RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780357|ref|YP_003064770.1| hypothetical protein CLIBASIA_01210 [Candidatus Liberibacter asiaticus str. psy62] (394 letters) >d1hyoa1 b.34.8.1 (A:1-118) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Score = 29.2 bits (65), Expect = 0.55 Identities = 8/33 (24%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Query: 140 SLDNIPFGVMAWGLDIIIHIAHRISVAHNEFCI 172 + N+P+GV + + RI VA + + Sbjct: 13 PIQNLPYGVFSTQ----SNPKPRIGVAIGDQIL 41 >d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 181 Score = 29.0 bits (64), Expect = 0.72 Identities = 9/82 (10%), Positives = 22/82 (26%), Gaps = 4/82 (4%) Query: 15 TTIEGIARLSPPSGPA----FPGLFDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTW 70 G +P P + F S YS + S ++ + Sbjct: 77 LKRNGKLYPNPFGEPHLSIDYENSFAAPLVILETDYSNYACLYSCIDYNFGYHSDFSFIF 136 Query: 71 KKISSIKQSFLNEIRANIGTYG 92 + +++ ++ + A Sbjct: 137 SRSANLADQYVKKCEAAFKNIN 158 >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412 Score = 25.9 bits (55), Expect = 5.6 Identities = 8/60 (13%), Positives = 18/60 (30%), Gaps = 16/60 (26%) Query: 108 PVYGLIANILAIPILSFVVIPAGLIAILLMILSLDNIPFGVM----AWGLDIIIHIAHRI 163 P Y + ++ P ++ +P + +P GV + A + Sbjct: 359 PRYNRLWTLMGNPCVN---VPVL---------KVGGLPIGVQVIARFGNDAHALATAWFL 406 >d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Length = 409 Score = 26.0 bits (56), Expect = 5.9 Identities = 13/70 (18%), Positives = 20/70 (28%) Query: 35 FDFNFSSYYKGISAIGYFYSIPKMIYSSESHNTWTWKKISSIKQSFLNEIRANIGTYGSA 94 FDF + G+ I + K +S+ + I I Y A Sbjct: 26 FDFGELTLSTGLPGIILMLAELKNKDNSKIYQKKIDNYIEYIVSKLSTYGLLTGSLYSGA 85 Query: 95 SASIFLIKHF 104 + I H Sbjct: 86 AGIALSILHL 95 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.141 0.425 Gapped Lambda K H 0.267 0.0442 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,508,709 Number of extensions: 72539 Number of successful extensions: 216 Number of sequences better than 10.0: 1 Number of HSP's gapped: 216 Number of HSP's successfully gapped: 11 Length of query: 394 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 307 Effective length of database: 1,213,086 Effective search space: 372417402 Effective search space used: 372417402 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (25.3 bits)