BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] (204 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780347|ref|YP_003064760.1| riboflavin synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 418 bits (1075), Expect = e-119, Method: Compositional matrix adjust. Identities = 204/204 (100%), Positives = 204/204 (100%) Query: 1 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD Sbjct: 1 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60 Query: 61 NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120 NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG Sbjct: 61 NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120 Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG Sbjct: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180 Query: 181 DLINIEVDSMMRYIARLYALNTSQ 204 DLINIEVDSMMRYIARLYALNTSQ Sbjct: 181 DLINIEVDSMMRYIARLYALNTSQ 204 >537021.9.peg.753_1 Length = 1033 Score = 26.2 bits (56), Expect = 0.46, Method: Composition-based stats. Identities = 27/83 (32%), Positives = 36/83 (43%), Gaps = 16/83 (19%) Query: 40 SIAHAGI--CLTVVRLSEEHSVDNWYEVEVWAETNRIT---NIASWGIGTF---INLER- 90 S+ AG C R+ S+DN + W E NR NI + GTF I LE+ Sbjct: 884 SLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKF 943 Query: 91 -----SVKLGD--RLDGHLVSGH 106 SV+ + R+ G SGH Sbjct: 944 SVENSSVRFENEQRVLGFYFSGH 966 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 24.3 bits (51), Expect = 1.5, Method: Composition-based stats. Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 5/27 (18%) Query: 167 HTIEETTWKMHKVGDLIN----IEVDS 189 HTI+E+TW + K+G IN IE DS Sbjct: 85 HTIDESTW-IEKLGLSINYDLPIEYDS 110 >gi|254780628|ref|YP_003065041.1| coproporphyrinogen III oxidase [Candidatus Liberibacter asiaticus str. psy62] Length = 395 Score = 23.9 bits (50), Expect = 2.0, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 6/31 (19%) Query: 164 LIRHTIEETT--WKMHKVGDLI----NIEVD 188 L + TIE+ T +KMHK GDL+ N+ VD Sbjct: 204 LYQLTIEKGTLFYKMHKDGDLVLPSENVAVD 234 >gi|254780810|ref|YP_003065223.1| transcription termination factor Rho [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 23.1 bits (48), Expect = 3.7, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 15 MTPIAKGMRLRVMTSYNTSKMKLGCSIAHA 44 + PI KG R ++ T K L +IAH+ Sbjct: 168 IAPIGKGQRSLIVAPPRTGKTILLQNIAHS 197 >gi|254780503|ref|YP_003064916.1| putative glutamine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.9 bits (45), Expect = 7.4, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 59 VDNWYEVEVWAETNRITNI 77 V NW + W + NRI ++ Sbjct: 14 VKNWEQAAKWLKDNRIEDV 32 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.138 0.416 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 128,058 Number of Sequences: 1233 Number of extensions: 5070 Number of successful extensions: 19 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 6 length of query: 204 length of database: 328,796 effective HSP length: 70 effective length of query: 134 effective length of database: 242,486 effective search space: 32493124 effective search space used: 32493124 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 36 (18.5 bits)