HHsearch alignment for GI: 254780360 and conserved domain: PRK08238

>PRK08238 hypothetical protein; Validated.
Probab=99.91  E-value=1e-21  Score=147.89  Aligned_cols=172  Identities=19%  Similarity=0.245  Sum_probs=134.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHH---HHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCHHHHCHHHH
Q ss_conf             6537999999626899999999999999708989989---9999999999999999988633066120137121070566
Q gi|254780360|r    5 VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVL---KSVISIFAIAMGAGASGALNMYYDADIDKMMARTASRPIP   81 (305)
Q Consensus         5 ~~k~~~y~~L~kp~~~~~~~~~~~~g~~la~~~~~~~---~~~~~~~~~~l~~~a~~~~Nd~~D~~iD~~~~RT~~RPl~   81 (305)
T Consensus       190 ~~~~~~~lk~lRphQW~KNll-vF~Pl~~a~~~~~~~~~~~~~~aF~~Fsl~ASsvYi~NDl~D~e~DR~Hp~Kr~RP~A  268 (481)
T PRK08238        190 PPSLRTWLKALRVHQWLKNLL-VFVPLLAAHDFGDLQAVLAALLAFLAFSLCASAVYILNDLLDLEADRAHPRKRRRPFA  268 (481)
T ss_pred             CCCHHHHHHHHCHHHHHHHHH-HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             867999999869899988689-9999987242058999999999999999999698988608678754168624569777


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHEEECCCCC
Q ss_conf             53047898999888877668999886344589999999888654445443102665605888877664221101323688
Q gi|254780360|r   82 LGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGD  161 (305)
Q Consensus        82 ~g~is~~~a~~~~~~l~~~~~~~l~~~~n~~~~~l~~~~~~~y~~iYtp~lKR~t~~~~~~~~i~ga~~~l~g~~a~~~~  161 (305)
T Consensus       269 SG~ls~~~~~~~~~~ll~~~~~~a-~~~~~~f~~~l~~Y~~l-t~~YS~~LK~i~iiDv~~la~~f~lRiiaG~~a~--~  344 (481)
T PRK08238        269 SGALPIPFGLAAAPVLLLAALALA-LALSPAFLLVLLAYLVL-TLAYSLRLKRKALIDVLTLAGLYTLRIIAGAVAV--G  344 (481)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH-HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHC--C
T ss_conf             788898899999999999999999-99679999999999999-9999999754267589999989999998526230--7


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             5663211147888899999999986
Q gi|254780360|r  162 VSIASLVMFLIIFLWTPPHFWSLAL  186 (305)
Q Consensus       162 ~~~~~~~l~~~~~~W~~~~~~~~a~  186 (305)
T Consensus       345 i~~S~WLl~fs~f~-----fl~La~  364 (481)
T PRK08238        345 VALSFWLLAFSMFF-----FLSLAL  364 (481)
T ss_pred             CCCCHHHHHHHHHH-----HHHHHH
T ss_conf             78749999999999-----999999