RPSBLAST alignment of GI: 254780348 and protein with PDBid: 2b3z

>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Length = 373
 Score =  218 bits (555), Expect = 2e-57
 Identities = 120/358 (33%), Positives = 177/358 (49%), Gaps = 9/358 (2%)

Query: 5   SFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAG 64
           S +  +M  AL  ++   G T +NP V  ++VKDG ++G G     G  HAEV A+  AG
Sbjct: 12  SMEEYYMKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAG 71

Query: 65  EEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGI 124
             A GA  YVTLEPCSHYG++PPCA+ II  GI+RV V + DP+  V+GRG+  + + GI
Sbjct: 72  AHAEGADIYVTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGI 131

Query: 125 IVDRMMESEGKIFLHAYLTRQVE-KRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQV 183
            V   + ++    L+      +     ++TLK A S D  I  +   S  IT   ++   
Sbjct: 132 EVREGILADQAERLNEKFLHFMRTGLPYVTLKAAASLDGKIATSTGDSKWITSEAARQDA 191

Query: 184 HLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLA 243
              R    +ILVG+GTV AD+P LTCRL  +    P+R+ILD    +  D+K+I   +  
Sbjct: 192 QQYRKTHQSILVGVGTVKADNPSLTCRLPNVT-KQPVRVILDTVLSIPEDAKVICDQIAP 250

Query: 244 PVIIVTE--NDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHS 301
             I  T   +++    L+    NI  +  +   +  +L IL   G+ S+ VEGG+AV  S
Sbjct: 251 TWIFTTARADEEKKKRLSAFGVNIFTLETERIQIPDVLKILAEEGIMSVYVEGGSAVHGS 310

Query: 302 FINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEK-----NFMCVRRDYFGSDVCLEY 354
           F+       II Y +  +IG    PS +     +                G D+ L  
Sbjct: 311 FVKEGCFQEIIFYFAPKLIGGTHAPSLISGEGFQSMKDVPLLQFTDITQIGRDIKLTA 368