HHsearch alignment for GI: 254780360 and conserved domain: TIGR00751

>TIGR00751 menA 1,4-dihydroxy-2-naphthoate octaprenyltransferase; InterPro: IPR004657 This membrane-associated enzyme converts 1,4-dihydroxy-2-naphthoic acid (DHNA) to demethylmenaquinone, a step in menaquinone biosynthesis. A key reaction in the biosynthesis of menaquinone involves the conversion of the soluble bicyclic naphthalenoid compound 1, 4-dihydroxy-2-naphthoic acid (DHNA) to the membrane-bound demethylmenaquinone .; GO: 0016740 transferase activity, 0009234 menaquinone biosynthetic process, 0016021 integral to membrane.
Probab=91.57  E-value=0.96  Score=23.58  Aligned_cols=185  Identities=19%  Similarity=0.101  Sum_probs=96.3

Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CHHCCCHHHHCHHHHHHHCCHHHHHHHHH---HH
Q ss_conf             99999999997089899899999999999999999988633066--12013712107056653047898999888---87
Q gi|254780360|r   23 AIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA--DIDKMMARTASRPIPLGQISPWEAWVLGV---SL   97 (305)
Q Consensus        23 ~~~~~~~g~~la~~~~~~~~~~~~~~~~~l~~~a~~~~Nd~~D~--~iD~~~~RT~~RPl~~g~is~~~a~~~~~---~l   97 (305)
T Consensus        12 ~~~g~~~~~w~~p~~~~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~g~d~~~~~gp~~~~~~~~~~~~~~~~~~~~~~~~   91 (286)
T TIGR00751        12 IVAGTGLAWWLGPQGFDWLVALLALLTAGLLQILSNLANDYGDGVKGSDKDDRIGPLRGVGKGLITPKELKWALILSLAL   91 (286)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             76432455432620003899999999999999987531000233467775101001343332101278889999999999


Q ss_pred             HHH-HHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHEEECCCCCC-------CC
Q ss_conf             766-8999886344589-----9999998886544454431026656058888776642211013236885-------66
Q gi|254780360|r   98 AVS-SIVIMGLAINWVS-----ATLLFMSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV-------SI  164 (305)
Q Consensus        98 ~~~-~~~~l~~~~n~~~-----~~l~~~~~~~y~~iYtp~lKR~t~~~~~~~~i~ga~~~l~g~~a~~~~~-------~~  164 (305)
T Consensus        92 ~~~~g~~~~~~~~~~~~d~~~~~~~g~~~~~~-~~~~~~g~~p~g~~g~--g~~--~~~~~~g~~~~~g~~~~~~~~~~~  166 (286)
T TIGR00751        92 GALSGLALVGLAAPNLADLFWFLGLGGLCIVG-AWTYTGGSKPYGYAGL--GDL--SVLVFFGPLGVLGTWYLQAHTLDW  166 (286)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCCCCCCC--HHH--HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98877899987544578899999987999998-8765215664442220--146--777777556652345555543335


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             321114788889999999998653566664101335124338877899
Q gi|254780360|r  165 ASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMH  212 (305)
Q Consensus       165 ~~~~l~~~~~~W~~~~~~~~a~~d~~dd~k~Gikslpv~~G~k~t~~~  212 (305)
T Consensus       167 ~~~~~~~~~g~~~~~~~~~~~~~d~~~d~~~~~~~~~~~~g~~~~~~~  214 (286)
T TIGR00751       167 AGLLPAVATGLLACAVLNINNLRDIPTDAKAGKNTLAVRLGDAKGRVY  214 (286)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCEEEEHHHHHHHHH
T ss_conf             677666554467777765321110220010241000011101334688