BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780360|ref|YP_003064773.1| protoheme IX
farnesyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (305 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|239831338|ref|ZP_04679667.1| protoheme IX farnesyltransferase [Ochrobactrum intermedium LMG
           3301]
 gi|239823605|gb|EEQ95173.1| protoheme IX farnesyltransferase [Ochrobactrum intermedium LMG
           3301]
          Length = 427

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 147/283 (51%), Positives = 201/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+V+APGH++ + + ISI  IA+GAGASGALNM+YDADI
Sbjct: 134 RDYLVLLKPRVMSLVVFTGLVGLVVAPGHMNPVLAAISILCIAVGAGASGALNMWYDADI 193

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT +RPIP G I+P +    G++L+  S++ +GL +NW++  LL  +IF Y VIY
Sbjct: 194 DAVMKRTRNRPIPAGVIAPNQVLAFGLTLSAFSVITLGLMVNWLAGALLAFTIFFYAVIY 253

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  SLV+F+IIFLWTPPHFW+L+L  
Sbjct: 254 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFS 313

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+ A IPM+PNV  + +T+   L Y+++ + VGVLP +LGFA   YG +   LG  F
Sbjct: 314 STDYEAARIPMMPNVKGELSTRRQALFYSIIMAPVGVLPWVLGFAGPVYGAVSTLLGLAF 373

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  LF +L+V+ L
Sbjct: 374 LYYAWRLWAAGSQPAMLAAARKLFRFSLLYLSGLFAVLLVETL 416


>gi|108799382|ref|YP_639579.1| protoheme IX farnesyltransferase [Mycobacterium sp. MCS]
 gi|119868496|ref|YP_938448.1| protoheme IX farnesyltransferase [Mycobacterium sp. KMS]
 gi|108769801|gb|ABG08523.1| protoheme IX farnesyltransferase [Mycobacterium sp. MCS]
 gi|119694585|gb|ABL91658.1| protoheme IX farnesyltransferase [Mycobacterium sp. KMS]
          Length = 333

 Score =  181 bits (460), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 158/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G +  L  + ++    + A  +  LN   DADI
Sbjct: 45  AYLALTKPRVIELLLVTAIPAMLLADRGSVDPLLILNTLIGGMLAAAGANTLNCVADADI 104

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK M RTA RP+    +    A + G+ L+V S   +    N +S  L   +I  YV +Y
Sbjct: 105 DKKMKRTARRPLARDTVPTRNALIFGLVLSVGSFFWLWGTSNLLSGLLAVATIAFYVFVY 164

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMF IIF WTPPH W+LA+  
Sbjct: 165 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFAIIFFWTPPHTWALAMRY 224

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     ILIYT LT +  +   +       Y  +    G  F
Sbjct: 225 KDDYKAAGVPMLPAVATERQVTRQILIYTWLTVLTTLALAL--ATGWLYASVAVLAGTWF 282

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            + A + +   +  +     +LFL+S  YL V+F  L VD ++ + T+
Sbjct: 283 LVMAHQLYNGVKRGEPVKPLRLFLQSNNYLAVVFAALAVDSVLALPTL 330


>gi|312198662|ref|YP_004018723.1| protoheme IX farnesyltransferase [Frankia sp. EuI1c]
 gi|311229998|gb|ADP82853.1| protoheme IX farnesyltransferase [Frankia sp. EuI1c]
          Length = 395

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 157/288 (54%), Gaps = 1/288 (0%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           + +   +I L KPR++ L + T    ++LA  G  S+   +I++ A  + AG++  +N Y
Sbjct: 108 LAKTRAYIALTKPRIIELLLITTVPVMILAKRGLPSLWLILITLVAGTLAAGSANTINCY 167

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D DID++MART  RP+    ++P EA   G+ L V + ++ GL +NW SA L   +I  
Sbjct: 168 VDRDIDEIMARTKRRPLVKATVTPVEALRFGIVLGVVATLLFGLLVNWPSALLADGAIAF 227

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+ LKR T  NIVIGG AG  P +IGW++VTG V   ++V+F ++F WTPPHFW+
Sbjct: 228 YVFVYTLGLKRRTSSNIVIGGAAGCFPVLIGWSAVTGTVGWGAVVLFGVVFFWTPPHFWA 287

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  KDDY  A +PMLP V   R     ILIY+ +     +    +  A   Y      
Sbjct: 288 LAIKFKDDYAAAGVPMLPVVAPLREVGRKILIYSYVMVATSLALYPVADAGYVYLGTAVV 347

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            G  F   A R              +LF  SITYL +LF  + V  L+
Sbjct: 348 TGAWFLFEAHRMTHQIAKGTEIRPMRLFHYSITYLTLLFIAVAVSPLV 395


>gi|163792281|ref|ZP_02186258.1| putative protoheme IX farnesyltransferase (heme o synthase) [alpha
           proteobacterium BAL199]
 gi|159181986|gb|EDP66495.1| putative protoheme IX farnesyltransferase (heme o synthase) [alpha
           proteobacterium BAL199]
          Length = 312

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 156/282 (55%), Positives = 204/282 (72%), Gaps = 1/282 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ LLKPRVMSL ++T  VG+ +APGH++ + +VI++  IA+GAGASGA+NM+YD DID
Sbjct: 27  DYVALLKPRVMSLVVFTGAVGLAVAPGHLNPVLAVIAVLCIAIGAGASGAINMWYDRDID 86

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT +RPIP G+++P EA   GV LA  S+++MGLA+NW +A LL ++I  YV IYT
Sbjct: 87  AVMERTKTRPIPAGRMNPDEALAFGVVLAGFSVLVMGLAVNWAAAVLLAVTIGFYVFIYT 146

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGWA+VTGDVS+AS+V+F IIF+WTPPHFW+LAL   
Sbjct: 147 MWLKRRTPQNIVIGGAAGAFPPMIGWAAVTGDVSVASIVLFAIIFMWTPPHFWALALWRC 206

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY +A +PMLP V  DR T+  ILIY VL + +GV P  LGFA + YG+    LG  F 
Sbjct: 207 GDYARAGVPMLPVVAGDRETRRQILIYAVLLAPLGVAPWFLGFAGLGYGMAATVLGALFV 266

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           + A R +    D D R  K+LF  SI YLF L+  L++D  +
Sbjct: 267 VAAVRVWRG-SDADHRPAKQLFGYSILYLFALYGALLIDSWL 307


>gi|114328921|ref|YP_746078.1| protoheme IX farnesyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317095|gb|ABI63155.1| protoheme IX farnesyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 329

