RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit
alpha [Candidatus Liberibacter asiaticus str. psy62]
         (204 letters)



>3a35_A Lumazine protein, LUMP; luminous bacteria, homologue of
           riboflavin synthase, luminescent protein; HET: RBF;
           1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A*
           (A:95-190)
          Length = 96

 Score = 92.1 bits (229), Expect = 5e-20
 Identities = 15/93 (16%), Positives = 40/93 (43%)

Query: 102 LVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD 161
            ++G+I G   +  +    D +   + +P +L + I  +  + +NGVS ++  +  +   
Sbjct: 3   ALTGNIKGVATVDNITEEEDRLKVYIKIPKDLIENILSEDHIGINGVSHSIEEISDDIIF 62

Query: 162 VLLIRHTIEETTWKMHKVGDLINIEVDSMMRYI 194
           +   ++    T     + G  +N+E  ++    
Sbjct: 63  INYPKNLSITTNLGTLEKGSDVNVETLNVSNEW 95



 Score = 85.9 bits (213), Expect = 4e-18
 Identities = 12/97 (12%), Positives = 36/97 (37%), Gaps = 6/97 (6%)

Query: 1  MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSK-MKLGCSIAHAGICLTVVRLSEEHSV 59
            TG +  +  +  +T     +++ +    +  + +     I   G+  ++  +S     
Sbjct: 3  ALTGNIKGVATVDNITEEEDRLKVYIKIPKDLIENILSEDHIGINGVSHSIEEIS----- 57

Query: 60 DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGD 96
          D+   +      +  TN+ +   G+ +N+E      +
Sbjct: 58 DDIIFINYPKNLSITTNLGTLEKGSDVNVETLNVSNE 94


>3a35_A Lumazine protein, LUMP; luminous bacteria, homologue of
          riboflavin synthase, luminescent protein; HET: RBF;
          1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A*
          (A:1-94)
          Length = 94

 Score = 88.3 bits (219), Expect = 7e-19
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 7/99 (7%)

Query: 1  MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEHSV 59
          MF GIV   G I  ++      R  +    +    ++ G  +   G  LTVVR+S     
Sbjct: 1  MFKGIVQGAGIIKKISKNDDTQRHGITFPKDILESVEKGTVMLVNGCSLTVVRIS----- 55

Query: 60 DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRL 98
           +    ++  +    T      +G  +NLE   + G  L
Sbjct: 56 GDVVYFDI-DQAINTTTFRELEVGNKVNLEVRPEFGSLL 93



 Score = 77.5 bits (191), Expect = 1e-15
 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 3/95 (3%)

Query: 103 VSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDV 162
             G + G   I  +    D+    ++ P ++ + +     + +NG SLTV  +  +    
Sbjct: 2   FKGIVQGAGIIKKISKNDDTQRHGITFPKDILESVEKGTVMLVNGCSLTVVRISGDVVYF 61

Query: 163 LLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
             I   I  TT++  +VG+ +N+EV     + + L
Sbjct: 62  -DIDQAINTTTFRELEVGNKVNLEVR--PEFGSLL 93


>3ddy_A Lumazine protein, LUMP; luminescent bacteria, riboflavin
           synthase, luminescence, luminescent protein; HET: RBF;
           2.50A {Photobacterium leiognathi} (A:95-186)
          Length = 92

 Score = 86.7 bits (215), Expect = 2e-18
 Identities = 15/92 (16%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query: 102 LVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD 161
            ++G+I GT  +  ++         + +P  L + + VK  + ++G+SL +  +  +   
Sbjct: 3   GLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIIT 62

Query: 162 VLLIRHTIEETTWKMHKVGDLINIEVDSMMRY 193
           +   R  +  T          +N+E+  +  +
Sbjct: 63  LNYSRDLLASTNIASLAKDVKVNVEI--LNEW 92



 Score = 84.4 bits (209), Expect = 9e-18
 Identities = 17/94 (18%), Positives = 34/94 (36%), Gaps = 6/94 (6%)

Query: 1  MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSK-MKLGCSIAHAGICLTVVRLSEEHSV 59
            TG +     + A+     G  + +      ++ + +   I   GI L +  +S     
Sbjct: 3  GLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMS----- 57

Query: 60 DNWYEVEVWAETNRITNIASWGIGTFINLERSVK 93
          D+   +    +    TNIAS      +N+E   +
Sbjct: 58 DSIITLNYSRDLLASTNIASLAKDVKVNVEILNE 91


>3ddy_A Lumazine protein, LUMP; luminescent bacteria, riboflavin
          synthase, luminescence, luminescent protein; HET: RBF;
          2.50A {Photobacterium leiognathi} (A:1-94)
          Length = 94

 Score = 86.4 bits (214), Expect = 3e-18
 Identities = 20/99 (20%), Positives = 35/99 (35%), Gaps = 7/99 (7%)

