 73/211 (34%), Positives = 113/211 (53%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I ++ P+      G+RL V     +   + LG SIA  G C+T +  + 
Sbjct: 1   MFTGIVAAVGRIESIAPLGTEADAGVRLVVRAGGLDLGDVALGDSIAIQGACMTAIETTA 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
           E      + V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  E-----TFTVDVSRESLNKTVG--LSEPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT++ 
Sbjct: 114 FAPVGESHELRVLAPKALGKYLAYKGSITVNGVSLTVNAVKDLADGCEFSINLIPHTVQV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  K G  +N+E+D + RY+ R+     
Sbjct: 174 TTLRHLKAGSKVNLEIDMIARYVERMLGAGQ 204


>gi|167036453|ref|YP_001664031.1| riboflavin synthase subunit alpha [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256751434|ref|ZP_05492312.1| riboflavin synthase, alpha subunit [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|320114878|ref|YP_004185037.1| riboflavin synthase subunit alpha [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855287|gb|ABY93695.1| riboflavin synthase, alpha subunit [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256749653|gb|EEU62679.1| riboflavin synthase, alpha subunit [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|319927969|gb|ADV78654.1| riboflavin synthase, alpha subunit [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 207

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 68/201 (33%), Positives = 115/201 (57%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G +  +       ++ +  S      K+G SIA  G+CLTV  +S E    
Sbjct: 1   MFTGIIEETGTVKNIIH-GTFTKIVIKCSKVLEGTKIGDSIAVNGVCLTVTNMSNES--- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET R +N+    IG+ +NLER++++G R+ GH+V+GHID   +I+      
Sbjct: 57  --FAADVMPETMRASNLKDLKIGSIVNLERALQVGRRMGGHIVTGHIDCVGKIIDKRQEK 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++   ++++     ++IA KGS+ ++G+SLTV   G ++F V +I HT+ +TT     VG
Sbjct: 115 NAFIFKIAINKEFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTMLKTTLGYKGVG 174

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIEVD + +Y+ +L    
Sbjct: 175 DSVNIEVDILSKYVEKLIGKK 195


>gi|88859177|ref|ZP_01133818.1| Riboflavin synthase subunit E [Pseudoalteromonas tunicata D2]
 gi|88819403|gb|EAR29217.1| Riboflavin synthase subunit E [Pseudoalteromonas tunicata D2]
          Length = 218

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 81/201 (40%), Positives = 122/201 (60%), Gaps = 6/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I A+  I   + + V T   + S ++LG SIA  G+CLTVVRL     +
Sbjct: 1   MFTGIIAAVGQISALKKIGGDLSVTVKTGKLDLSDVQLGDSIATNGVCLTVVRL-----L 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  +V  ET  +T  A + +G  +NLE+++    RL GHLVSGHIDG   ++ +   
Sbjct: 56  ADGFMADVSQETLSLTGFAHYTVGQKVNLEKALMPTSRLGGHLVSGHIDGIATVVAMQAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   LS P +L ++I  KGSVC++G+SLTVN +  + F + ++ HT  ETT    KV
Sbjct: 116 GRAVDYWLSAPTHLLKYIPYKGSVCIDGISLTVNELNASQFKLTIVPHTAIETTISHFKV 175

Query: 180 GDLINIEVDSMMRYIARLYAL 200
           G  +N+EVD + RY+ RL  L
Sbjct: 176 GSTVNLEVDQLARYMERLLTL 196


>gi|254303902|ref|ZP_04971260.1| riboflavin synthase alpha subunit [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324094|gb|EDK89344.1| riboflavin synthase alpha subunit [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 218

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLATPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 IAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVYFDKLE 199


>gi|133778401|dbj|BAF49205.1| riboflavin synthase [Bartonella phoceensis]
          Length = 205

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 90/201 (44%), Positives = 126/201 (62%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TDIG +  +  + +G+ L + T Y    +++G SIA +GICLT+V    + +  
Sbjct: 1   MFTGIITDIGCVEDVQSLKQGLCLNISTRYAVESLEIGASIACSGICLTIVERGLKQANT 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+ VE W E  R+TN+A W  GT++NLERS+KLGD L GH V GH+DG  EI+     G
Sbjct: 61  SWFVVEAWEEALRLTNLAQWKKGTYVNLERSLKLGDELGGHFVFGHVDGLAEIIDQKNEG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           D++   L +P     FI  KGS+ LNG SLTVN +    FDVL+IRHT+E TTW   ++G
Sbjct: 121 DAVRFFLKVPTQFTPFIVNKGSIALNGTSLTVNSIEDYIFDVLIIRHTLEMTTWGQAQIG 180

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +N+E+D   RY  +     
Sbjct: 181 DQVNLEIDQFARYAVKFSGFK 201


>gi|119472107|ref|ZP_01614338.1| riboflavin synthase subunit alpha [Alteromonadales bacterium TW-7]
 gi|119445127|gb|EAW26420.1| riboflavin synthase subunit alpha [Alteromonadales bacterium TW-7]
          Length = 217

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 75/199 (37%), Positives = 113/199 (56%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+   GKI  +      + +R+ +   + S +KLG SIA  G+CLTVV        
Sbjct: 1   MFTGIIEATGKIALLQKKQGDLAIRIQSADLDMSDVKLGDSIATNGVCLTVVD-----KH 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            + +  ++  ET  +T  A + IG  +NLE++++   RL GHLVSGH+DG   I  +   
Sbjct: 56  VDGFSADLSNETIHLTGFAHYSIGQTVNLEKAMQPVSRLGGHLVSGHVDGIATITAITAN 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
             +    L+   +L ++I  KGSVC++G+SLTVN V  N F + ++ HT  +TT    KV
Sbjct: 116 ARATEYWLTTDESLMKYIPYKGSVCIDGISLTVNAVEGNKFKLTIVPHTSGQTTIADFKV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G  +N+EVD + RY+ RL 
Sbjct: 176 GTQVNLEVDQIARYLERLI 194


>gi|332703474|ref|ZP_08423562.1| riboflavin synthase, alpha subunit [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553623|gb|EGJ50667.1| riboflavin synthase, alpha subunit [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 220

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 73/199 (36%), Positives = 107/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+I A+       RLRV   +  + +++G SIA  G CLTV     E    
Sbjct: 1   MFTGLIQGLGRIEAVENRGAESRLRVAPRFALTDVRIGESIAVNGACLTV-----ETWNG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +     AET R TN+     G+ +NLER++  GDRL GHLVSGH+D   E+  +   G
Sbjct: 56  SAFTAYASAETMRRTNLGKLRPGSNVNLERALAFGDRLGGHLVSGHVDCLAEVESVSPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S    L  P      +  KGSV L+G+SLT+N  G +F  V +I  T  +TT      G
Sbjct: 116 ESKKYVLRFPAEYGPTVIEKGSVALDGISLTINECGPDFLSVNIIPETQGQTTILDWAPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R+ A
Sbjct: 176 RAVNMETDLIGKYVQRMIA 194


>gi|91977145|ref|YP_569804.1| riboflavin synthase subunit alpha [Rhodopseudomonas palustris
           BisB5]
 gi|91683601|gb|ABE39903.1| riboflavin synthase, alpha subunit [Rhodopseudomonas palustris
           BisB5]
          Length = 202

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 93/203 (45%), Positives = 125/203 (61%), Gaps = 3/203 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I  +TP+A+G   RLR++ S++ + +  G SIA  G+C+TVV  S    
Sbjct: 1   MFTGIVTDIGEIEKLTPVAQGQLHRLRILCSFDQTTIADGASIASNGVCMTVVG-SGVAG 59

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              WYEV+  AET  +T    W +GT +NLER++K+GD L GH+V+GH+DG   I   + 
Sbjct: 60  GRTWYEVDAGAETLGLTTAKHWSVGTRLNLERALKIGDELGGHIVTGHVDGIATIESREE 119

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           + D     LS    L +FIA KGSV L+G SLTVN V    F VL+I HT+  T     +
Sbjct: 120 LPDMARFTLSTSRELARFIAAKGSVTLDGTSLTVNTVDDTRFSVLIIPHTLSATILSGWQ 179

Query: 179 VGDLINIEVDSMMRYIARLYALN 201
            G  +N+EVD M RY ARL  + 
Sbjct: 180 QGSEVNLEVDLMARYAARLSEMK 202


>gi|187927759|ref|YP_001898246.1| riboflavin synthase subunit alpha [Ralstonia pickettii 12J]
 gi|241662320|ref|YP_002980680.1| riboflavin synthase subunit alpha [Ralstonia pickettii 12D]
 gi|187724649|gb|ACD25814.1| riboflavin synthase, alpha subunit [Ralstonia pickettii 12J]
 gi|240864347|gb|ACS62008.1| riboflavin synthase, alpha subunit [Ralstonia pickettii 12D]
          Length = 217

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 75/207 (36%), Positives = 114/207 (55%), Gaps = 16/207 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAK----GMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  ++P+      G+RL +       + + LG SIA  G C+TVV  +E
Sbjct: 1   MFTGIVAAVGRIETVSPLGDNADAGVRLSIDAGGLPLADVALGDSIAIQGACMTVVAKTE 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
                  ++V+V  E+   T          +NLE++++L D + GHLVSGH+DG   + +
Sbjct: 61  TR-----FDVDVSRESLSKTVG--LERPGEVNLEKALRLADHIGGHLVSGHVDGLGTVTY 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              + +S   R+  P  L +++A KGSV +NGVSLTVN V        F + LI HT+  
Sbjct: 114 FAPVNESHELRVRAPVELGKYLAYKGSVVVNGVSLTVNSVRDDADGCEFSINLIPHTVAV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLY 198
           TT K  K G  +N+E+D + RY+ R+ 
Sbjct: 174 TTLKHLKAGSQVNLEIDLIARYVERML 200