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 189/288 (65%), Gaps = 6/288 (2%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ LLKPRVMSL ++T  +G+++APG +  +   I+I  IA+  GASGA+NM+YD DID
Sbjct: 42  DWVTLLKPRVMSLVVFTGLIGMLVAPGSLHPVLGAIAILCIAVATGASGAINMWYDRDID 101

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT +RPIP G+I P EA   G+ LAV S+++M LA N V+A +L  +IF Y VIYT
Sbjct: 102 AVMRRTKNRPIPAGRIEPGEALGYGIVLAVGSVLVMWLATNVVAAAVLAFAIFFYSVIYT 161

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PP+IGWA+VTG + +  ++MF I+F WTPPHFWSL+L  +
Sbjct: 162 MWLKRSTPQNIVIGGAAGAFPPVIGWAAVTGTIDLMPVMMFAIVFFWTPPHFWSLSLWAQ 221

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY++A +PMLP V   R T+ HI+ YTVL S++ VLP  LG     YG+    L   F 
Sbjct: 222 MDYERAGVPMLPVVAGARKTRQHIMAYTVLLSVIAVLPWALGDTGRVYGLSAVVLSLGFL 281

Query: 250 LWAWRTFLCKEDK------DIRVTKKLFLESITYLFVLFTILMVDHLI 291
           + +WR    K+D+           +  F  S+ YL VLF  L VD  +
Sbjct: 282 VQSWRVLRDKQDEVGLSLTKDAPARAAFKYSLIYLAVLFLALAVDRFV 329


>gi|256391442|ref|YP_003113006.1| protoheme IX farnesyltransferase [Catenulispora acidiphila DSM
           44928]
 gi|256357668|gb|ACU71165.1| protoheme IX farnesyltransferase [Catenulispora acidiphila DSM
           44928]
          Length = 328

 Score =  176 bits (445), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 108/289 (37%), Positives = 158/289 (54%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KPR++ L + T    + LA  H+  +   V       + AG++ ALN Y D 
Sbjct: 40  LKAYVALTKPRIIELLLVTTIPVMFLALRHVPGLWPVVAVTVGGYLSAGSANALNCYVDR 99

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P   ++P  A V G+ L V S + +GLA+NW+S+ L   +   YV+
Sbjct: 100 DIDAEMRRTRRRPVPAASVTPQNALVFGLVLGVVSTLWLGLAVNWLSSGLALAANAFYVL 159

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR TPQNIV GG AG  P +IGW + T  ++ A +V+F+++FLWTPPHFW+LA+
Sbjct: 160 VYTMVLKRRTPQNIVWGGAAGCFPALIGWTAATDRLAWAPVVLFMVVFLWTPPHFWALAI 219

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A++PMLP V   R     I+ Y+  T    +L   +G   + Y I    LG 
Sbjct: 220 RYREDYAAANVPMLPVVAPAREVTKQIVWYSYATVACSLLLWPIGHTGLVYPIAAAVLGV 279

Query: 247 HFTLWAWRT---FLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            F + A R        +D    +  +LF  S  YL +LF    V  L+ 
Sbjct: 280 VFLVEAHRLDARARSGKDGVELLPMRLFHFSNMYLALLFVAAAVSPLVH 328


>gi|254780360|ref|YP_003064773.1| protoheme IX farnesyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040037|gb|ACT56833.1| protoheme IX farnesyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 305

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGAL 60
           MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGAL
Sbjct: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGAL 60

Query: 61  NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS 120
           NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS
Sbjct: 61  NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS 120

Query: 121 IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH 180
           IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH
Sbjct: 121 IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH 180

Query: 181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII 240
           FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII
Sbjct: 181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII 240

Query: 241 VFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
           VFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF
Sbjct: 241 VFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300

Query: 301 FSSFL 305
           FSSFL
Sbjct: 301 FSSFL 305


>gi|304320207|ref|YP_003853850.1| putative heme o synthase transmembrane protein [Parvularcula
           bermudensis HTCC2503]
 gi|303299110|gb|ADM08709.1| putative heme o synthase transmembrane protein [Parvularcula
           bermudensis HTCC2503]
          Length = 317

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 134/281 (47%), Positives = 193/281 (68%), Gaps = 4/281 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHI-SVLKSVISIFAIAMGAGASGALNMYYDAD 67
             ++ LLKPRVMSL+I+TAF G++ APG + +   ++IS+ AIA+GAGASGALNM++DAD
Sbjct: 33  RDYLQLLKPRVMSLSIFTAFAGMIAAPGEVTNWPLALISLLAIALGAGASGALNMWWDAD 92

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP G +   EA + G  L++ ++ ++ L+  +++A LL  +I  YV++
Sbjct: 93  IDAVMQRTKDRPIPRGAVPRDEALIFGGLLSLLAVWLLALSGTYLAAALLAGTILFYVLV 152

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++ LKR TPQNIVIGG AGA+PP++GWA++TGD  +A+ V+F IIF+WTPPHFW+LAL+
Sbjct: 153 YSMILKRRTPQNIVIGGAAGALPPVVGWAAITGDAPLAAWVLFSIIFVWTPPHFWALALV 212

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +DDY+ A+IPM+PNV  D  T+  IL Y+VL + +GVLP     A   YG +    G  
Sbjct: 213 KQDDYRAAAIPMMPNVRGDAHTRRLILWYSVLLAPLGVLPVAFEMAGWLYGSVAVLGGVV 272

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
           F   A      + D+  +   +LF  SI YLF LF  L+++
Sbjct: 273 FVALAVNI---QRDERAKPAWRLFGFSIFYLFALFLALIIE 310


>gi|126435039|ref|YP_001070730.1| protoheme IX farnesyltransferase [Mycobacterium sp. JLS]
 gi|182639211|sp|A3PZB2|COXX_MYCSJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639254|sp|A1UFQ0|COXX_MYCSK RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639255|sp|Q1B9B1|COXX_MYCSS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|126234839|gb|ABN98239.1| protoheme IX farnesyltransferase [Mycobacterium sp. JLS]
          Length = 310

