HHSEARCH alignment of GI: 254780348 and SCOP domain: d1seja1

Alignment
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
Probab=98.42  E-value=2.3e-06  Score=60.23  Aligned_cols=158  Identities=15%  Similarity=0.160  Sum_probs=89.1

Q ss_pred             HHHHCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHH------CCCCEEEEHHHHCCCCCCCCCCCCCCCCCCCE--EEEE
Q ss_conf             110102787720211365322221013566676420------14403663122013454235443444434421--5764
Q gi|254780348|r  153 TLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRA------QSDAILVGIGTVLADDPELTCRLNGLQEHSPM--RIIL  224 (364)
Q Consensus       153 ~lK~A~SlDGkIa~~~g~s~wIT~~~sr~~vh~lRa------~~DaIlvG~~Tv~~DnP~Lt~R~~~~~~~~P~--riVl  224 (364)
                      ++-.|++.+|-|+. +|+--| .-++..++..++-.      .-++|++|.+|...    |-.|      .-|-  -||+
T Consensus         6 ~~vaa~~~~~~IG~-~~~lPW-~~~~Dl~~Fk~~T~~~~~~~~~~~vIMGrkT~es----l~~~------pl~~r~~iVl   73 (178)
T d1seja1           6 IVVAASVLSSGIGI-NGQLPW-SISEDLKFFSKITNNKCDSNKKNALIMGRKTWDS----IGRR------PLKNRIIVVI   73 (178)
T ss_dssp             EEEEEETTTCEEEB-TTBCSS-CCHHHHHHHHHHHHCCSCTTSEEEEEEEHHHHHH----TTSC------CCTTEEEEEE
T ss_pred             EEEEEECCCCCEEC-CCCCCC-CCHHHHHHHHHHHCCCCCCCCCCEEEEEECCHHC----CCCC------CCCCCEEEEE
T ss_conf             99999748981957-997474-2789999999985799876773079994131011----2531------3577349998


Q ss_pred             CCCCCCCHHHHHCCCCCCCEEEEECCCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHHHHHC-CCCEEEECCHHHHHHHHH
Q ss_conf             4668998022100344467079854655421011002232222233322278899998607-996999812389999999
Q gi|254780348|r  225 DPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGR-GVTSLLVEGGAAVAHSFI  303 (364)
Q Consensus       225 d~~l~i~~~~~l~~~~~~~~~ii~~~~~~~~~~~~~~~~~v~vi~~~~~dl~~iL~~L~~~-gi~~iLVEGG~~l~~sfl  303 (364)
                      +++.....        ....+++                        ..++++.++.+.+. +.+.|+|-||+.+...||
T Consensus        74 S~~~~~~~--------~~~~~~v------------------------~~s~~~~l~~~~~~~~~~~i~IiGG~~IY~~~l  121 (178)
T d1seja1          74 SSSLPQDE--------ADPNVVV------------------------FRNLEDSIENLMNDDSIENIFVCGGESIYRDAL  121 (178)
T ss_dssp             CSSSCCCS--------SCTTEEE------------------------ESSHHHHTTSTTSCTTEEEEEECCCHHHHHHHH
T ss_pred             CCCCCCCC--------CCCEEEE------------------------CCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHH
T ss_conf             35765333--------5550453------------------------214999988765025876499971279999974


Q ss_pred             HCCCCCEEEEEEECE-EECCCCCCCCCCCCCCCCCCEEEEEEEE-CCCE---EEEEEECC
Q ss_conf             788988999996074-3268875233345454446405446886-7936---99995074
Q gi|254780348|r  304 NSRLVDSIILYRSQI-VIGEGGIPSPLEEGYLEKNFMCVRRDYF-GSDV---CLEYIGKN  358 (364)
Q Consensus       304 ~~~LvDEl~ifiaP~-ilG~~g~~s~~~~~~~~~~~~l~~~~~i-g~Dv---~~~y~~k~  358 (364)
                      ..+++||++++.-+. ...++. -+|  .. ....+...+.+.. .+++   +.+|.|++
T Consensus       122 ~~~~~d~i~lT~I~~~~~~gD~-~FP--~i-~~~~~~~~~~~~~~~~~~~y~F~vy~rk~  177 (178)
T d1seja1         122 KDNFVDRIYLTRVALEDIEFDT-YFP--EI-PETFLPVYMSQTFCTKNISYDFMIFEKQE  177 (178)
T ss_dssp             HTTCCSEEEEEEECCCSSCCSE-ECC--CC-CTTCEEEEECCCEEETTEEEEEEEEECCC
T ss_pred             HCCCCCEEEEEEEEEECCCCCE-ECC--CC-CHHHEEEEEEEEECCCCCCEEEEEEEEEE
T ss_conf             2341478999998224267876-999--89-84683888887353689956999999975


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: Dihydrofolate reductases
domain: Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain
species: Cryptosporidium hominis [TaxId: 237895]