Query: 1  MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEHSV 59
          MF GIV   G I +++      R  +         + +   +   G   TVVR+      
Sbjct: 1  MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRIL----- 55

Query: 60 DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRL 98
           +    ++  +    T       G  +NLE   K G+ +
Sbjct: 56 GDMVYFDI-DQALGTTTFDGLKEGDQVNLEIHPKFGEVV 93



 Score = 77.2 bits (190), Expect = 1e-15
 Identities = 21/95 (22%), Positives = 39/95 (41%), Gaps = 3/95 (3%)

Query: 103 VSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDV 162
             G + G   I  +    DS    ++ P  + Q + V   + +NG S TV  +  +    
Sbjct: 2   FRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILGDMVYF 61

Query: 163 LLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
             I   +  TT+   K GD +N+E+    ++   +
Sbjct: 62  -DIDQALGTTTFDGLKEGDQVNLEIH--PKFGEVV 93


>1kzl_A Riboflavin synthase; biosynthesis of riboflavin, ligand
          binding, transferase; HET: CRM; 2.10A
          {Schizosaccharomyces pombe} (A:6-92)
          Length = 87

 Score = 76.3 bits (188), Expect = 3e-15
 Identities = 24/90 (26%), Positives = 36/90 (40%), Gaps = 6/90 (6%)

Query: 6  VTDIGKIIAMTPIAK-GMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYE 64
          V  IG +  +      G  +++           G SIA  G CLTV            + 
Sbjct: 1  VEAIGVVKDVQGTIDNGFAMKIEAPQILDDCHTGDSIAVNGTCLTVTDFD-----RYHFT 55

Query: 65 VEVWAETNRITNIASWGIGTFINLERSVKL 94
          V +  E+ R+TN+     G  +NLER+V  
Sbjct: 56 VGIAPESLRLTNLGQCKAGDPVNLERAVLS 85



 Score = 75.2 bits (185), Expect = 6e-15
 Identities = 15/82 (18%), Positives = 30/82 (36%)

Query: 107 IDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIR 166
           ++    +  +    D+ +        +        S+ +NG  LTV    +  F V +  
Sbjct: 1   VEAIGVVKDVQGTIDNGFAMKIEAPQILDDCHTGDSIAVNGTCLTVTDFDRYHFTVGIAP 60

Query: 167 HTIEETTWKMHKVGDLINIEVD 188
            ++  T     K GD +N+E  
Sbjct: 61  ESLRLTNLGQCKAGDPVNLERA 82


>1i8d_A Riboflavin synthase; riboflavin biosynthesis, antimicrobial
           target, structure-based design, transferase; 2.00A
           {Escherichia coli} (A:7-91)
          Length = 85

 Score = 75.9 bits (187), Expect = 4e-15
 Identities = 22/78 (28%), Positives = 37/78 (47%)

Query: 109 GTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHT 168
           GT +++ +D   +     + LP ++   +    SV  NG  LTV  +  N     L++ T
Sbjct: 2   GTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVSFDLMKET 61

Query: 169 IEETTWKMHKVGDLINIE 186
           +  T     KVGD +N+E
Sbjct: 62  LRITNLGDLKVGDWVNVE 79



 Score = 72.1 bits (177), Expect = 6e-14
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 9  IGKIIAMTPIAKGMRLRV-MTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEV 67
            K++++          V +  +    ++ G S+AH G CLTV  ++      N    ++
Sbjct: 3  TAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEIN-----GNHVSFDL 57

Query: 68 WAETNRITNIASWGIGTFINLERSVKL 94
            ET RITN+    +G ++N+ER+ K 
Sbjct: 58 MKETLRITNLGDLKVGDWVNVERAAKF 84


>1i8d_A Riboflavin synthase; riboflavin biosynthesis, antimicrobial
           target, structure-based design, transferase; 2.00A
           {Escherichia coli} (A:1-6,A:92-213)
          Length = 128

 Score = 57.8 bits (139), Expect = 1e-09
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 1/103 (0%)

Query: 96  DRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHN-LEQFIAVKGSVCLNGVSLTVNL 154
           D + GHL+SGHI  T E+  +    ++      +  + L ++I  KG + ++G+SLTV  
Sbjct: 7   DEIGGHLMSGHIMTTAEVAKILTSENNRQIWFKVQDSQLMKYILYKGFIGIDGISLTVGE 66

Query: 155 VGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
           V    F V LI  T+E TT    K+G  +NIE+D   + +   
Sbjct: 67  VTPTRFCVHLIPETLERTTLGKKKLGARVNIEIDPQTQAVVDT 109


>1kzl_A Riboflavin synthase; biosynthesis of riboflavin, ligand
           binding, transferase; HET: CRM; 2.10A
           {Schizosaccharomyces pombe} (A:1-5,A:93-186)
          Length = 99