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 158/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G +  L  + ++    + A  +  LN   DADI
Sbjct: 22  AYLALTKPRVIELLLVTAIPAMLLADRGSVDPLLILNTLIGGMLAAAGANTLNCVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK M RTA RP+    +    A + G+ L+V S   +    N +S  L   +I  YV +Y
Sbjct: 82  DKKMKRTARRPLARDTVPTRNALIFGLVLSVGSFFWLWGTSNLLSGLLAVATIAFYVFVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMF IIF WTPPH W+LA+  
Sbjct: 142 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFAIIFFWTPPHTWALAMRY 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     ILIYT LT +  +   +       Y  +    G  F
Sbjct: 202 KDDYKAAGVPMLPAVATERQVTRQILIYTWLTVLTTLALAL--ATGWLYASVAVLAGTWF 259

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            + A + +   +  +     +LFL+S  YL V+F  L VD ++ + T+
Sbjct: 260 LVMAHQLYNGVKRGEPVKPLRLFLQSNNYLAVVFAALAVDSVLALPTL 307


>gi|300784716|ref|YP_003765007.1| protoheme IX farnesyltransferase [Amycolatopsis mediterranei U32]
 gi|299794230|gb|ADJ44605.1| protoheme IX farnesyltransferase [Amycolatopsis mediterranei U32]
          Length = 326

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 106/291 (36%), Positives = 155/291 (53%), Gaps = 3/291 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPRV+ L + T    + LA   I      + ++    M AG++ ALN   DA
Sbjct: 35  VGAYAALAKPRVIELLLVTTIPAMFLAGRQIPSPWLVLATLVGGTMAAGSANALNCVIDA 94

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DIDK+M RT  RP+    +    A + G+ + V+S V++ L +N +SA L   +I  Y+ 
Sbjct: 95  DIDKVMNRTKRRPLVKDSVPRRGALIFGLVMGVASAVVLYLTVNLLSAILAIATILFYIF 154

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QN+V GG AG +P +IGWA+VTG V   + VMF +IF WTPPH W+L +
Sbjct: 155 VYTLGLKRRTSQNVVWGGAAGCMPVVIGWAAVTGTVQWPAFVMFGVIFFWTPPHTWALGM 214

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY++A +PMLP V T +     I+IY+ +     +L  +L   S  YG      G 
Sbjct: 215 KYRDDYERAGVPMLPVVATAQHVARQIVIYSWVMVAWTLL--LLPVTSWLYGTFAILAGG 272

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            F  +A          +      LF  S TYL ++F  L VD  I + T+ 
Sbjct: 273 WFLFYAHSLQAAVRRGEETKPMALFHRSNTYLMIVFVALAVDSAIGLPTLG 323


>gi|111024137|ref|YP_707109.1| protoheme IX farnesyltransferase [Rhodococcus jostii RHA1]
 gi|110823667|gb|ABG98951.1| probable protoheme IX farnesyltransferase [Rhodococcus jostii RHA1]
          Length = 327

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 107/295 (36%), Positives = 170/295 (57%), Gaps = 3/295 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KPRV+ L +      ++LA  G++ +   + ++F   MGA ++ +LN   D
Sbjct: 34  KVLAYIALTKPRVIELLLVATIPAMLLADRGNVDIALILSTLFGGWMGAASANSLNCVVD 93

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADIDK+M RTA RP+    +    A+V G++L V+S + +    N ++  L+ ++I  YV
Sbjct: 94  ADIDKVMKRTARRPLARDAVPTSHAFVFGMTLGVASFLWLWWRANLLAGCLVVLTIAFYV 153

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           ++YT+ LKR T QN+V GG AG +P M+GW++VTG +S   +V+FL+IF WTPPH W+LA
Sbjct: 154 LVYTMVLKRRTWQNVVWGGAAGCMPVMVGWSAVTGSLSWQPIVLFLVIFFWTPPHTWALA 213

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY+ A +PMLP + T+      IL+Y+     V    T++  A V Y  +    G
Sbjct: 214 MRYKEDYKAAGVPMLPVIATEEHVTKQILLYSWAM--VITSLTLVPAAGVVYAAVTLVAG 271

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             F L A + +            +LFL+S  YL V+F  L VD ++ ++TV    
Sbjct: 272 AWFLLMAHQLYRSVRGGAAVKPLRLFLQSNNYLAVVFVGLAVDSVLGLQTVGSLL 326


>gi|90415427|ref|ZP_01223361.1| probable cytochrome c oxidase assembly factor [marine gamma
           proteobacterium HTCC2207]
 gi|90332750|gb|EAS47920.1| probable cytochrome c oxidase assembly factor [marine gamma
           proteobacterium HTCC2207]
          Length = 301

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 120/285 (42%), Positives = 178/285 (62%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP V++L I T+ +G++LA  G +S+   ++    IA+ AG++ A+N   D 
Sbjct: 13  WRDYLELCKPNVVALMILTSLIGMLLATDGLVSLDVLILGNLGIALCAGSAAAVNHIVDR 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART +RPI  G+I P +A +      ++ +VI+ + IN ++A L   S   Y  
Sbjct: 73  KIDDTMARTHNRPIARGRIQPSQAIMFAALTGLAGMVILLVFINQITAWLTLASSIGYAF 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA PP++GW +VTG+V   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 VYTMYLKRATPQNIVIGGLAGAAPPLLGWTAVTGEVHYNALLLVLIIFAWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY KA IPMLP    ++ TK++I++YT+L  ++ VLP + G   + Y +    LG 
Sbjct: 193 HRKDDYAKAEIPMLPVTHGEQYTKINIVLYTLLLIVITVLPFLTGMFGLLYLVGALVLGA 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  WA      ++D       K F  SITYL VLF I+++DH +
Sbjct: 253 GFLYWALVMLFGQDDDSG---MKTFKFSITYLMVLFVIMLLDHYL 294


>gi|226366377|ref|YP_002784160.1| protoheme IX farnesyltransferase [Rhodococcus opacus B4]
 gi|226244867|dbj|BAH55215.1| putative protoheme IX farnesyltransferase [Rhodococcus opacus B4]
          Length = 327

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 105/295 (35%), Positives = 172/295 (58%), Gaps = 3/295 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KPRV+ L +      ++LA  G++ +L  + ++F   MGA ++ +LN   D
Sbjct: 34  KVLAYIALTKPRVIELLLVATIPAMLLADRGNVDILLILSTLFGGWMGAASANSLNCVVD 93

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADIDK+M RTA RP+    +    A+V G++L V+S + +    N ++  L+ ++I  YV
Sbjct: 94  ADIDKVMKRTARRPLARDAVPTSHAFVFGMTLGVASFLWLWWRANLLAGCLVVLTIAFYV 153