>gi|306820098|ref|ZP_07453746.1| riboflavin synthase subunit alpha [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551876|gb|EFM39819.1| riboflavin synthase subunit alpha [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 222

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 68/199 (34%), Positives = 117/199 (58%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK+ ++   +    L +  +     + +G SIA  GICLTV   +++    
Sbjct: 1   MFTGIVEETGKVSSIKRGSHSAILSIAANKILEDIHIGDSIAVNGICLTVTSFNKQ---- 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET + ++++  GIG F+NLER++ +G R  GH+VSGH+DGT EI ++    
Sbjct: 57  -GFSADVMHETIKRSSLSDIGIGDFVNLERAMPVGGRFGGHIVSGHVDGTGEITYIQRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +     + ++I  KGS+ ++G+SLTV  V ++ F +  I HT+E +  K  K+G
Sbjct: 116 NAILYTIKADSKIIRYIVEKGSITVDGMSLTVVSVNEDTFIISAIPHTVEVSILKYRKLG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
           D +N+EVD + +YI    +
Sbjct: 176 DKVNLEVDIVGKYIEHFLS 194


>gi|153803021|ref|ZP_01957607.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-3]
 gi|124121464|gb|EAY40207.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-3]
          Length = 217

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 116/204 (56%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTISVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +    + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFVQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRRVNLEVDVLARYMERLLQGQQE 199


>gi|153826801|ref|ZP_01979468.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-2]
 gi|149739388|gb|EDM53630.1| riboflavin synthase, alpha subunit [Vibrio cholerae MZO-2]
          Length = 217

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/204 (34%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+ A+ P    + + V     +   +KLG SIA  G+CLTVV   +    
Sbjct: 1   MFTGIVEAVGKLTAIIPKGSDVTICVDVGKLDMGDVKLGDSIATNGVCLTVVAFDQRS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +  ++  ET + +  A + +G  +NLE+++    R  GH+VSGH+DG  EI+    +
Sbjct: 59  ---FSADLSMETLKKSGFAQYQVGDRVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERIPV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +++P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT  ETT    +V
Sbjct: 116 GRAVDLWVNMPAEISKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTSAETTIDEFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G  +N+EVD + RY+ RL      
Sbjct: 176 GRRVNLEVDVLARYMERLLQGQQE 199


>gi|226950299|ref|YP_002805390.1| riboflavin synthase, alpha subunit [Clostridium botulinum A2 str.
           Kyoto]
 gi|226841512|gb|ACO84178.1| riboflavin synthase, alpha subunit [Clostridium botulinum A2 str.
           Kyoto]
          Length = 228

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 113/203 (55%), Gaps = 5/203 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      N
Sbjct: 14  FTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFNS-----N 68

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V AET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G 
Sbjct: 69  SFTADVMAETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEGI 128

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +GD
Sbjct: 129 ATLLEIKSKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIGD 188

Query: 182 LINIEVDSMMRYIARLYALNTSQ 204
           +INIE D + +YI +       +
Sbjct: 189 IINIECDVLGKYIYKFMHFKKEE 211


>gi|323699088|ref|ZP_08111000.1| riboflavin synthase, alpha subunit [Desulfovibrio sp. ND132]
 gi|323459020|gb|EGB14885.1| riboflavin synthase, alpha subunit [Desulfovibrio desulfuricans
           ND132]
          Length = 221

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/199 (33%), Positives = 106/199 (53%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++  +G+I A        R R+   ++   ++LG SIA  G+CLTV     E   D
Sbjct: 1   MFTGLILGMGRIEAAEARGSETRFRIRALFDLHDIELGESIAVNGVCLTV-----ETFGD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+      ET  +T++     G  +NLER++ LG+R  GH+V+GH+D   E+  +   G
Sbjct: 56  HWFTCYASRETLSVTSLGGLRPGGTVNLERALALGERFGGHMVAGHVDCLAEVAEVRPAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   RL+      +++  KGSV L+G+SLTVN     + +V +I  T   TT      G
Sbjct: 116 ESKIYRLTFDAAHGRYVIPKGSVALDGISLTVNACAPTWLEVNIIPETQRVTTISGWSPG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R+  
Sbjct: 176 TKVNMETDVIGKYVERMVQ 194


>gi|34763285|ref|ZP_00144244.1| Riboflavin synthase alpha chain [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|237742613|ref|ZP_04573094.1| riboflavin synthase subunit alpha [Fusobacterium sp. 4_1_13]
 gi|294784868|ref|ZP_06750156.1| riboflavin synthase, alpha subunit [Fusobacterium sp. 3_1_27]
 gi|27887056|gb|EAA24168.1| Riboflavin synthase alpha chain [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|229430261|gb|EEO40473.1| riboflavin synthase subunit alpha [Fusobacterium sp. 4_1_13]
 gi|294486582|gb|EFG33944.1| riboflavin synthase, alpha subunit [Fusobacterium sp. 3_1_27]
          Length = 218

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLESVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLSTPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 IAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI R    +  +
Sbjct: 176 DIVNIETDLVGKYIERFVYFDKLE 199


>gi|55379040|ref|YP_136890.1| riboflavin synthase subunit alpha [Haloarcula marismortui ATCC
           43049]
 gi|55231765|gb|AAV47184.1| ribiflavin synthase alpha chain [Haloarcula marismortui ATCC 43049]
          Length = 192

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 70/197 (35%), Positives = 107/197 (54%), Gaps = 6/197 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV   G++ A+     G R+R+        +  G SI+ +G+CLTV    E+ +  
Sbjct: 1   MFTGIVETTGEVQAVIDDEGGRRMRIGAP--FEGLDHGQSISVSGVCLTV----EKAADG 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+EV +  ET   T   +   G  +NLER++    R DGH+V GH+D T EI+ ++  G
Sbjct: 55  EWFEVFLAQETLARTFFDNLDGGDQVNLERAMPADGRFDGHIVQGHVDTTAEIVGIEQEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +      SLP     ++  KGS+ ++G+SLTV       FDV +I  T  ETT     VG
Sbjct: 115 EDWTFTFSLPETHRNYLVQKGSITVDGISLTVADRRSEEFDVAIIPTTYAETTLSEKSVG 174

Query: 181 DLINIEVDSMMRYIARL 197
           D +++EVD + +Y+ +L
Sbjct: 175 DPVHLEVDVVAKYVEQL 191


>gi|284991536|ref|YP_003410090.1| riboflavin synthase subunit alpha [Geodermatophilus obscurus DSM
           43160]
 gi|284064781|gb|ADB75719.1| riboflavin synthase, alpha subunit [Geodermatophilus obscurus DSM
           43160]
          Length = 208

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/213 (34%), Positives = 109/213 (51%), Gaps = 16/213 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG------MRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLS 54
           MFTGIV +IG ++A   + +        RLR+        + LG SIA  G+CLTV    
Sbjct: 1   MFTGIVEEIGTLLAREGLGEADGEATAARLRIRARTALEGVALGDSIAVNGVCLTVTGSD 60

Query: 55  EEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
            E      +  +V AET   +++ + G G  +NLER+V    RL GHLV GH+DG   +L
Sbjct: 61  GEE-----WTTDVMAETLHRSSLGALGAGDPVNLERAVTSHTRLGGHLVQGHVDGVGTVL 115

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG-----KNFFDVLLIRHTI 169
                      R+ LP  L +++  KGS+ ++GVSLTV+ V      + + +V LI  T+
Sbjct: 116 TRTPGEHWEVVRVGLPPELARYVVEKGSITVDGVSLTVSAVSAADDPEPWLEVSLIPTTL 175

Query: 170 EETTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
            +TT      G  +N+EVD + +Y+ RL     
Sbjct: 176 RDTTLGAVPPGSPVNLEVDVIAKYVERLLGARA 208


>gi|85715453|ref|ZP_01046434.1| riboflavin synthase subunit alpha [Nitrobacter sp. Nb-311A]
 gi|85697648|gb|EAQ35524.1| riboflavin synthase subunit alpha [Nitrobacter sp. Nb-311A]
          Length = 232

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 93/204 (45%), Positives = 121/204 (59%), Gaps = 3/204 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGM--RLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGIVTDIG+I ++T  A+    RLR++  Y+ + +  G SIA  G CLTVV  S    
Sbjct: 24  MFTGIVTDIGEIESVTRTAQNQLHRLRILCHYDQTTIADGASIACNGACLTVVA-SGVAG 82

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W++V+V AET  +T    W +GT +NLER++K+GD L GH+V+GH+DG   IL  D 
Sbjct: 83  GSTWFDVDVGAETLNVTTAKHWAVGTRLNLERALKIGDELGGHIVAGHVDGIATILTRDD 142

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
                    S    L +FIAVKGSV L+GVSLTVN V    F VL I  T+  TT    +
Sbjct: 143 QYGMARFEFSTAPKLARFIAVKGSVTLDGVSLTVNSVRHEAFSVLTIPRTLGLTTLGDWR 202

