BLAST/PSIBLAST alignment of GI: 254780350 and GI: 150396039 at iteration 1
>gi|150396039|ref|YP_001326506.1| peptidoglycan binding domain-containing protein [Sinorhizobium medicae WSM419] Length = 443
>gi|150027554|gb|ABR59671.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium medicae WSM419] Length = 443
 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/384 (52%), Positives = 271/384 (70%), Gaps = 4/384 (1%)

Query: 35  VLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGW 94
            L+EIIN       +D+FD   +R    + S+ P+   ETIA  ++AI  YQ I + GGW
Sbjct: 36  ALNEIINSPRRGSWDDQFDAKASRTATAVLSNTPVFGPETIALLQQAILDYQQIAAAGGW 95

Query: 95  PEL---PIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGL 151
           P +     + L LG +  +VQ+LR+RL+ISGDL  S G+S +FD+YV+ AVK FQ RHGL
Sbjct: 96  PMVNPASTQRLELGVNDPAVQQLRQRLMISGDLPQSAGISPSFDSYVDGAVKRFQARHGL 155

Query: 152 DPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENG 211
              G++   +L+A+NV    R+ QL+ NL+R++ +    +G RYV+VNIPAA +EAVENG
Sbjct: 156 PADGVIGEYSLKALNVDASTRLAQLETNLVRLQSM-SGDLGRRYVMVNIPAAYIEAVENG 214

Query: 212 KVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNI 271
           +V LR T IVG++DRQ+PIL+S+I  ++ NPYW  PRSIIQKD+M L+R+DP YL+ N I
Sbjct: 215 RVALRHTAIVGKIDRQSPILNSKIYEVILNPYWTAPRSIIQKDIMPLMRKDPTYLERNAI 274

Query: 272 HMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPIL 331
            ++D  G EV  E +DW + + PN +FRQDPGKINAM+STKI F++ +  YMHDTP+  L
Sbjct: 275 RLLDGNGNEVSPETIDWQAEKAPNLMFRQDPGKINAMSSTKINFHNEHAVYMHDTPQQGL 334

Query: 332 FNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFV 391
           FN ++RFE+SGCVRV+N+ DL  WLLK+TP WSR  IE  +K+   TP+KLA EVPV+F 
Sbjct: 335 FNKLMRFESSGCVRVQNVRDLSTWLLKETPGWSRQQIEGTIKSGVNTPIKLAEEVPVYFT 394

Query: 392 YISAWSPKDSIIQFRDDIYGLDNV 415
           YI+AWS KD ++QFRDDIY  D  
Sbjct: 395 YITAWSAKDRVVQFRDDIYQRDGA 418