HHsearch alignment for GI: 254780360 and conserved domain: TIGR01476

>TIGR01476 chlor_syn_BchG bacteriochlorophyll/chlorophyll synthetase; InterPro: IPR006372 These are a subfamily of a large family of polyprenyltransferases that also includes 4-hydroxybenzoate octaprenyltransferase and protoheme IX farnesyltransferase (heme O synthase). Members of this family are found exclusively in photosynthetic organisms, including a single copy in Arabidopsis thaliana.; GO: 0030494 bacteriochlorophyll biosynthetic process.
Probab=100.00  E-value=4.2e-32  Score=209.54  Aligned_cols=242  Identities=21%  Similarity=0.273  Sum_probs=171.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCC---CC-----CCHHHHHH-HHHHHHHHHHHHHHHHHHHCCCHHCCCHHHHCHH
Q ss_conf             999999626899999999999999708---98-----99899999-9999999999999886330661201371210705
Q gi|254780360|r    9 NFFIVLLKPRVMSLAIYTAFVGIVLAP---GH-----ISVLKSVI-SIFAIAMGAGASGALNMYYDADIDKMMARTASRP   79 (305)
Q Consensus         9 ~~y~~L~kp~~~~~~~~~~~~g~~la~---~~-----~~~~~~~~-~~~~~~l~~~a~~~~Nd~~D~~iD~~~~RT~~RP   79 (305)
T Consensus         1 ~~~l~L~~PvTW~~p~w~~~CGA~asG~~~g~dWtr~e~~~~~LlGmllaGPL~tG~sQ~~Ndy~DR~vDAiNe--P~Rp   78 (295)
T TIGR01476         1 RARLELMKPVTWIPPIWAVLCGAVASGALRGSDWTRVEKWLLLLLGMLLAGPLLTGLSQSVNDYFDRDVDAINE--PQRP   78 (295)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC--CCCC
T ss_conf             96200268733343699998666660333687655523489999999875145410377764331565466377--3558


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHH---HHHHCCCCCCHHHHHHH-HHH
Q ss_conf             665304789899988887766899988634458------99999998886544454---43102665605888877-664
Q gi|254780360|r   80 IPLGQISPWEAWVLGVSLAVSSIVIMGLAINWV------SATLLFMSIFCYVVIYT---IWLKRFTPQNIVIGGIA-GAI  149 (305)
Q Consensus        80 l~~g~is~~~a~~~~~~l~~~~~~~l~~~~n~~------~~~l~~~~~~~y~~iYt---p~lKR~t~~~~~~~~i~-ga~  149 (305)
T Consensus        79 IPsG~iS~~~~~~~~~vL~~~~~~va~~LG~~~qhdfPi~~~~~~~G~~~-A~~YS~~PikLK~~GWlG~~~vg~sY~~L  157 (295)
T TIGR01476        79 IPSGAISLREVLILILVLTVAGLAVALVLGNWLQHDFPIIVLFTVVGVVL-ALIYSLPPIKLKRNGWLGPALVGLSYEGL  157 (295)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH-HHHHHCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             98860067899999999999999999872664333226999999999999-99970463012435560078999997456


Q ss_pred             HHHHEEECCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2211013236-885663211147888899999999986535666641013351243388778997434568989987642
Q gi|254780360|r  150 PPMIGWASVT-GDVSIASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPT  228 (305)
Q Consensus       150 ~~l~g~~a~~-~~~~~~~~~l~~~~~~W~~~~~~~~a~~d~~dd~k~Gikslpv~~G~k~t~~~i~~ysi~~~llsll~~  228 (305)
T Consensus       158 ~W~AGha~fa~GaL~~~~vvvALlys~~A~Gi~~lNDfKSveGDr~lGl~SLpV~~G~~~aa~~~~~-~~~~~q~~v~~l  236 (295)
T TIGR01476       158 PWMAGHAVFAPGALTFEIVVVALLYSLGAHGIMTLNDFKSVEGDRQLGLRSLPVMLGVKVAAKLAVT-TIDVFQILVIGL  236 (295)
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHHHHH
T ss_conf             7899999860379851558898899887616677732452015113463201103124667899998-999999999999


Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10221089999999999999999999
Q gi|254780360|r  229 MLGFASVTYGIIVFFLGYHFTLWAWR  254 (305)
Q Consensus       229 ~~~~~g~~yli~ali~~~~~l~~a~~  254 (305)
T Consensus       237 l~~wG~~~~A~~v~~lLvAq~~~~~~  262 (295)
T TIGR01476       237 LLIWGQPLVATIVLLLLVAQIIAQAK  262 (295)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99832378999999998433664248