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           ++YT+ LKR T QN+V GG AG +P M+GW++VTG +S   +V+FL+IF WTPPH W+LA
Sbjct: 154 LVYTMVLKRRTWQNVVWGGAAGCMPVMVGWSAVTGSLSWQPIVLFLVIFFWTPPHTWALA 213

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY+ A +PMLP + T+      IL+Y+    I  ++  ++  A V Y  +    G
Sbjct: 214 MRYKEDYKAAGVPMLPVIATEEHVTKQILLYSWAMVITSLV--LVPAAGVVYAAVTLVAG 271

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             F L A + +            +LFL+S  YL ++F  L VD ++ ++T+    
Sbjct: 272 AWFLLMAHQLYRSVRGGAAVKPLRLFLQSNNYLAIVFVGLAVDSVLGLQTIGSLL 326


>gi|257055629|ref|YP_003133461.1| protoheme IX farnesyltransferase [Saccharomonospora viridis DSM
           43017]
 gi|256585501|gb|ACU96634.1| protoheme IX farnesyltransferase [Saccharomonospora viridis DSM
           43017]
          Length = 326

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 155/291 (53%), Gaps = 3/291 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPRV+ L + T    + LA   I      + ++    M AG++ ALN   DA
Sbjct: 35  IGAYAALAKPRVIELLLVTTIPAMFLAGREIPSPWLVLATLVGGTMAAGSANALNCVIDA 94

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DIDK+M RT  RP+    +    A V G++L + S  ++ + +N ++A L   +I  Y+ 
Sbjct: 95  DIDKVMNRTRRRPLVRDSVPRRNALVFGIALGLISFGLLYVTVNLLAAVLAVATILFYIF 154

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR TPQN+V GG AG +P +IGWA+VTG V   + VMF +IF WTPPH W+LA+
Sbjct: 155 VYTLLLKRRTPQNVVWGGAAGCMPVVIGWAAVTGTVEWPAFVMFGVIFFWTPPHTWALAM 214

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY++A +PMLP V T +     I++Y+ +     +L  ++   S  Y       G 
Sbjct: 215 RYREDYERAGVPMLPVVATPKHVAKQIVVYSWVMVAWTLL--LVPATSWLYAAFALLAGA 272

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            F  +A R +      +      LF  S TYL V+F  L VD  I +    
Sbjct: 273 WFLFYAHRLYASVARGEKTKPMALFHRSNTYLMVVFVALAVDAAIGLPVFG 323


>gi|182639257|sp|Q0BPU7|COXX_GRABC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 317

 Score =  173 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 189/288 (65%), Gaps = 6/288 (2%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ LLKPRVMSL ++T  +G+++APG +  +   I+I  IA+  GASGA+NM+YD DID
Sbjct: 30  DWVTLLKPRVMSLVVFTGLIGMLVAPGSLHPVLGAIAILCIAVATGASGAINMWYDRDID 89

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT +RPIP G+I P EA   G+ LAV S+++M LA N V+A +L  +IF Y VIYT
Sbjct: 90  AVMRRTKNRPIPAGRIEPGEALGYGIVLAVGSVLVMWLATNVVAAAVLAFAIFFYSVIYT 149

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PP+IGWA+VTG + +  ++MF I+F WTPPHFWSL+L  +
Sbjct: 150 MWLKRSTPQNIVIGGAAGAFPPVIGWAAVTGTIDLMPVMMFAIVFFWTPPHFWSLSLWAQ 209

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY++A +PMLP V   R T+ HI+ YTVL S++ VLP  LG     YG+    L   F 
Sbjct: 210 MDYERAGVPMLPVVAGARKTRQHIMAYTVLLSVIAVLPWALGDTGRVYGLSAVVLSLGFL 269

Query: 250 LWAWRTFLCKEDK------DIRVTKKLFLESITYLFVLFTILMVDHLI 291
           + +WR    K+D+           +  F  S+ YL VLF  L VD  +
Sbjct: 270 VQSWRVLRDKQDEVGLSLTKDAPARAAFKYSLIYLAVLFLALAVDRFV 317


>gi|229493657|ref|ZP_04387442.1| protoheme IX farnesyltransferase [Rhodococcus erythropolis SK121]
 gi|229319618|gb|EEN85454.1| protoheme IX farnesyltransferase [Rhodococcus erythropolis SK121]
          Length = 327

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 103/295 (34%), Positives = 168/295 (56%), Gaps = 3/295 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KPRV+ L +      ++LA  G + ++  + ++F   MGA ++ +LN   D
Sbjct: 34  KVLAYIALTKPRVIELLLVATIPAMLLADRGTVDIVLILSTLFGGWMGAASANSLNCVVD 93

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADIDK+M RTA RP+    +    A V G+ L ++S + +    N ++  L+ ++I  YV
Sbjct: 94  ADIDKVMKRTAKRPLAREAVPTRNALVFGLLLGLASFLWLWWRANLLAGILVVITIAFYV 153

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT+ LKR T QN++ GG AG +P ++GWA+VTG +S   +V+FLIIF WTPPH W+LA
Sbjct: 154 LIYTMVLKRRTWQNVIWGGAAGCMPVLVGWAAVTGSLSWQPVVLFLIIFFWTPPHTWALA 213

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY+ A +PMLP + T+      IL Y+    +  ++  ++  + V Y  I    G
Sbjct: 214 MRYKEDYKAAGVPMLPVIATEEHVTKQILFYSWAMVVTTLV--LVPASGVIYAAITIVAG 271

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             F L A + +            +LFL+S  YL ++F  L VD ++ ++T+    
Sbjct: 272 AWFLLMAHQLYRSVRGGAQVKPLRLFLQSNNYLAIVFVGLAVDSVLGLQTISDML 326


>gi|15964659|ref|NP_385012.1| protoheme IX farnesyltransferase [Sinorhizobium meliloti 1021]
 gi|15073837|emb|CAC45478.1| Putative heme O synthase transmembrane protein [Sinorhizobium
           meliloti 1021]
          Length = 350

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 161/284 (56%), Positives = 204/284 (71%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+      +I  IA+GAGASGALNM+YDADI
Sbjct: 58  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPFIGFTAILCIAIGAGASGALNMWYDADI 117

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I P EA   G++L+  S++I+GLA++W++A LL  +IF YV IY
Sbjct: 118 DAVMSRTAKRPIPAGKILPQEALAFGLTLSAFSVIILGLAVHWLAAGLLAFTIFFYVAIY 177

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VTG VS+ S+V+FLIIFLWTP HFW+LAL  
Sbjct: 178 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTGGVSVESIVLFLIIFLWTPAHFWALALFK 237

