HHsearch alignment for GI: 254780360 and conserved domain: pfam01040

>pfam01040 UbiA UbiA prenyltransferase family.
Probab=100.00  E-value=1e-34  Score=225.08  Aligned_cols=231  Identities=22%  Similarity=0.321  Sum_probs=176.7

Q ss_pred             HHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCHHHHCHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             99999999997089-89989999999999999999998863306612013712107056653047898999888877668
Q gi|254780360|r   23 AIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSS  101 (305)
Q Consensus        23 ~~~~~~~g~~la~~-~~~~~~~~~~~~~~~l~~~a~~~~Nd~~D~~iD~~~~RT~~RPl~~g~is~~~a~~~~~~l~~~~  101 (305)
T Consensus         4 ~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Nd~~D~~~D~~~~~~~~Rpl~~g~is~~~~~~~~~~~~~~~   83 (258)
T pfam01040         4 ALLPVLAGLALAAGGALDLLLLLLLLLALLLLQAAGNVLNDYFDREIDADNPNKPSRPLPSGRISPREALLLALALLLLG   83 (258)
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999999999857999999999999999999999999984851841866777888877899977999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCCHHHHHHHHHHHHHHEEECCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99988634458999999988865444544-31026656058888776642211013236885663211147888899999
Q gi|254780360|r  102 IVIMGLAINWVSATLLFMSIFCYVVIYTI-WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH  180 (305)
Q Consensus       102 ~~~l~~~~n~~~~~l~~~~~~~y~~iYtp-~lKR~t~~~~~~~~i~ga~~~l~g~~a~~~~~~~~~~~l~~~~~~W~~~~  180 (305)
T Consensus        84 ~~~~-~~~~~~~~~~~~~~~~~~-~~Ys~~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (258)
T pfam01040        84 LLLA-LLLGPLLLLLGLLGLLLG-LLYSLPRLKRRPLLGELVVGLAFGLLILLGAYAVGGDIPSPLLLLALPLFLLGLAI  161 (258)
T ss_pred             HHHH-HHHHHHHHHHHHHHHHHH-HHHHCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9999-999999999999999999-99944641346876621022398899999999980888699999999999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99998653566664101335124338877899743456898998764210221089999999999999999999995
Q gi|254780360|r  181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWAWRTFL  257 (305)
Q Consensus       181 ~~~~a~~d~~dd~k~Gikslpv~~G~k~t~~~i~~ysi~~~llsll~~~~~~~g~~yli~ali~~~~~l~~a~~~~~  257 (305)
T Consensus       162 ~~~~~~~D~e~D~~~g~~tl~~~~G~~~~~~~~~~~~~~~~~~~~-~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~  236 (258)
T pfam01040       162 LLANDIRDVEGDRKAGRRTLPVRLGEKRALALLALLLAAALLLLA-LLLLLL-APLLLLLAVLLAALALLRALRLLR  236 (258)
T ss_pred             HHHHHCCCHHHHHHCCCCCCCEEECHHHHHHHHHHHHHHHHHHHH-HHHHHH-HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999970357879987998516347777699999999999999999-999998-789999999999999999999972