Query: 179 VGDLINIEVDSMMRYIARLYALNT 202
               +NIEVD M RY ARL  + +
Sbjct: 203 QNSEVNIEVDLMARYAARLNEMKS 226


>gi|259416636|ref|ZP_05740556.1| riboflavin synthase, alpha subunit [Silicibacter sp. TrichCH4B]
 gi|259348075|gb|EEW59852.1| riboflavin synthase, alpha subunit [Silicibacter sp. TrichCH4B]
          Length = 201

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 96/205 (46%), Positives = 128/205 (62%), Gaps = 12/205 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+TD+G I  +      +R R+ T+Y+T  + +G SIA  G+CLTVV L       
Sbjct: 1   MFTGIITDVGTITELEQTGD-LRARIQTAYDTGSIDMGASIASDGVCLTVVALGP----- 54

Query: 61  NWYEVEVWAETNRITNI------ASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEIL 114
           +WY+V++ AET   TNI        W +G  +NLER++K+GD L GH+VSGH+DG  E++
Sbjct: 55  DWYDVQISAETISKTNIDGRGNHKGWFVGKRVNLERALKVGDELGGHIVSGHVDGVAEVV 114

Query: 115 FLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTW 174
            +   GDS    L  P +L +FIA KGSV LNG SLTVN V    F +  I HT E TTW
Sbjct: 115 EMRDEGDSTRVTLRAPKDLARFIAPKGSVALNGTSLTVNEVEGCDFGINFIPHTKEVTTW 174

Query: 175 KMHKVGDLINIEVDSMMRYIARLYA 199
               VGDLIN+E+D++ RY+ARL  
Sbjct: 175 GDVSVGDLINLEIDTLARYVARLQE 199


>gi|320533504|ref|ZP_08034173.1| riboflavin synthase, alpha subunit [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|320134281|gb|EFW26560.1| riboflavin synthase, alpha subunit [Actinomyces sp. oral taxon 171
           str. F0337]
          Length = 215

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/208 (35%), Positives = 113/208 (54%), Gaps = 14/208 (6%)

Query: 1   MFTGIVTDIGKIIAMTP----IAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEE 56
           MFTGIV ++G+++A+       A+  RL V         + G SI+  G CLTV  LS  
Sbjct: 1   MFTGIVEELGQVVALEHSAALEARSARLSVRGPVVVEGTRTGDSISVNGCCLTVSELS-- 58

Query: 57  HSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFL 116
              D  +  +V AET + T + +   G+ +NLER+++ GDR+ GH+V GH+D T  +L  
Sbjct: 59  ---DGVFVADVMAETLQHTGLGALAPGSRVNLERALRPGDRMGGHIVQGHVDATGTLLAR 115

Query: 117 DFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV-----GKNFFDVLLIRHTIEE 171
                     +S+P  L  ++AVKGS+ ++G+SLTV              V LI  T+  
Sbjct: 116 HHEERWDVLEISVPDELMGYVAVKGSIAIDGISLTVVDGAGSEGTGGRVTVSLIPETLRR 175

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYA 199
           TT  + +VG+ +N+EVD M +YIAR  +
Sbjct: 176 TTLGLTQVGEAVNLEVDVMAKYIARYLS 203


>gi|149174956|ref|ZP_01853580.1| riboflavin synthase subunit alpha [Planctomyces maris DSM 8797]
 gi|148846293|gb|EDL60632.1| riboflavin synthase subunit alpha [Planctomyces maris DSM 8797]
          Length = 205

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/199 (33%), Positives = 101/199 (50%), Gaps = 6/199 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTG+V   G +  +      + L +    + T+   +G S+A  G CLTVV +      
Sbjct: 1   MFTGLVEGRGTVHLLEKDGSAIDLTLAIPEWITNDAHMGDSVAINGCCLTVVEI-----A 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
             + + +  AET   TN+     G  +NLER +    RL GH V GH+DG   I  +D  
Sbjct: 56  VGFLKFQAGAETLAKTNLGLLAPGDEVNLERPLAANGRLGGHFVQGHVDGVGTIKSIDRD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G+ +    ++P  L   +  KGSV ++G+SLTV       F + LI HT+E TT    +V
Sbjct: 116 GEWITMWFNIPEALALQMVAKGSVTIDGISLTVVECQPAAFSIALIPHTLEVTTLGQKQV 175

Query: 180 GDLINIEVDSMMRYIARLY 198
           G ++NIE D + +Y+ +L 
Sbjct: 176 GSVVNIETDILGKYVQKLI 194


>gi|110598475|ref|ZP_01386746.1| riboflavin synthase, alpha subunit [Chlorobium ferrooxidans DSM
           13031]
 gi|110339925|gb|EAT58429.1| riboflavin synthase, alpha subunit [Chlorobium ferrooxidans DSM
           13031]
          Length = 218

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/205 (33%), Positives = 105/205 (51%), Gaps = 7/205 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVM--TSYNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+ D+G++  +     G+RLRV          + +  S++  G C TVV L E   
Sbjct: 1   MFTGIIKDVGRVRGVVRQKGGLRLRVHYTNPVEFGTLSIDESVSINGACQTVVALGE--- 57

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
              W+EV+   ET   T +     G+ +NLER+V+  DRL GH V GH+D    +  +  
Sbjct: 58  --GWFEVDTVEETLSKTTLGELANGSLVNLERAVRPLDRLGGHFVLGHVDCAASVHEIRE 115

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +G S    +S P     FI   GS+ ++G+SLTV  + +  F   +I +T   TT    K
Sbjct: 116 LGSSRELWISFPETFTPFIVSAGSITIDGISLTVAKLDRLRFAAAVIPYTFAHTTINDLK 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTS 203
            G  +N+E D + +Y+AR   + +S
Sbjct: 176 AGSRVNLEFDILGKYVARQIGMRSS 200


>gi|322807185|emb|CBZ04759.1| riboflavin synthase alpha chain [Clostridium botulinum H04402 065]
          Length = 228

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 112/203 (55%), Gaps = 5/203 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      N
Sbjct: 14  FTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFNS-----N 68

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G 
Sbjct: 69  SFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEGI 128

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +GD
Sbjct: 129 ATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIGD 188

Query: 182 LINIEVDSMMRYIARLYALNTSQ 204
           +INIE D + +YI +       +
Sbjct: 189 IINIECDVLGKYIYKFMHFKKEE 211


>gi|291300091|ref|YP_003511369.1| riboflavin synthase subunit alpha [Stackebrandtia nassauensis DSM
           44728]
 gi|290569311|gb|ADD42276.1| riboflavin synthase, alpha subunit [Stackebrandtia nassauensis DSM
           44728]
          Length = 193

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/202 (35%), Positives = 108/202 (53%), Gaps = 9/202 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G+I+A  P      L +     TS    G SIA  G+CLTV  ++     D
Sbjct: 1   MFTGIVEELGEIVATAP----ASLSIRGKLITSDAHHGDSIAVNGVCLTVTAVT-----D 51

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V+V  ET + T + +   G  +NLER+  L  R+ GHLV GH+D   EIL  +   
Sbjct: 52  DVFTVDVMGETYKRTALDTLKPGDQVNLERAATLSTRMGGHLVQGHVDAVGEILRREPEA 111

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +       +P  L ++I  KGS+ ++GVSLTV  V    F V LI  T++ TT    + G
Sbjct: 112 EWETVTFRVPEALTKYIVEKGSITIDGVSLTVVAVKGEEFSVGLIPTTMQLTTLGRKRPG 171

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D ++IE D + +++ +L    +
Sbjct: 172 DPVHIETDIIAKHVEKLLEAKS 193


>gi|71066694|ref|YP_265421.1| riboflavin synthase subunit alpha [Psychrobacter arcticus 273-4]
 gi|71039679|gb|AAZ19987.1| probable riboflavin synthase alpha chain [Psychrobacter arcticus
           273-4]
          Length = 223

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 78/206 (37%), Positives = 112/206 (54%), Gaps = 9/206 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +GK+ +M P    +RL + +   + S +KLG SIA  GICLTVV        
Sbjct: 1   MFTGIIESVGKVKSMQPTGGDIRLTIESDGLDFSDVKLGDSIASNGICLTVVDFGS---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N Y V+V  ET   T +     G  +NLE+++    R  GH+V+GH+DG   +  L   
Sbjct: 57  -NHYSVDVSRETIARTALKDLKPGHIVNLEKAMLPTTRFGGHIVAGHVDGVGVVSKLQKD 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK-MHK 178
             S+Y  + +P  L  + A KGS+ L+G+SLT NLV  N   + +I HT + T       
Sbjct: 116 ARSIYIEIEIPVELAHYTATKGSITLDGISLTTNLVRDNIVSLNIIPHTAQVTNIAQHWL 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
           +G  +N+EVD + RY+ RL   N SQ
Sbjct: 176 LGSKVNVEVDIVARYLERLL--NKSQ 199


>gi|315122229|ref|YP_004062718.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495631|gb|ADR52230.1| riboflavin synthase subunit alpha [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 204

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 165/200 (82%), Positives = 187/200 (93%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+IIA+ PIAKG+RLR+MTSY+TS M++GCSIAHAGICLTVV+LS+E SV+
Sbjct: 1   MFTGIVTDIGQIIAIMPIAKGLRLRLMTSYDTSTMRVGCSIAHAGICLTVVQLSDESSVN 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWYEVE+W ETNR+TN+ +W IGTF+NLERS+KLGD LDGHLVSGH+DGTVEILF+DF G
Sbjct: 61  NWYEVEIWEETNRLTNVVAWEIGTFVNLERSMKLGDELDGHLVSGHVDGTVEILFMDFFG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+YCRLSLPHNLE+FIAVKGSVCLNGVSLTVNLVG NFFDVLLIRHTIE+TTW MHK G
Sbjct: 121 DSVYCRLSLPHNLEKFIAVKGSVCLNGVSLTVNLVGDNFFDVLLIRHTIEQTTWSMHKTG 180