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    +PM+PNV  + TTK  I+IY VLT++ GV PT+LGFAS+ YG     +G  F
Sbjct: 238 MGDYGAVGVPMMPNVCGEATTKRQIVIYAVLTAVSGVCPTLLGFASLGYGAFATVMGLGF 297

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++       E DK +   KKLF  SI YLF +F+ L+VD+ I
Sbjct: 298 VWYSLGVLRMPEGDKRMVPAKKLFAFSIAYLFAIFSALLVDYAI 341


>gi|209519822|ref|ZP_03268607.1| protoheme IX farnesyltransferase [Burkholderia sp. H160]
 gi|209499765|gb|EDZ99835.1| protoheme IX farnesyltransferase [Burkholderia sp. H160]
          Length = 301

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 164/286 (57%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ ++ L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRVSQYLALTKPRVTQLAVFCAVIGMFLSTPGMVPWTVLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +       L    +  +    N ++  L   +   Y
Sbjct: 72  EQQIDAKMRRTSWRPSARGEITTAQILTFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTLMPFISGMSGVVYLASAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L++DH 
Sbjct: 252 GAVFLAYAWKIYREYSDD---LARKTFRYSIVYLSLLFAALLIDHY 294


>gi|296115090|ref|ZP_06833732.1| protoheme IX farnesyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978427|gb|EFG85163.1| protoheme IX farnesyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 330

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 136/292 (46%), Positives = 188/292 (64%), Gaps = 6/292 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             + VLLKPRV+SL ++T   G+ +APGH++ + + ISI  I M +GA+GA+NM+YD DI
Sbjct: 39  RDWFVLLKPRVISLVVFTGAAGLAMAPGHLNPIIAAISILCICMASGAAGAINMWYDRDI 98

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA+RPIP G++ P E    G+ L+V+S+++M LA N ++A +L  SIF Y V+Y
Sbjct: 99  DAVMKRTATRPIPDGRMRPDEVLGFGIGLSVASVILMWLATNALAAGILAFSIFFYAVVY 158

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG +++  +VMF IIFLWTPPHFWSL+L  
Sbjct: 159 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGSLTVLPIVMFGIIFLWTPPHFWSLSLYA 218

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY +A IPMLP V   R T+  IL YT++   V ++P+ +  A   Y +    LG  F
Sbjct: 219 CKDYGRAGIPMLPVVKGARHTRWQILWYTIILMAVTLVPSAMHLAGWLYTVTATVLGAGF 278

Query: 249 TLWAWRTFLCKEDKDIRV------TKKLFLESITYLFVLFTILMVDHLIDMK 294
              A      ++D            +K F  S+ YLF+LF  ++ DH + M 
Sbjct: 279 IYRAIGVLRDRQDAQGVSESGDLPARKAFRYSLAYLFLLFCGMLADHFLIMH 330


>gi|295675373|ref|YP_003603897.1| protoheme IX farnesyltransferase [Burkholderia sp. CCGE1002]
 gi|295435216|gb|ADG14386.1| protoheme IX farnesyltransferase [Burkholderia sp. CCGE1002]
          Length = 301

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 166/286 (58%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ ++ L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRVSQYLALTKPRVTQLAVFCAVIGMFLSTPGMVPWTVLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQQIDAKMRRTSWRPSARGEITTPQILLFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTLMPFISGMSGVVYLASAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D+   + +K F  SI YL +LF  L++DH 
Sbjct: 252 GAVFLAYAWKIYREYSDE---LARKTFRYSIVYLSLLFAALLIDHY 294


>gi|187922561|ref|YP_001894203.1| protoheme IX farnesyltransferase [Burkholderia phytofirmans PsJN]
 gi|187713755|gb|ACD14979.1| protoheme IX farnesyltransferase [Burkholderia phytofirmans PsJN]
          Length = 301

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 165/286 (57%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRVSQYIALTKPRVTQLAVFCAVIGMFLSTPGMVPWTPLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKIDAKMRRTSWRPSARGEITTAQILLFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFISGMSGVVYLAAAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L++DH 
Sbjct: 252 GAVFLAYAWKIYREYSDD---LARKTFRYSIVYLSLLFAALLIDHY 294


>gi|262202302|ref|YP_003273510.1| protoheme IX farnesyltransferase [Gordonia bronchialis DSM 43247]
 gi|262085649|gb|ACY21617.1| protoheme IX farnesyltransferase [Gordonia bronchialis DSM 43247]
          Length = 335

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 164/294 (55%), Gaps = 3/294 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +I L KPRV+ L +      ++ A  GH+ +L    ++    +GA ++  LNM  DA
Sbjct: 44  ILAYIALTKPRVIELLLVATIPVMLQADRGHVDLLVIACTLVGGWLGAASANTLNMVVDA 103

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RTA RP+    ++P  A V G+ L  +S  ++ +A N +SA L+  +I  YV 
Sbjct: 104 DIDQKMKRTARRPLARRAVAPRSALVFGIVLWAASFAVLTVAANLLSALLVSATIVFYVG 163

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QN+V GG AG +P ++GWA+VTG +S   +V+F +IF WTPPH W+LA+
Sbjct: 164 VYTMILKRRTWQNVVWGGAAGCMPTLVGWAAVTGSLSWEPVVLFGVIFFWTPPHTWALAM 223

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY+ A +PMLP + T+      ++IYT LT +  ++  ++   S  Y  +    G 
Sbjct: 224 RYKEDYKAAGVPMLPVIATEERVTRQMVIYTWLTVVCSLI--LVPATSWIYAAVAVLAGA 281

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
            F       +            K+FL+S  YL VLF  L VD +I + T+   F
Sbjct: 282 WFASRVHILYRDTRRGAEVAPLKIFLQSNEYLAVLFCGLAVDAVIGLPTIASLF 335


>gi|288958071|ref|YP_003448412.1| protoheme IX farnesyltransferase [Azospirillum sp. B510]
 gi|288910379|dbj|BAI71868.1| protoheme IX farnesyltransferase [Azospirillum sp. B510]
          Length = 303

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 144/283 (50%), Positives = 194/283 (68%), Gaps = 3/283 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            FI LLKPRVMSL ++T   GIVLAPGH+    +V+++  IA+GAGASGA+NM+YD DID
Sbjct: 20  DFIELLKPRVMSLVVFTGLAGIVLAPGHLHPFLAVVAVLCIAVGAGASGAINMWYDRDID 79