 Score = 57.8 bits (138), Expect = 1e-09
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 95  GDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPH-NLEQFIAVKGSVCLNGVSLTVN 153
           G R+ GH V GH+D   EI+     G+++          + ++I  KG + L+G SLT+ 
Sbjct: 4   GLRMGGHFVQGHVDTVAEIVEKKQDGEAIDFTFRPRDPFVLKYIVYKGYIALDGTSLTIT 63

Query: 154 LVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDS 189
            V  + F +++I +T  +       VGDL+N+EVD 
Sbjct: 64  HVDDSTFSIMMISYTQSKVIMAKKNVGDLVNVEVDQ 99


>2he7_A BAND 4.1-like protein 3; FERM domain, DAL-1, EPB41L3A,
           structural genomics, structural genomics consortium,
           SGC, cell adhesion; 2.00A {Homo sapiens} PDB: 3bin_A
           1gg3_A 2rq1_A (A:1-85)
          Length = 85

 Score = 27.1 bits (60), Expect = 1.6
 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 4/51 (7%)

Query: 122 SMYCRLSLPHNLEQFIAV----KGSVCLNGVSLTVNLVGKNFFDVLLIRHT 168
           SM C++ L    E    V    +G V  + V   +NL+ K++F +      
Sbjct: 2   SMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAE 52


>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement,
           oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum}
           (A:50-117,A:240-340)
          Length = 169

 Score = 26.3 bits (58), Expect = 3.2
 Identities = 11/57 (19%), Positives = 24/57 (42%), Gaps = 7/57 (12%)

Query: 66  EVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDS 122
           ++ +E N ++ IA +      ++ R+ ++ D L G             + L  IG+ 
Sbjct: 24  KILSEANDMSTIALYNPDENGHIRRTDRIPDTLPGI-------SRYHQVVLHMIGEQ 73


>2ich_A Putative ATTH; NP_841447.1, structural genomics, PSI-2,
           protein structure initiative, joint center for
           structural genomics, JCSG; HET: NHE; 2.00A {Nitrosomonas
           europaea} (A:1-201)
          Length = 201

 Score = 25.2 bits (55), Expect = 7.5
 Identities = 6/26 (23%), Positives = 10/26 (38%), Gaps = 2/26 (7%)

Query: 136 FIAVKGSVCLNGVSLTVNLVGKNFFD 161
            + V G +   G  + V   G  + D
Sbjct: 169 HLQVSGIINRQGEDIPVT--GTAWLD 192


>2fel_A 3-carboxy-CIS,CIS-muconate lactonizing enzyme;
           biodegradation, sulphonic acids, 3-sulphomuconate,
           cycloisomerase; 2.20A {Agrobacterium tumefaciens} PDB:
           2fen_A (A:1-100,A:198-225)
          Length = 128

 Score = 24.8 bits (54), Expect = 8.1
 Identities = 12/65 (18%), Positives = 20/65 (30%), Gaps = 11/65 (16%)

Query: 53  LSEEHSVDNWYEVEV-----WAETNRIT-----NIASWGIGTFINLERSVKLGDRLDGHL 102
            S +  +D     E       AE +         I S       ++   ++ G   DG +
Sbjct: 24  FSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSA-LRHGVAKDGVV 82

Query: 103 VSGHI 107
           V   I
Sbjct: 83  VPELI 87


>1r6v_A Subtilisin-like serine protease; sandwich domain,
           propeptide, hydrolase; 1.70A {Fervidobacterium
           pennivorans} (A:556-671)
          Length = 116

 Score = 25.0 bits (54), Expect = 8.1
 Identities = 9/47 (19%), Positives = 16/47 (34%), Gaps = 2/47 (4%)

Query: 111 VEILFLDF--IGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLV 155
                 D   +   +   +         I ++G+V LNG  + V  V
Sbjct: 36  ARNQTYDLSLLSGQISFGIQTLLPAATDITIQGTVTLNGEDIPVYGV 82


>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein,
          nucleotide-binding, zinc-binding domain, SOS response,
          metal-binding; HET: ADP; 2.30A {Deinococcus
          radiodurans} PDB: 2vf8_A* (A:601-677)
          Length = 77

 Score = 24.7 bits (54), Expect = 9.0
 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%)

Query: 2  FTGIVTDIGKIIAMTPIAKGMRLRV-MTSYNT 32
          +TG+   + K+ A TP+AK         S+N 
Sbjct: 5  YTGLFDQVRKLFAATPLAKKRGYNAGRFSFNV 36


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.324    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0678    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,574,691
Number of extensions: 67792
Number of successful extensions: 277
Number of sequences better than 10.0: 1
Number of HSP's gapped: 262
Number of HSP's successfully gapped: 22
Length of query: 204
Length of database: 4,956,049
Length adjustment: 84
Effective length of query: 120
Effective length of database: 2,116,429
Effective search space: 253971480
Effective search space used: 253971480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 52 (23.9 bits)