Query: 181 DLINIEVDSMMRYIARLYAL 200
           DLINIEVDSMMRYI+RL A 
Sbjct: 181 DLINIEVDSMMRYISRLCAF 200


>gi|242278130|ref|YP_002990259.1| riboflavin synthase subunit alpha [Desulfovibrio salexigens DSM
           2638]
 gi|242121024|gb|ACS78720.1| riboflavin synthase, alpha subunit [Desulfovibrio salexigens DSM
           2638]
          Length = 218

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 9/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++   G+I          R +V         + G SIA  G+CLTV     E   D
Sbjct: 1   MFTGLIQGKGRIENAENRGNETRFKVSAPK-IKDYEKGESIAINGVCLTV-----ETYSD 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +W+      E+  +TN+ +   G+ +N ER++ +GDRL GH+VSGH+D    +  +   G
Sbjct: 55  SWFTCYASKESMSVTNLGNLKRGSMVNYERALAMGDRLGGHIVSGHVDCLGSVESVRPEG 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +S   R+  P    +++  KGSV L+G+SLTVN  G ++ +V +I  T EETT  +   G
Sbjct: 115 ESKIYRIKFPIEHGKYVVPKGSVALDGISLTVNDCGPDYLEVNIIPETQEETTISLWTPG 174

Query: 181 DLINIEVDSMMRYIARLYA---LNTSQ 204
             +NIE D + +Y+ R+ A    N S+
Sbjct: 175 YAVNIETDVIGKYVERMVAPWTGNKSE 201


>gi|161485656|ref|NP_602334.2| riboflavin synthase subunit alpha [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 218

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V + G +I++    K ++L++  +     +KLG SIA  G+CLTV   S+     
Sbjct: 1   MFTGLVEEKGSVISLNNGDKSIKLKIKANKVLENVKLGDSIATNGVCLTVTEFSK----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           +++  +   ET   +N+     G  +NLE+S+ L   L GHLV+G +D   EI+ +   G
Sbjct: 56  DYFVADCMFETISRSNLKRLKAGDEVNLEKSITLATPLGGHLVTGDVDCEGEIVSITQEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            +    + +     ++I  KG   ++G SLTV  +  + F V LI HT E+      KVG
Sbjct: 116 VAKIYEIKISRKYMRYIVEKGRATIDGASLTVISLTDDTFSVSLIPHTQEKIILGSKKVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++NIE D + +YI +    +  +
Sbjct: 176 DIVNIETDLVGKYIEKFVYFDKLE 199


>gi|89073131|ref|ZP_01159670.1| riboflavin synthase subunit alpha [Photobacterium sp. SKA34]
 gi|89051084|gb|EAR56541.1| riboflavin synthase subunit alpha [Photobacterium sp. SKA34]
          Length = 218

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 117/204 (57%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    + + V +   + S +KLG SIA  G+CLTVV+L+ +   
Sbjct: 1   MFTGIIEAIGTITALTPKGADISVTVDSGDLDLSDVKLGDSIATNGVCLTVVKLTGK--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T    +  G   NLE+++    R  GH+VSGH+D   EI+     
Sbjct: 58  --GYIADLSLETLKRTAFVHYQAGQVANLEKAMLPTTRFGGHMVSGHVDAVAEIIERHHT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + +P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT      
Sbjct: 116 GRAIEFWVKVPAHLAKYISEKGSVSVDGISLTVNEINGDEFKLTIVPHTALETTMDAFTP 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G +IN+EVD + RY+ RL   + +
Sbjct: 176 GRMINLEVDVIARYLERLMLGDKA 199


>gi|54307993|ref|YP_129013.1| riboflavin synthase subunit alpha [Photobacterium profundum SS9]
 gi|90410897|ref|ZP_01218911.1| riboflavin synthase subunit alpha [Photobacterium profundum 3TCK]
 gi|46912419|emb|CAG19211.1| Putative riboflavin synthase [Photobacterium profundum SS9]
 gi|90328110|gb|EAS44421.1| riboflavin synthase subunit alpha [Photobacterium profundum 3TCK]
          Length = 218

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/204 (35%), Positives = 120/204 (58%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG I A+TP    + + V + + + S +KLG SIA  G+CLTVV L+ +   
Sbjct: 1   MFTGIIEAIGTISALTPKGADISVTVDSGNLDLSDVKLGDSIATNGVCLTVVALTGK--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+D   +I+     
Sbjct: 58  --GYVADLSLETLKRTAFTDYKSGQKVNLEKAMLPTTRFGGHMVSGHVDEVGKIIERTHT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +  P +L ++I+ KGSV ++G+SLTVN +  + F + ++ HT  ETT +  +V
Sbjct: 116 GRAIEFWVKAPAHLAKYISEKGSVSIDGISLTVNAIRGDEFKLTIVPHTASETTMESFQV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTS 203
           G ++N+EVD + RY+ RL   + +
Sbjct: 176 GRVVNLEVDVIARYLERLMLGDKA 199


>gi|260061395|ref|YP_003194475.1| riboflavin synthase subunit alpha [Robiginitalea biformata
           HTCC2501]
 gi|88785527|gb|EAR16696.1| riboflavin synthase subunit alpha [Robiginitalea biformata
           HTCC2501]
          Length = 199

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 65/204 (31%), Positives = 101/204 (49%), Gaps = 6/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +  +  +      + + + +S  T ++K+  S+AH G+CLTVV +       
Sbjct: 1   MFTGIIETLATVTRIQKDRSNLDITLESSL-TPELKIDQSLAHNGVCLTVVAIE-----G 54

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             Y V   AET   +N+     G  +NLER++ LG RLDGH+V GH+D       +    
Sbjct: 55  TTYTVTAVAETLSRSNLGDLREGDRVNLERAMVLGARLDGHIVQGHVDQVGRCTGVSQQD 114

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   R        +    KGS+ ++GVSLTV       F V +I +T E T +  +  G
Sbjct: 115 GSWIFRFDYEPGPGRVTIEKGSITVDGVSLTVVDSAPGSFSVAIIPYTYEHTRFCEYAPG 174

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
             +N+E D + +Y+ARL   +  Q
Sbjct: 175 TRVNLEFDMIGKYVARLMEPHRPQ 198


>gi|323497967|ref|ZP_08102976.1| riboflavin synthase subunit alpha [Vibrio sinaloensis DSM 21326]
 gi|323317012|gb|EGA70014.1| riboflavin synthase subunit alpha [Vibrio sinaloensis DSM 21326]
          Length = 217

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/205 (36%), Positives = 121/205 (59%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+TP  + + + V     + + +KLG SIA  G+CLTVV  S     
Sbjct: 1   MFTGIVEAVGTLTAITPKGEDISVTVEVGKLDMADVKLGDSIATNGVCLTVVDYSATS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T  +++  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YTADLSLETLQKTGFSAYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVSMPEEIAKYVAEKGSITVDGISLTVNALRKNAFKLTIVPHTGEETTIADFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQRDE 200


>gi|118444351|ref|YP_879180.1| riboflavin synthase subunit alpha [Clostridium novyi NT]
 gi|118134807|gb|ABK61851.1| riboflavin synthase, alpha subunit [Clostridium novyi NT]
          Length = 213

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG I ++    +  R+++  +     + LG SI   G+CLTV     +    
Sbjct: 1   MFTGIVEEIGTINSIFQNRENARIKIDANKVLEDVNLGDSICTNGVCLTVTEYDSKS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             + V+V  ET R +N+     G  +NLER++ LG R  GH+VSGHIDG   I      G
Sbjct: 58  --FTVDVMGETLRRSNLGELKKGDKVNLERALALGGRFGGHIVSGHIDGVGVIKEFSNEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++  +   +++ + I  KGS+ ++GVSLTV  V    F V +I HT  ET     K G
Sbjct: 116 NAIWISIETSNDILKSIVFKGSITIDGVSLTVAYVDDYIFKVCIIPHTQSETILTSKKTG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           + +N+E D + +YI +L  +   +
Sbjct: 176 NKVNLECDVIAKYIKKLLMVQEKK 199


>gi|297537848|ref|YP_003673617.1| riboflavin synthase subunit alpha [Methylotenera sp. 301]
 gi|297257195|gb|ADI29040.1| riboflavin synthase, alpha subunit [Methylotenera sp. 301]
          Length = 201

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 78/198 (39%), Positives = 122/198 (61%), Gaps = 8/198 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G+I  +TP+   ++L +     +   +K+G SIA  G+CLT +   E H  
Sbjct: 1   MFTGIIQTVGQIERVTPMGDDVKLNISCTGLDMLDVKIGDSIAVNGVCLTAITFDESH-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              +E  V  E+  +T      I   +NLE++++L DRL GHLVSGH+DG  E++F + +
Sbjct: 59  ---FEAHVSKESLSVTIGLDKPIA--VNLEKALRLSDRLGGHLVSGHVDGVGEVVFFEPL 113

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GD     +  PH + ++I+VKGS+C+NGVSLTVN +  + F + LI HT+E T+ +  K 
Sbjct: 114 GDCWKLDIRAPHAISKYISVKGSICVNGVSLTVNTIASDVFSMNLIPHTLENTSLQFLKA 173