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M+RT  RPIP G++ P EA   GV+L+V S+V+MGLA+NW +A+LL ++I  YV +YT
Sbjct: 80  AVMSRTVKRPIPSGRVEPAEALGFGVTLSVLSVVVMGLAVNWAAASLLALTIGFYVFVYT 139

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGWA+VTG +   S+++FL+IFLWTPPHFW+LAL   
Sbjct: 140 MWLKRRTPQNIVIGGAAGAFPPMIGWAAVTGTIDPPSVLLFLLIFLWTPPHFWALALFRN 199

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY +A +PM+P V     TK  +L+YT++   V   P  +G A   Y  +   LG  F 
Sbjct: 200 GDYTRAGVPMMPVVAGAAATKRQMLVYTLILLPVAAAPFFVGIAGPVYLAVSAILGLMFV 259

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
             A R     +D      +++F  SI YLF+LF ++M + LI+
Sbjct: 260 GCAVRVLRADDDGP---ARRMFGFSILYLFLLFAVMMGERLIN 299


>gi|296160435|ref|ZP_06843252.1| protoheme IX farnesyltransferase [Burkholderia sp. Ch1-1]
 gi|295889416|gb|EFG69217.1| protoheme IX farnesyltransferase [Burkholderia sp. Ch1-1]
          Length = 301

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 165/286 (57%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRVSQYIALTKPRVTQLAVFCAVIGMFLSTPGMVPWTPLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKIDAKMRRTSWRPSARGEITTAQILLFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFISGMSGVVYLAAAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L++DH 
Sbjct: 252 GAVFLAYAWKIYREYSDD---LARKTFRYSIVYLSLLFAALLIDHY 294


>gi|222085120|ref|YP_002543650.1| protoheme IX farnesyltransferase [Agrobacterium radiobacter K84]
 gi|254765929|sp|B9JAP1|COXX_AGRRK RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|221722568|gb|ACM25724.1| protoheme IX farnesyltransferase [Agrobacterium radiobacter K84]
          Length = 319

 Score =  171 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 156/284 (54%), Positives = 206/284 (72%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+ +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 24  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPVLGLIAILCIAVGAGASGALNMWYDADI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA RPIP G+++P EA   G+ L+  S+ I+GLA+NW+SA +L  +IF Y V+Y
Sbjct: 84  DAIMTRTAKRPIPAGRVAPSEALAFGLVLSGFSVTILGLAVNWLSAAILAFTIFFYAVVY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PP+IGWA VTG+V+I S+V+FLIIFLWTP HFW+LAL  
Sbjct: 144 TMWLKRSTPQNIVIGGAAGAFPPVIGWACVTGNVTIESVVLFLIIFLWTPAHFWALALFK 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV    TTK  I+ Y VLT+I+GV+P+ +GFAS+ YG++   LG  F
Sbjct: 204 MGDYEAVGVPMLPNVAGVPTTKNQIVAYAVLTAIIGVVPSFMGFASLGYGVVATVLGVIF 263

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHLI 291
              +   +   +    +   KKLF  SI YLF +F+ L++D L+
Sbjct: 264 VHCSISVWRMPDGDVKMVPAKKLFAFSIFYLFAIFSALLIDRLV 307


>gi|218676151|ref|YP_002394970.1| Protoheme IX farnesyltransferase [Vibrio splendidus LGP32]
 gi|218324419|emb|CAV25826.1| Protoheme IX farnesyltransferase [Vibrio splendidus LGP32]
          Length = 324

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 168/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA P  + + +++  +  I + AG++ A N   D 
Sbjct: 42  WKIYLTLTKPKVVALMLLTALVGMCLAVPNGLPLQQTLFGMIGIGLMAGSAAAFNHLIDK 101

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  M RT  RP+P G++S    +     + +   V + + +N ++A L F S+  Y V
Sbjct: 102 KIDGQMTRTNRRPLPSGELSSARVFSFAAGIGLLGFVTLVVWVNQLTAWLTFASLLGYAV 161

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVI GIAGA+PP++GW +VT ++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 162 IYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTNELHSNAWLLVMIIFIWTPPHFWALAI 221

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +D+Y K +IPMLP       TK  IL+YT+L SIV +LP ++G +S  Y      L  
Sbjct: 222 HRRDEYAKVNIPMLPVTHGIEYTKTSILLYTLLLSIVCILPVLVGMSSWIYLSASLVLNG 281

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW     K   +  +  K F  SI +L +LF  L+ DH +
Sbjct: 282 GFVYHAWVL---KYRDEPNIAMKTFKFSIYHLMILFVALLADHYL 323


>gi|111223964|ref|YP_714758.1| protoheme IX farnesyltransferase [Frankia alni ACN14a]
 gi|111151496|emb|CAJ63214.2| putative protoheme IX farnesyltransferase [Frankia alni ACN14a]
          Length = 314

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 101/286 (35%), Positives = 156/286 (54%), Gaps = 1/286 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  ++ L+K RV+ L + T    ++LA  G  S+    +++ A  + AG++  +N Y D
Sbjct: 29  KIRAYVALMKLRVVELLLITTVPVMMLADRGMPSLWLIAVTLVAGTLAAGSANTINCYVD 88

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT  RP+    ++P EA   G+ + + S ++ GL +NW SA L   +I  YV
Sbjct: 89  RDIDQVMGRTKRRPLVRATVTPTEALTFGIVIGIVSTLMFGLLVNWPSALLADGAIAFYV 148

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +YT+ LKR TP NIVIGG AG  P +IGW++VTG V  +++++F ++F WTPPHFW+LA
Sbjct: 149 FVYTLGLKRRTPSNIVIGGAAGCFPVLIGWSAVTGTVGWSAVLLFAVVFFWTPPHFWALA 208

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  +DDY  A IPMLP V         I+ Y+       +    +      Y +    +G
Sbjct: 209 MKFRDDYAAAGIPMLPVVAPVEVVTRRIVGYSYAMVAASLALVPVAHTGPVYLVSAVVVG 268

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F   A R        D     +LF  SITYL +LF  + V  ++
Sbjct: 269 AWFLAEAHRIDRRTRRGDDPRPMRLFHMSITYLTLLFVAIAVTAVV 314


>gi|332709336|ref|ZP_08429298.1| protoheme IX farnesyltransferase [Lyngbya majuscula 3L]
 gi|332351882|gb|EGJ31460.1| protoheme IX farnesyltransferase [Lyngbya majuscula 3L]
          Length = 332

