BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780351|ref|YP_003064764.1| MarR family transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] (171 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780351|ref|YP_003064764.1| MarR family transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 341 bits (874), Expect = 5e-96, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%) Query: 1 MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQA 60 MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQA Sbjct: 1 MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQA 60 Query: 61 LLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSG 120 LLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSG Sbjct: 61 LLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSG 120 Query: 121 KEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL 171 KEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL Sbjct: 121 KEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL 171 >gi|254780410|ref|YP_003064823.1| hypothetical protein CLIBASIA_01475 [Candidatus Liberibacter asiaticus str. psy62] Length = 362 Score = 26.6 bits (57), Expect = 0.25, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 62 LLFNIGDLELTAGELRSRGYYLGS 85 L+FNIGD E+ + L Y+LG+ Sbjct: 187 LVFNIGDHEIKSNFLTCSDYFLGA 210 >gi|254780687|ref|YP_003065100.1| flagellar C-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 318 Score = 23.1 bits (48), Expect = 3.1, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 125 ETISQLYQRHIESIDK 140 ETI QLY R + +++K Sbjct: 117 ETIPQLYNRSLSTVEK 132 >gi|254781039|ref|YP_003065452.1| putative glycerol-3-phosphate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 329 Score = 22.3 bits (46), Expect = 5.4, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Query: 51 GRSDVNAVQALLLFNIGDLELTAGELRSRGYYLG 84 GR+D L L +GDL LTA +SR + G Sbjct: 232 GRADT----ILRLSGVGDLILTATSEQSRNFCFG 261 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.9 bits (45), Expect = 6.0, Method: Compositional matrix adjust. Identities = 11/37 (29%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Query: 107 IDKRSIRISLTQSGKEIAETISQLY----QRHIESID 139 +D R +++TQ + I E I+Q+Y +++I++I Sbjct: 500 LDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIP 536 >gi|254780239|ref|YP_003064652.1| 30S ribosomal protein S13 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 21.9 bits (45), Expect = 7.0, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 83 LGSNVSYNLKKLIDLGFIKHQRSR 106 L V+ N+K+L+DLG + R R Sbjct: 70 LRRTVAMNIKRLMDLGCYRGLRHR 93 >gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Score = 21.6 bits (44), Expect = 7.9, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 22/46 (47%) Query: 113 RISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQR 158 R LT+ E SQ+ Q+ ID+ GG+S+ + L+R Sbjct: 295 RGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKR 340 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.138 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,194 Number of Sequences: 1233 Number of extensions: 3790 Number of successful extensions: 19 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 12 length of query: 171 length of database: 328,796 effective HSP length: 68 effective length of query: 103 effective length of database: 244,952 effective search space: 25230056 effective search space used: 25230056 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 35 (18.1 bits)