Query: 180 GDLINIEVDSMMRYIARL 197
           G  +N+EVD + RY+ R+
Sbjct: 174 GSRVNLEVDQIARYVERM 191


>gi|239932465|ref|ZP_04689418.1| riboflavin synthase subunit alpha [Streptomyces ghanaensis ATCC
           14672]
 gi|291440829|ref|ZP_06580219.1| riboflavin synthase subunit alpha [Streptomyces ghanaensis ATCC
           14672]
 gi|291343724|gb|EFE70680.1| riboflavin synthase subunit alpha [Streptomyces ghanaensis ATCC
           14672]
          Length = 204

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/202 (37%), Positives = 117/202 (57%), Gaps = 5/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++ A+  +    R R+     T   K G SIA  G+CLTVV         
Sbjct: 1   MFTGIVEELGEVTAVETLDDACRFRLRGPVVTEDAKHGDSIAVNGVCLTVVE-----HEG 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +  +V AET   +++ +  +G+ +NLER + LG RL GH+V GH+DGT EIL      
Sbjct: 56  DEFTADVMAETLNRSSLGALAVGSRVNLERPMALGARLGGHIVQGHVDGTGEILERKPSE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +    ++SLP +L +++  KGS+ ++G+SLTV   G +FF V LI  T+  TT  + + G
Sbjct: 116 NWEVVKVSLPADLSRYVVEKGSITVDGISLTVVDAGPDFFTVSLIPTTLALTTLGLKQPG 175

Query: 181 DLINIEVDSMMRYIARLYALNT 202
           D +N+EVD + +Y+ R+     
Sbjct: 176 DPVNLEVDVIAKYVERMIGDRA 197


>gi|197335014|ref|YP_002155464.1| riboflavin synthase, alpha subunit [Vibrio fischeri MJ11]
 gi|26522771|dbj|BAC44858.1| riboflavin synthase [Vibrio fischeri]
 gi|197316504|gb|ACH65951.1| riboflavin synthase, alpha subunit [Vibrio fischeri MJ11]
          Length = 218

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/205 (35%), Positives = 117/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  +G + A+TP  + + + V     + S +KLG SIA  G+CLTVV ++E+   
Sbjct: 1   MFTGIIESVGTLQAITPKGEDISVTVNVGQLDMSDVKLGDSIATNGVCLTVVAMTEQ--- 57

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T   ++  G  +NLE+++    R  GH+VSGH+D   EI+     
Sbjct: 58  --TYTADLSLETLKRTGFVNYKAGDKVNLEKAMLPTTRFGGHIVSGHVDAVGEIIERHQT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   + LP  L +++  KGS+ ++G+SLTVN + KN F + ++ HT  ETT     V
Sbjct: 116 GRAIEFWIQLPQTLAKYVVEKGSITVDGISLTVNDIRKNAFKLTIVPHTAAETTMDNFSV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      +
Sbjct: 176 GQKVNLEVDVIARYLERLVIGQKEE 200


>gi|224370209|ref|YP_002604373.1| RibE [Desulfobacterium autotrophicum HRM2]
 gi|223692926|gb|ACN16209.1| RibE [Desulfobacterium autotrophicum HRM2]
          Length = 222

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 79/201 (39%), Positives = 113/201 (56%), Gaps = 5/201 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+   G +  + P  +G RL + T  +    K+G SIA  G CLTVV LS     +
Sbjct: 1   MFTGIIEGAGTLKKIQPNGEGKRLAIQTGMDLEGTKIGDSIAVNGACLTVVSLS-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + +EV++  ET   T   S   G  +NLER+++L DRLDGHLVSGHID T  ++      
Sbjct: 56  SVFEVDMAPETVSRTTFKSLLPGARLNLERALRLSDRLDGHLVSGHIDATGSVVSKTVKS 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   + +P  L   I  KGSV ++G+SLT+N      FDV +I HT + TT    +VG
Sbjct: 116 NAVIVTIGIPETLGDEIIEKGSVAIDGISLTINRCSHKDFDVSVIPHTAKITTIGTARVG 175

Query: 181 DLINIEVDSMMRYIARLYALN 201
           D +NIE D + +Y+ R     
Sbjct: 176 DSVNIETDMIGKYVNRFLKQK 196


>gi|153931182|ref|YP_001385130.1| riboflavin synthase subunit alpha [Clostridium botulinum A str.
           ATCC 19397]
 gi|153934504|ref|YP_001388599.1| riboflavin synthase subunit alpha [Clostridium botulinum A str.
           Hall]
 gi|152927226|gb|ABS32726.1| riboflavin synthase, alpha subunit [Clostridium botulinum A str.
           ATCC 19397]
 gi|152930418|gb|ABS35917.1| riboflavin synthase, alpha subunit [Clostridium botulinum A str.
           Hall]
          Length = 228

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 112/203 (55%), Gaps = 5/203 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++G+I+ +      + + +  S   + + LG S+A  G+CLTV   +      N
Sbjct: 14  FTGIVEEVGRILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFNS-----N 68

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G 
Sbjct: 69  SFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEGI 128

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +GD
Sbjct: 129 ATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFTVSLIPHTKEETILVNKNIGD 188

Query: 182 LINIEVDSMMRYIARLYALNTSQ 204
           +INIE D + +YI +       +
Sbjct: 189 IINIECDVLGKYIYKFMHFKKEE 211


>gi|291279487|ref|YP_003496322.1| riboflavin synthase subunit alpha [Deferribacter desulfuricans
           SSM1]
 gi|290754189|dbj|BAI80566.1| riboflavin synthase, alpha subunit [Deferribacter desulfuricans
           SSM1]
          Length = 216

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/203 (35%), Positives = 113/203 (55%), Gaps = 6/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV + GK++     +   ++++       K ++G SIA  G+CLTVV L E     
Sbjct: 1   MFTGIVEETGKVVFFQKKSDFAKIKIKCDTVLEKTQVGDSIAVNGVCLTVVDLDE----- 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  ++  E+   +       G  +NLER++ L  RL GHLV GH+DG  +I+ +    
Sbjct: 56  NSFSADISYESIERSTFKYCTTGWAVNLERALTLEKRLGGHLVQGHVDGIGKIVKIMEYK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTV-NLVGKNFFDVLLIRHTIEETTWKMHKV 179
           D+   ++  P  L+++IAVKGS+ ++G+SLTV + +  N  +V +I HT   T  K  K 
Sbjct: 116 DAYKLQILYPSELDKYIAVKGSITIDGISLTVASEIAANTIEVAVIPHTFMVTNLKDKKS 175

Query: 180 GDLINIEVDSMMRYIARLYALNT 202
           GD +NIEVD + RY+ +L     
Sbjct: 176 GDYVNIEVDVIARYLEKLLKKEK 198


>gi|222478638|ref|YP_002564875.1| riboflavin synthase, alpha subunit [Halorubrum lacusprofundi ATCC
           49239]
 gi|222451540|gb|ACM55805.1| riboflavin synthase, alpha subunit [Halorubrum lacusprofundi ATCC
           49239]
          Length = 203

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/201 (35%), Positives = 108/201 (53%), Gaps = 4/201 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLS---EEH 57
           MFTGIV D G +   T    G+RLR+        +  G SI+ +G+CLTV       +  
Sbjct: 1   MFTGIVEDTGTVRDRTETEDGLRLRIAVD-GFDDLHHGQSISVSGVCLTVEEYDTGTDNA 59

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D+W+EV + +ET   T +   G G  +N+ER++    R DGH+V GH+D   E+  ++
Sbjct: 60  DGDDWFEVFLASETVAKTYLGEIGAGDAVNVERAMPADGRFDGHVVQGHVDTVAEVTAIE 119

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +G+      S+P     ++  KGSV L+G+SLTV     + FDV +I  T E TT    
Sbjct: 120 RVGEDWRFTFSIPEGHGDYLVDKGSVTLDGISLTVAEKRTDEFDVAIIPTTYELTTLSEK 179

Query: 178 KVGDLINIEVDSMMRYIARLY 198
            VGD I++EVD + +Y+  + 
Sbjct: 180 SVGDPIHLEVDVIAKYVENMV 200


>gi|312143491|ref|YP_003994937.1| riboflavin synthase, alpha subunit [Halanaerobium sp.
           'sapolanicus']
 gi|311904142|gb|ADQ14583.1| riboflavin synthase, alpha subunit [Halanaerobium sp.
           'sapolanicus']
          Length = 216

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 105/204 (51%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ + G+ I         +L +        +K G SIA  G+CLTVV  S     D
Sbjct: 1   MFTGIIQEKGEFIRRNKGDNKYQLEIAAETVLKNVKTGDSIAVNGVCLTVVDFS-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N++  +V  ET + TN+     G  +NLE++++    + GH V+GHID T EI  +    
Sbjct: 56  NYFRADVMLETLKATNLVQLAGGDKVNLEQALQPNSFIGGHFVTGHIDDTAEIKKVVTEK 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++    + +   +E++I  KGS  +NGVSLTV  +  N   + LI  T  ET      VG
Sbjct: 116 NAKIITMEVTAEVEKYIVKKGSAAINGVSLTVMEIEDNLLTISLIPETWSETNLADLSVG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D +NIE D + +YI ++     S+
Sbjct: 176 DKVNIETDMLGKYIYKMLNREQSK 199


>gi|261253737|ref|ZP_05946310.1| riboflavin synthase alpha chain [Vibrio orientalis CIP 102891]
 gi|260937128|gb|EEX93117.1| riboflavin synthase alpha chain [Vibrio orientalis CIP 102891]
          Length = 217