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 116/285 (40%), Positives = 170/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T   G+ LA  G +  +  ++++    + A ++  LN  YD 
Sbjct: 17  IQSYYQLTKPRIIPLLLITTAAGMWLASDGQVDPILLLVTLVGGTLAAASAQVLNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RPIP G++ P +A +  ++LA+ S  ++ +  N +SA L    I  Y++
Sbjct: 77  DIDYEMLRTRHRPIPSGKVQPRDALLFAIALAILSFTLLTVFANLLSALLALSGIIFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT  LKR T QNIVIGG AGAIP ++GWA+VTG++S A  ++F+I+FLWTPPHFW+LAL
Sbjct: 137 IYTHILKRHTAQNIVIGGAAGAIPALVGWAAVTGELSWAPWLLFIIVFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           +  +DY K  IPMLP V  +  T   I  YT+L     +L     G + V YGI+   LG
Sbjct: 197 MIHEDYAKVGIPMLPVVAGEEVTVRQIWYYTLLVVPTSLLLIYPLGESGVVYGIVAILLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW   L +E KD ++ + +F  SI Y+ +L T ++VD L
Sbjct: 257 SIFIKKAW--LLLQEPKDNQLARSMFKYSILYMMLLCTGIVVDSL 299


>gi|54025542|ref|YP_119784.1| protoheme IX farnesyltransferase [Nocardia farcinica IFM 10152]
 gi|81374339|sp|Q5YTS1|COXX_NOCFA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|54017050|dbj|BAD58420.1| putative protoheme IX farnesyltransferase [Nocardia farcinica IFM
           10152]
          Length = 311

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 111/297 (37%), Positives = 168/297 (56%), Gaps = 3/297 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           + R+  +I L KPRV+ L +      ++LA  GHI +   + ++F   MGA ++  LN  
Sbjct: 16  MRRVLAYIALTKPRVIELLLVATIPTMLLADRGHIDIRLILATLFGGWMGAASANTLNCV 75

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            DADIDK+M RTA RP+    +    A+V GV L ++S   +    N +S  L+  +I  
Sbjct: 76  ADADIDKVMKRTAKRPLARDAVPTRNAFVFGVVLGLASFAWLWWQANLLSGALVVATILF 135

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+ LKR T QN+V GG AG +P ++GW++VTG +   +L +F +IF WTPPH W+
Sbjct: 136 YVFVYTLGLKRRTSQNVVWGGAAGCMPALVGWSAVTGTIGWPALALFGVIFFWTPPHTWA 195

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K+DY+ A +PMLP V T+RT    I+IYT LT +  +   ++    V Y  +   
Sbjct: 196 LAMRYKEDYRAAGVPMLPVVATERTVTKQIVIYTWLTVLTTLA--LVPATGVIYAAVALV 253

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
            G  F L A + +      +     +LFL+S  YL V+F  L VD ++   T+  +F
Sbjct: 254 AGAWFLLMAHQLYAGVRRGESVKPLRLFLQSNNYLAVVFCGLAVDSVLGWDTIGSFF 310


>gi|317507847|ref|ZP_07965548.1| protoheme IX farnesyltransferase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316253889|gb|EFV13258.1| protoheme IX farnesyltransferase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 317

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 104/298 (34%), Positives = 161/298 (54%), Gaps = 3/298 (1%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNM 62
            +  +  ++ L KPRV+ L +      ++LA  G + +   + ++F   +GA ++  LN 
Sbjct: 21  SLSLVRDYLALTKPRVIELLLVATIPVMLLAHRGTVDLKLILATLFGGWLGAASANTLNC 80

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             DADIDK+M RT +RP+  G +S   A V G+ L ++S V +    N +SA L+  +I 
Sbjct: 81  VVDADIDKVMDRTKNRPLARGAMSVRAALVFGLCLGLASFVWLWRVANLLSAALVVATIA 140

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            YV++Y+++LKR T QN+V GG AG +P ++GWA+VTG +   +LV+F++IF WTPPH W
Sbjct: 141 FYVLVYSMYLKRRTSQNVVWGGAAGCMPALVGWAAVTGSLDWPALVVFMVIFFWTPPHTW 200

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           SLA+  ++DY  A +PMLP V  +R     ++ YT  T    +L  ++  A   Y  +  
Sbjct: 201 SLAMKYREDYSAAGVPMLPTVADERLVARRMVWYTWATVATTLL--LIPVAGPLYAGVAT 258

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             G  F   A R              +LFL+S  YL  +F  L VD  +   TV    
Sbjct: 259 LAGAWFLYEAHRLSAGLASGRPVTPFRLFLQSNNYLAAVFVGLAVDSALAWPTVSSLL 316


>gi|85707976|ref|ZP_01039042.1| protoheme IX farnesyltransferase [Erythrobacter sp. NAP1]
 gi|85689510|gb|EAQ29513.1| protoheme IX farnesyltransferase [Erythrobacter sp. NAP1]
          Length = 322

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 132/286 (46%), Positives = 184/286 (64%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  L KPRVM+L I+TA  G++ APG I  +    ++ AIAMGAG S ALN +++AD
Sbjct: 25  WRDFFTLTKPRVMTLVIFTAICGLLAAPGSIHPVLGFTAVLAIAMGAGGSAALNHWWEAD 84

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           +D  M RTA+RP+P G++   +A   G+ L+  S+ +MG+AI W++A LLF +I  Y VI
Sbjct: 85  LDAGMKRTANRPLPGGRMRREDARDFGIFLSAVSVFVMGVAIGWLAAGLLFAAIIYYAVI 144

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLK  TPQNIVIGG +GA PP+IGW +VTG+++   +++F IIF+WTPPHFW+LAL 
Sbjct: 145 YTMWLKPRTPQNIVIGGGSGAFPPLIGWVAVTGELTAMPILLFAIIFMWTPPHFWALALF 204

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY    IPM+P V  +R T+  IL YTVL + V + P ++G  S  YG     L   
Sbjct: 205 VKTDYANVGIPMMPVVKGERHTRHQILAYTVLLAPVAIAPWLIGGTSWVYGSFAVALSIL 264

Query: 248 FTLWAWR--TFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   AW       +E +D++   +LF  SI YLF+LF  L+ D ++
Sbjct: 265 FFALAWPVGLRNRQEGEDMKPEIRLFKFSIYYLFILFAALVADRVL 310


