RPSBLAST alignment of GI: 254780347 and protein with PDBid: 3ddy

>3ddy_A Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Length = 186
 Score =  188 bits (479), Expect = 7e-49
 Identities = 35/188 (18%), Positives = 73/188 (38%), Gaps = 7/188 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSK-MKLGCSIAHAGICLTVVRLSEEHSV 59
           MF GIV   G I +++      R  +       + + +   +   G   TVVR+      
Sbjct: 1   MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRIL----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +    ++  +    T       G  +NLE   K G+ +    ++G+I GT  +  ++  
Sbjct: 56  GDMVYFDI-DQALGTTTFDGLKEGDQVNLEIHPKFGEVVGRGGLTGNIKGTALVAAIEEN 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                  + +P  L + + VK  + ++G+SL +  +  +   +   R  +  T       
Sbjct: 115 DAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAK 174

Query: 180 GDLINIEV 187
              +N+E+
Sbjct: 175 DVKVNVEI 182