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 76/205 (37%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +G + A+T   + + + V     + S +KLG SIA  G+CLTVV  S     
Sbjct: 1   MFTGIVEAVGTLTAITQKGEDISVTVEVGKLDMSDVKLGDSIATNGVCLTVVDFSSTS-- 58

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              Y  ++  ET + T    +  G  +NLE+++    R  GH+VSGH+DG  EI+  + +
Sbjct: 59  ---YTADLSIETLQKTGFTDYQAGDKVNLEKAMLPTTRFGGHIVSGHVDGVGEIVERNMV 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           G ++   +S+P  + +++A KGS+ ++G+SLTVN + KN F + ++ HT EETT     V
Sbjct: 116 GRAIEFWVSMPEEIAKYVAEKGSITVDGISLTVNDLRKNAFKLTIVPHTGEETTIADFHV 175

Query: 180 GDLINIEVDSMMRYIARLYALNTSQ 204
           G  +N+EVD + RY+ RL      Q
Sbjct: 176 GRKVNLEVDVLARYMERLLTSQREQ 200


>gi|310697235|gb|ADP06547.1| RibC [Bartonella sp. E2-114]
          Length = 187

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 97/187 (51%), Positives = 131/187 (70%)

Query: 10  GKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWA 69
           G +  + P+ KG+RL + T Y+   +++G SIA +GICLTVV L+ ++SV+NW+ VE W 
Sbjct: 1   GCVEDIEPLQKGVRLNISTHYDMDSLEIGTSIACSGICLTVVGLAPQNSVNNWFAVEAWE 60

Query: 70  ETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSL 129
           ET R+TN+A W  GTF+NLERS++ G  + GHLVSGHIDG  EI+     GD++   L +
Sbjct: 61  ETLRLTNLAHWKKGTFVNLERSLRFGAEMGGHLVSGHIDGLAEIIDEKSEGDAVRFFLQV 120

Query: 130 PHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDS 189
           P  +  FI  KGSV LNG SLTVN V  + FDVL+IRHT+E TTW   KVGD +N+E+D 
Sbjct: 121 PTRITPFIVNKGSVALNGTSLTVNCVESDVFDVLIIRHTLEVTTWGQAKVGDQVNLEIDQ 180

Query: 190 MMRYIAR 196
           + RY+AR
Sbjct: 181 LARYVAR 187


>gi|320103122|ref|YP_004178713.1| riboflavin synthase subunit alpha [Isosphaera pallida ATCC 43644]
 gi|319750404|gb|ADV62164.1| riboflavin synthase, alpha subunit [Isosphaera pallida ATCC 43644]
          Length = 209

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 70/200 (35%), Positives = 103/200 (51%), Gaps = 6/200 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVM-TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV  +GK+  +     G RL +   +   + + LG S+A  G CLTVV      S 
Sbjct: 1   MFTGIVQALGKVEFVRLEPPGRRLAIRWPNLGNTGLALGESVAVNGCCLTVVE-----SR 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
              + V+   ET   TNI     G  +NLER++ +GDRL GH+V GH+D    +      
Sbjct: 56  GEVFMVQAGPETLNRTNIGRLAAGDVVNLERALSMGDRLGGHIVQGHVDALATLRSRRPE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D  +          + +  KGSV L+GVSLT+  VG   F V+LI HT++ TT     +
Sbjct: 116 NDWDHLVFETQPEWTELMVPKGSVTLDGVSLTLVEVGIVEFSVMLIPHTLQVTTLGRLPI 175

Query: 180 GDLINIEVDSMMRYIARLYA 199
           G  +N+E D + R++ +L+ 
Sbjct: 176 GGQVNLETDILARHVRKLFQ 195


>gi|328473736|gb|EGF44571.1| riboflavin synthase subunit alpha [Vibrio parahaemolyticus 10329]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT-SKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV    K++ +    +     +         +++G S+AH G CLTV  + E    
Sbjct: 1   MFTGIVQGTAKVVQIDKKERFQTHVIELDGALIEGLEIGASVAHNGCCLTVTNIDE---- 56

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N    ++   T  +TN+     G+ +N+ER+ K G+ + GH +SGHI     I+ +   
Sbjct: 57  -NRVSFDLMQATLALTNLGLLEEGSAVNVERAAKFGNEIGGHSMSGHISLMANIVDVIDT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            ++      LP    +++  KG + ++G SLT+  V  N F V LI  T++ T +   +V
Sbjct: 116 PNNRTIWFELPQESMKYVLAKGYIGIDGCSLTIGEVEANRFSVHLIPETLQRTLFGSRQV 175

Query: 180 GDLINIEVDSMMRY----IARLYALNT 202
           GD +NIE D   +     + R+ A   
Sbjct: 176 GDKVNIEFDPQTQAIVDTVERVLAAKQ 202


>gi|256827879|ref|YP_003156607.1| riboflavin synthase subunit alpha [Desulfomicrobium baculatum DSM
           4028]
 gi|256577055|gb|ACU88191.1| riboflavin synthase, alpha subunit [Desulfomicrobium baculatum DSM
           4028]
          Length = 218

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+  +G++ AM       R  V   +  +   LG SIA  G+CLTV     E    
Sbjct: 1   MFTGIIQGLGRVAAMDRRGSETRFTVRPDFALTDYALGESIAVNGVCLTV-----ETFGA 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
            W+      ET  +TN+ + G+ + +NLER++ +GDRL GH+VSGH+D   E+L +   G
Sbjct: 56  GWFTAYASGETMSVTNLGALGVSSSVNLERALAMGDRLGGHIVSGHVDCLAEVLSIRQAG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
            S   RL  P +    +  KGSV L+G+SLTVN  G+ + +V +I  T  ETT      G
Sbjct: 116 QSRIYRLGFPASYSSQVIPKGSVALDGISLTVNDCGQGYLEVNIIPATQRETTISDWAQG 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             IN+E D + +Y+ R+  
Sbjct: 176 RRINMETDVIGKYVQRMLE 194


>gi|269467888|gb|EEZ79627.1| riboflavin synthase alpha chain [uncultured SUP05 cluster
           bacterium]
          Length = 197

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/202 (36%), Positives = 119/202 (58%), Gaps = 6/202 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGI+  IG+I       KG   R  +   + S + +G SIA  G+CLT V +      
Sbjct: 1   MFTGIIQAIGQIKTKDVHNKGAVFRFESKDLDFSNVAIGDSIAVNGVCLTAVEIG----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            ++++ ++  ET   +  ++  +G  +NLE++++L   +DGHLVSGH+DG  +++     
Sbjct: 56  GDYFQADLSQETLDCSVFSNLEVGDSVNLEKALRLSQGIDGHLVSGHVDGVAKVIDKYSE 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
           GDS   ++S P NL ++IA KGSVC+NGVSLTVN +    FD+ ++ HT+  TT     V
Sbjct: 116 GDSTRFKISTPKNLVKYIARKGSVCINGVSLTVNDISDEMFDINIVPHTLIATTLGELVV 175

Query: 180 GDLINIEVDSMMRYIARLYALN 201
           G  +N+EVD + R++ +L   +
Sbjct: 176 GSKVNLEVDIIARHLEQLLNKD 197


>gi|78186606|ref|YP_374649.1| riboflavin synthase subunit alpha [Chlorobium luteolum DSM 273]
 gi|78166508|gb|ABB23606.1| Lumazine-binding protein [Chlorobium luteolum DSM 273]
          Length = 217

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/206 (33%), Positives = 108/206 (52%), Gaps = 7/206 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS--YNTSKMKLGCSIAHAGICLTVVRLSEEHS 58
           MFTGI+ D+G++  ++    G+RLRV  S   +   + +  S++  G C TVVR+     
Sbjct: 1   MFTGIIKDVGRVQGLSRQKGGLRLRVRHSGAESLEGLSVDESVSINGACQTVVRVE---- 56

Query: 59  VDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDF 118
             + +EV+   ET + T++     G+ +NLER+++  DRL GH V GH+D T  +  +  
Sbjct: 57  -AHSFEVDTVEETLKKTSLGDLHEGSLVNLERALRPIDRLGGHFVLGHVDCTAPVSSVRD 115

Query: 119 IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
           +G S    ++ P      I   GS+ ++GVSLTV  +    F V LI +T   TT     
Sbjct: 116 LGSSREISVTFPEAFSPLIVSAGSITIDGVSLTVARLDGLRFTVALIPYTFAHTTLNALV 175

Query: 179 VGDLINIEVDSMMRYIARLYALNTSQ 204
            G  +N+E D + +Y+AR      SQ
Sbjct: 176 AGSRVNLEFDILGKYVARQTGSGVSQ 201


>gi|116623315|ref|YP_825471.1| riboflavin synthase subunit alpha [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116226477|gb|ABJ85186.1| riboflavin synthase, alpha subunit [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 213

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/196 (33%), Positives = 109/196 (55%), Gaps = 6/196 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ ++G I A+   A G RL +  S   S    G SIA  G+CLT V L       
Sbjct: 1   MFTGIIEELGAIEAVQTRAAGARLTIRCSAVLSDAVEGASIAVNGVCLTAVDLRPAS--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI- 119
             +  ++  ET + +N+     G+ +NLER +    RL+GH+V GH+DGT E L L+ + 
Sbjct: 58  --FSADLAPETLQRSNLGDLRAGSRVNLERPLSPTGRLNGHIVQGHVDGTGEFLSLEALG 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            D+ + R+ +P  L+ ++  KGS+ ++G+SLT+  +  +   V +I HT   TT   ++ 
Sbjct: 116 DDNWWLRIRVPAELDPYLVFKGSIAIDGISLTIASLESDVLAVTIIPHTFRGTTLGSYRP 175

