HHSEARCH alignment of GI: 254780350 and SCOP domain: d1slma1

Alignment
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
Probab=97.87  E-value=1.5e-05  Score=51.08  Aligned_cols=55  Identities=27%  Similarity=0.234  Sum_probs=44.2

Q ss_pred             HHHHHHHCCCCCCCCCCC--CCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCC
Q ss_conf             999999819866567877--6457899999999999808887870299999884489
Q gi|254780350|r  114 LRERLIISGDLDPSKGLS--VAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVP  168 (431)
Q Consensus       114 Lr~RL~~~Gdl~~~~~~~--~~yD~~l~~AVk~FQ~rhGL~~DGvig~~Tl~aLN~~  168 (431)
                      .++=|..-|||+......  ..-+..+.+||+.||+-.||++||.+|++|++.|+.|
T Consensus         2 ~~~YL~~fgyl~~~~~~~~~~~~~~~l~~Ai~~~Q~f~~L~~TG~lD~~T~~~M~~P   58 (65)
T d1slma1           2 VQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKP   58 (65)
T ss_dssp             HHHHHHHHSCCCCC---------CHHHHHHHHHHHHHTTCCCCSSCCHHHHHHTTSC
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCC
T ss_conf             799999808999874300245667999999999999839974255799999988768


SCOP domain information

class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: MMP N-terminal domain
domain: Stromelysin-1 (MMP-3)
species: Human (Homo sapiens), fibroblast [TaxId: 9606]