Query: 180 GDLINIEVDSMMRYIA 195
           G  +N+E D + +++ 
Sbjct: 176 GARVNLECDVLAKHVE 191


>gi|238019275|ref|ZP_04599701.1| hypothetical protein VEIDISOL_01139 [Veillonella dispar ATCC 17748]
 gi|237863974|gb|EEP65264.1| hypothetical protein VEIDISOL_01139 [Veillonella dispar ATCC 17748]
          Length = 218

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 58/203 (28%), Positives = 108/203 (53%), Gaps = 5/203 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG++ ++    K + + +  +   S +K+G S+A  G+CLT   +      +
Sbjct: 1   MFTGIVEEIGRVESIKKGPKSLAITIRGNKIFSDLKIGDSVAVNGVCLTATTIG-----N 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  E+ ++T   +  +   +NLER++    R  GH+V+GH+DGT  I+  +   
Sbjct: 56  GVFTADVMPESIKMTTFTNLKVHQPVNLERAMLANGRFGGHIVAGHVDGTGRIINREQTD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++   +  P ++  ++  KGS+ ++G+SLT+     + F V +I HT+ ET      +G
Sbjct: 116 NAIIFTVEAPKSVMDYVIYKGSITIDGISLTIMRRTDSSFSVSIIPHTLGETILGSAHIG 175

Query: 181 DLINIEVDSMMRYIARLYALNTS 203
             +N+E D   RYI     L + 
Sbjct: 176 TEVNLETDIAGRYIRHFMNLGSE 198


>gi|258592178|emb|CBE68487.1| riboflavin synthase alpha chain [NC10 bacterium 'Dutch sediment']
          Length = 216

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 64/199 (32%), Positives = 101/199 (50%), Gaps = 5/199 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG++ +IG++  +      ++L +     TS + +G SIA  G CLTV R     +  
Sbjct: 1   MFTGLIEEIGRVQQVRREGGIVKLAIKGQQTTSSLAIGGSIAVDGTCLTVTR-----TAP 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +E ++  ET   T +    +G  +NLER  +  DRL GH VSGHIDG   I  +    
Sbjct: 56  TLFEADLSEETMARTTLGERQVGNPVNLERPCRPTDRLGGHFVSGHIDGVGTIREIRETE 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
              +  ++ P  L   +  KGSV ++G+SLTV  +    F + +I HT   TT +  +V 
Sbjct: 116 GMWWFFIAYPKALRPLLVEKGSVAVDGISLTVGSLSDRSFGIAIIPHTYHHTTLESKQVE 175

Query: 181 DLINIEVDSMMRYIARLYA 199
             +N+E D + +Y+ R   
Sbjct: 176 QRVNLETDLLGKYVVRYLQ 194


>gi|238026456|ref|YP_002910687.1| riboflavin synthase subunit alpha [Burkholderia glumae BGR1]
 gi|237875650|gb|ACR27983.1| Riboflavin synthase, alpha subunit [Burkholderia glumae BGR1]
          Length = 211

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/211 (34%), Positives = 113/211 (53%), Gaps = 16/211 (7%)

Query: 1   MFTGIVTDIGKIIAMTPIAKG----MRLRVMTS-YNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +G+I  + P+  G    +RL V     +   + LG SIA  G C+T +  + 
Sbjct: 1   MFTGIVAAVGRIETIAPLGNGADAGVRLVVHAGGLDLDDVALGDSIAIQGACMTAIEKTA 60

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
           +      + V+V  E+   T          +NLE++++  DRL GH+VSGH+DG   +  
Sbjct: 61  Q-----TFTVDVSRESLNRTVG--LTEPGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTH 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV----GKNFFDVLLIRHTIEE 171
              +G+S   R+  P  L +++A KGS+ +NGVSLTVN V        F + LI HT++ 
Sbjct: 114 FAPVGESHELRVLAPKALGKYLAHKGSITVNGVSLTVNAVADREDGCEFSINLIPHTVQM 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYALNT 202
           TT +  K G  +N+E+D + RY+ R+   + 
Sbjct: 174 TTLRHLKPGVKVNLEIDMIARYVERMLGASR 204


>gi|110667358|ref|YP_657169.1| riboflavin synthase subunit alpha [Haloquadratum walsbyi DSM 16790]
 gi|109625105|emb|CAJ51524.1| riboflavin synthase alpha chain [Haloquadratum walsbyi DSM 16790]
          Length = 209

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/202 (36%), Positives = 111/202 (54%), Gaps = 3/202 (1%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTS--YNTSKMKLGCSIAHAGICLTV-VRLSEEH 57
           MFTGI+   G I A T    G RLR+      N  +++ G SIA +G CLTV    +   
Sbjct: 1   MFTGIIEGTGVITAATADEGGRRLRIEPPAAINAKQLEHGQSIAVSGACLTVESSEARTT 60

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             + ++EV + AET   T +    +G  +N+ER++   DR DGHLV GH+D T +I  +D
Sbjct: 61  DTNGYFEVFLAAETIDKTYLGEINVGDRVNIERALAADDRFDGHLVQGHVDMTAQITSID 120

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            IGD       LP ++  ++  KGS+ ++G+SLTV       F V +I  T E TT    
Sbjct: 121 RIGDDWTFGFDLPTSIAPYVVQKGSITVDGISLTVAERNSTEFSVAIIPTTYEVTTLSEK 180

Query: 178 KVGDLINIEVDSMMRYIARLYA 199
            VGD +++EVD + +Y+ +L +
Sbjct: 181 AVGDPVHLEVDVVAKYVEQLTS 202


>gi|299538632|ref|ZP_07051915.1| riboflavin synthase alpha chain [Lysinibacillus fusiformis ZC1]
 gi|298726219|gb|EFI66811.1| riboflavin synthase alpha chain [Lysinibacillus fusiformis ZC1]
          Length = 212

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 70/194 (36%), Positives = 110/194 (56%), Gaps = 5/194 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V DIG I A+      M++ + ++  T  +KLG SIA  G+CLTV   +++    
Sbjct: 1   MFTGLVEDIGIIKAVQSDRNSMKITIQSAKITEDVKLGDSIAVNGVCLTVTHFTQQQ--- 57

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
               ++V  ET + TN+    IG  +NLER++    R  GH V+GH+DG  +IL    + 
Sbjct: 58  --LTMDVMPETVKATNLQQLAIGDSVNLERAMPANGRFGGHFVAGHVDGVGKILRKRPVA 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           +++Y  + +   L  F   KGS+ ++G SLT+  V  N   + LI HT +ET   + +VG
Sbjct: 116 NAVYIDIEMSEELTNFCIPKGSITIDGTSLTLFHVEANSVTISLIPHTYKETVLGLKRVG 175

Query: 181 DLINIEVDSMMRYI 194
            ++NIE D + +YI
Sbjct: 176 AIVNIETDLVGKYI 189


>gi|148655123|ref|YP_001275328.1| riboflavin synthase subunit alpha [Roseiflexus sp. RS-1]
 gi|148567233|gb|ABQ89378.1| riboflavin synthase, alpha subunit [Roseiflexus sp. RS-1]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/198 (35%), Positives = 107/198 (54%), Gaps = 5/198 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV +IG +  +  +A G  L V  +      +LG S+A  G CLTV  L+     D
Sbjct: 1   MFTGIVEEIGTVETLAEVAGGWSLTVQATTVLEHTRLGDSLAINGACLTVTNLT-----D 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           + + V +  ET R TN+     G  +NLERS+ L  RL GH V GHIDGT  +      G
Sbjct: 56  HSFTVGLSPETLRRTNLGDLKPGDGVNLERSLALNGRLGGHFVQGHIDGTGVVRAFHPEG 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS++  ++ P  L ++I  KG + ++G SLTV  V  + F  +L+ +T +  T     +G
Sbjct: 116 DSLWVAVAAPAALLRYIVPKGYIAVDGTSLTVVDVLDDAFTFMLVAYTQQHITLPRKSIG 175

Query: 181 DLINIEVDSMMRYIARLY 198
             +N+EVD + +Y+ +  
Sbjct: 176 SRVNLEVDMLSKYVEKFM 193


>gi|329903443|ref|ZP_08273465.1| Riboflavin synthase alpha chain [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327548370|gb|EGF33052.1| Riboflavin synthase alpha chain [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 210

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 114/208 (54%), Gaps = 16/208 (7%)

Query: 1   MFTGIVTDIGKIIAM----TPIAKGMRLRVMT-SYNTSKMKLGCSIAHAGICLTVVRLSE 55
           MFTGIV  +GKI  +    T    G+RL +     + S + LG SIA  G C+TVV  + 
Sbjct: 1   MFTGIVAAVGKITDLSAAGTEPGAGVRLTIDAGDLSLSDVVLGDSIAINGACMTVVSKT- 59

Query: 56  EHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILF 115
               D  + V+V  E+   T  A       +NLE+++ L DRL GHLVSGH+DG   +  
Sbjct: 60  ----DTTFAVDVSRESLNCT--AGLDAAGEVNLEKALTLADRLGGHLVSGHVDGLGLVTR 113

Query: 116 LDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGK----NFFDVLLIRHTIEE 171
            + +G+S    +  P +L +++A KGS+ +NGVSLTVN V        F + LI HT+  
Sbjct: 114 YEPVGESWELVIEAPADLAKYLAFKGSIVVNGVSLTVNRVTDTPTACAFSINLIPHTVAV 173

Query: 172 TTWKMHKVGDLINIEVDSMMRYIARLYA 199
           TT +    G  +N+E+D + RY+ R+ +
Sbjct: 174 TTLRNLTAGSRVNLEIDLIARYVERMLS 201


>gi|254562341|ref|YP_003069436.1| riboflavin synthase subunit alpha [Methylobacterium extorquens DM4]
 gi|254269619|emb|CAX25590.1| riboflavin synthase, alpha subunit [Methylobacterium extorquens
           DM4]
          Length = 212

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 86/208 (41%), Positives = 122/208 (58%), Gaps = 8/208 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTG+V+D+G+++++    +  R+ + ++Y+ + + LG SIA +G CLT V + E H   
Sbjct: 1   MFTGLVSDVGRVVSVEGSERLRRIVIESAYDPAGIALGASIACSGPCLTAVAV-EPHGAG 59

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHID-------GTVEI 113
             + V+  AET   T + +W  GT +NLERS+KLGD L GHLV+GH+D            
Sbjct: 60  CRFSVDAAAETLARTTVGAWREGTRLNLERSLKLGDELGGHLVTGHVDGVAEILARETVT 119

Query: 114 LFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETT 173
              +  G S    L  P  L   IA KGS+CL+G SLTVN V  + F VLLI H++  TT
Sbjct: 120 GEDNPWGASERFTLRAPAALAGLIAEKGSICLDGTSLTVNAVSGHDFSVLLIPHSLSVTT 179

Query: 174 WKMHKVGDLINIEVDSMMRYIARLYALN 201
           W+  + GD IN+EVD + RY ARL    
Sbjct: 180 WEDRREGDRINLEVDLLARYAARLAETR 207


>gi|238921880|ref|YP_002935394.1| riboflavin synthase alpha chain [Eubacterium eligens ATCC 27750]
 gi|238873552|gb|ACR73260.1| riboflavin synthase alpha chain [Eubacterium eligens ATCC 27750]
          Length = 214

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 63/204 (30%), Positives = 105/204 (51%), Gaps = 5/204 (2%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGI+ +IG +  +        L +          +G SIA  G+CLTV  +      D
Sbjct: 1   MFTGIIEEIGHVNNVKKGTASAILTIQAEKVLKGTHIGDSIAVNGVCLTVTGI-----YD 55

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           N +  +V  ET   +++     G+ +NLER++    R  GH+VSGHIDGT ++  +    
Sbjct: 56  NTFTADVMHETLNRSSLGKLVSGSAVNLERAMAADGRFGGHIVSGHIDGTGKVAAITRDD 115

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           ++++ ++     + ++I  KGSV ++G+SLTV       F V +I HT   TT  + K G
Sbjct: 116 NAIWYQIKTDIGILKYIVEKGSVAIDGISLTVAKTDSQSFSVSIIPHTAGATTLSLRKAG 175

Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204
           D++N+E D + +YI +       +
Sbjct: 176 DVVNLENDIVGKYIEKFITFEKEK 199


>gi|254822408|ref|ZP_05227409.1| riboflavin synthase subunit alpha [Mycobacterium intracellulare
           ATCC 13950]
          Length = 199

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/202 (33%), Positives = 114/202 (56%), Gaps = 7/202 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIV ++G++     ++   RL +  +  T+    G SIA  G+CLTV  L       
Sbjct: 1   MFTGIVEELGEVTGRDVLSDAARLTIRGAVVTADAGHGDSIAVNGVCLTVAEL----LPG 56

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
             +  +V  ET   +N+ +  +G+ +NLER+  +  RL GH+V GH+DGT +I+      
Sbjct: 57  GLFTADVMGETLDRSNLGALQVGSRVNLERAAAVNSRLGGHIVQGHVDGTGQIVARSPSE 116

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVG---KNFFDVLLIRHTIEETTWKMH 177
                R+ +P  + +++  KGS+ ++G+SLTV+ +G   +++F+V LI  T E TT    
Sbjct: 117 HWEVVRIEIPAEVARYVVEKGSITVDGISLTVSGLGSDPRDWFEVSLIPTTRELTTLGQA 176

Query: 178 KVGDLINIEVDSMMRYIARLYA 199
            +G  +N+EVD + +Y+ RL +
Sbjct: 177 PIGTQVNLEVDVIAKYVERLMS 198


>gi|323144124|ref|ZP_08078763.1| riboflavin synthase, alpha subunit [Succinatimonas hippei YIT
           12066]
 gi|322416101|gb|EFY06796.1| riboflavin synthase, alpha subunit [Succinatimonas hippei YIT
           12066]
          Length = 223

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/207 (32%), Positives = 113/207 (54%), Gaps = 8/207 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT---SKMKLGCSIAHAGICLTVVRLSEEH 57
           M+TGI+  +G +  +     G  ++VMT  +     ++K+G S+A  G+CLT   +    
Sbjct: 1   MYTGIIEAVGTLSLIEKRGNGAFVKVMTPASFKAKERVKIGDSVASNGVCLTATTVG--- 57

Query: 58  SVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLD 117
             D+++  +V AET  +T    +  G  +NLE        L GH+V GH+DG  EI  + 
Sbjct: 58  --DDFFTADVSAETVAMTCFKFYKQGQRLNLELPCTPATHLGGHIVQGHVDGIGEIKDIS 115

Query: 118 FIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMH 177
            +G+++   +S P  L ++IA+KGS+ ++G SLTVN V  + F + LI H+     ++  
Sbjct: 116 PLGEAVNIWVSNPPELSRYIALKGSIAVDGASLTVNSVTDDSFRLTLIPHSQTVLAFENW 175

Query: 178 KVGDLINIEVDSMMRYIARLYALNTSQ 204
           + G  +N+EVD + RY+ RL     SQ
Sbjct: 176 QTGSKVNLEVDVLARYLERLVLGQKSQ 202


>gi|168179300|ref|ZP_02613964.1| riboflavin synthase, alpha subunit [Clostridium botulinum NCTC
           2916]
 gi|182669633|gb|EDT81609.1| riboflavin synthase, alpha subunit [Clostridium botulinum NCTC
           2916]
          Length = 228

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 73/203 (35%), Positives = 112/203 (55%), Gaps = 5/203 (2%)

Query: 2   FTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDN 61
           FTGIV ++GKI+ +      + + +  S   + + LG S+A  G+CLTV   +      N
Sbjct: 14  FTGIVEEVGKILKIEEGKDFLHITIEGSKVLNPLNLGESVAVNGVCLTVTSFNS-----N 68

Query: 62  WYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGD 121
            +  +V  ET   +++ +   G+ +NLER+V L   L GH+VSGHIDGT EI+ +   G 
Sbjct: 69  SFTADVMTETLNKSSLGTLSKGSLVNLERAVTLNKPLGGHIVSGHIDGTGEIINMKKEGI 128

Query: 122 SMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGD 181
           +    +    NL +++  KGSV L+GVSLT+  + +  F V LI HT EET      +GD
Sbjct: 129 ATLLEIKAKENLLKYMIPKGSVALDGVSLTLVDIKEKSFAVSLIPHTKEETILINKNIGD 188

Query: 182 LINIEVDSMMRYIARLYALNTSQ 204
           +INIE D + +YI +       +
Sbjct: 189 IINIECDVLGKYIYKFMHFKKEE 211


>gi|28898254|ref|NP_797859.1| riboflavin synthase subunit alpha [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260361714|ref|ZP_05774741.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus K5030]
 gi|260878593|ref|ZP_05890948.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260898946|ref|ZP_05907387.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260903540|ref|ZP_05911935.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ4037]
 gi|28806471|dbj|BAC59743.1| riboflavin synthase, alpha chain [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308087953|gb|EFO37648.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308091213|gb|EFO40908.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308110624|gb|EFO48164.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus AQ4037]
 gi|308113630|gb|EFO51170.1| riboflavin synthase, alpha subunit [Vibrio parahaemolyticus K5030]
          Length = 203

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 59/207 (28%), Positives = 98/207 (47%), Gaps = 10/207 (4%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNT-SKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV    K++ +    +     +         +++G S+AH G CLTV  +      
Sbjct: 1   MFTGIVQGTAKVVQIDKKERFQTHVIELDGALIEGLEIGASVAHNGCCLTVTNID----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N    ++   T  +TN+     G+ +N+ER+ K GD + GH +SGHI     I+ +   
Sbjct: 56  GNRVSFDLMQATLALTNLGLIEEGSAVNVERAAKFGDEIGGHSMSGHISLMANIVDVIDT 115

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
            ++      LP    +++  KG + ++G SLT+  V  N F V LI  T++ T +   +V
Sbjct: 116 PNNRTIWFELPQESMKYVLAKGYIGIDGCSLTIGEVEANRFSVHLIPETLQRTLFGSRQV 175

Query: 180 GDLINIEVDSMMRY----IARLYALNT 202
           GD +NIE D   +     + R+ A   
Sbjct: 176 GDKVNIEFDPQTQAIVDTVERVLAAKQ 202


>gi|294628306|ref|ZP_06706866.1| riboflavin synthase, alpha subunit [Streptomyces sp. e14]
 gi|292831639|gb|EFF89988.1| riboflavin synthase, alpha subunit [Strep