>gi|145224275|ref|YP_001134953.1| protoheme IX farnesyltransferase [Mycobacterium gilvum PYR-GCK]
 gi|315444607|ref|YP_004077486.1| protoheme IX farnesyltransferase [Mycobacterium sp. Spyr1]
 gi|205693456|sp|A4TC38|COXX_MYCGI RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|145216761|gb|ABP46165.1| protoheme IX farnesyltransferase [Mycobacterium gilvum PYR-GCK]
 gi|315262910|gb|ADT99651.1| protoheme IX farnesyltransferase [Mycobacterium sp. Spyr1]
          Length = 313

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 108/292 (36%), Positives = 161/292 (55%), Gaps = 3/292 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL  +I L KPRV+ L + T    ++LA  G +  L  + ++    + A  +  LN   
Sbjct: 21  TRLMGYIGLTKPRVIELLLVTTIPAMLLADRGTVDPLLIINTLVGGLLAAAGANTLNCVA 80

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           DADIDK M RT  R +    +    A + G++L+V+S   +    N +SA L   +I  Y
Sbjct: 81  DADIDKKMKRTERRALARATVPRSHALIFGLTLSVASFFWLWSTTNMLSAHLAGATIAFY 140

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V++YT+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMFLIIF WTPPH W+L
Sbjct: 141 VLVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFLIIFFWTPPHTWAL 200

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  K+DY+ A +PMLP V T++     IL+YT LT +  +   +       Y  +    
Sbjct: 201 AMRYKEDYEAAGVPMLPVVATEQQVTKQILVYTWLTVLATLALAL--TTGWLYASVAILA 258

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           G  F + A + +   +  +     +LFL+S  YL V+F  L VD  + + T+
Sbjct: 259 GTWFLVMAHQLYAGVKRGEAVKPLRLFLQSNNYLAVVFVALAVDSALALPTL 310


>gi|325292152|ref|YP_004278016.1| protoheme IX farnesyltransferase [Agrobacterium sp. H13-3]
 gi|325060005|gb|ADY63696.1| protoheme IX farnesyltransferase [Agrobacterium sp. H13-3]
          Length = 317

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 153/283 (54%), Positives = 201/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+ +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 23  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPVLGLIAILCIAVGAGASGALNMWYDADI 82

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+++P EA   G++L+  S+VI+GLA+NW SA LL  +IF Y V+Y
Sbjct: 83  DAVMSRTAKRPIPSGRVAPGEALAFGLTLSAFSVVILGLAVNWFSAGLLAFTIFFYAVVY 142

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPM+GWA VTG VS+ S+++FLIIFLWTP HFW+LAL  
Sbjct: 143 TMWLKRSTPQNIVIGGAAGAFPPMLGWACVTGGVSLDSVILFLIIFLWTPAHFWALALFK 202

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    IPM+PNV  +R+TK  +++Y+VLT+ V V P   G AS+ YGI    L   F
Sbjct: 203 MRDYGSVGIPMMPNVAGERSTKNQMIVYSVLTAAVAVAPYFTGLASLGYGIFAAVLSAIF 262

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHL 290
              +       + D+ +   KK+F  S+ YLF +F+ L+ DH 
Sbjct: 263 VYCSLDVRRMPDGDEKMLPAKKMFAYSVLYLFAIFSGLLADHF 305


>gi|307941665|ref|ZP_07657020.1| protoheme IX farnesyltransferase [Roseibium sp. TrichSKD4]
 gi|307775273|gb|EFO34479.1| protoheme IX farnesyltransferase [Roseibium sp. TrichSKD4]
          Length = 339

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 147/283 (51%), Positives = 202/283 (71%), Gaps = 1/283 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +I LLKPRVMSL I+TAFVG++LAPG +  + + +++  IA+GAGASGALNM+YDADID
Sbjct: 52  DYIALLKPRVMSLVIFTAFVGMMLAPGSVHPVIAAVAVLCIAVGAGASGALNMWYDADID 111

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           ++M+RTA RPIP G+++P EA   G++L++ S++ +GL +NW +   L  +IF Y V+YT
Sbjct: 112 RIMSRTAKRPIPAGKVTPDEALAFGITLSIGSVLTLGLLVNWFAGAFLAFTIFFYAVVYT 171

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGW +VTGDVS+ S V+FLIIF+WTPPHFW+LAL  K
Sbjct: 172 MWLKRSTPQNIVIGGAAGAFPPMIGWTAVTGDVSLESFVLFLIIFMWTPPHFWALALFKK 231

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY+ A +PM+P    +  T+ +IL Y VL + +GV P  LG+ASV YG++   LG  F 
Sbjct: 232 GDYETAGVPMMPVTAGETVTRHNILAYAVLLAPIGVAPYFLGYASVIYGVMAAGLGLAFV 291

Query: 250 LWAWRTFLCKEDKDIRVTK-KLFLESITYLFVLFTILMVDHLI 291
             ++  +  +E         +LF  S+ YLF+LF  L+ + LI
Sbjct: 292 WLSYDVWRKREGDAAHAASVRLFKFSLYYLFLLFAGLLTESLI 334


>gi|291299921|ref|YP_003511199.1| protoheme IX farnesyltransferase [Stackebrandtia nassauensis DSM
           44728]
 gi|290569141|gb|ADD42106.1| protoheme IX farnesyltransferase [Stackebrandtia nassauensis DSM
           44728]
          Length = 341

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 159/289 (55%), Gaps = 6/289 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-----GHISVLKSVISIFAIAMGAGASGALNM 62
           L  ++ L KPR++ L + T    ++LA      G   V   V  +   A+ AG++ ALN 
Sbjct: 53  LKAYVALTKPRIVELLLITTVPAMLLAARKATGGLPEVWTVVAVVIGGALAAGSANALNC 112

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           + D DID++M RT+ RP+P   +SP  A V G+ L V S+  +GL  N ++A L   +I 
Sbjct: 113 FLDRDIDQLMRRTSRRPLPQHTVSPRSALVFGLVLGVVSVTAIGLVTNLLAAGLTLAAIA 172

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y +IYT+WLKR T  N V GG+ GA P +IGWA+VTG +S  + ++F ++F W PPHFW
Sbjct: 173 YYDLIYTLWLKRTTAANTVWGGVCGAAPVLIGWAAVTGGLSWEAWILFAVVFFWQPPHFW 232

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LA+  KDDY  A IPMLP V + R   +  +IY  LT +V  L       +  YGI+  
Sbjct: 233 ALAVKYKDDYAAAGIPMLPVVASARRVGLESVIYAWLT-LVSSLALWPLATTPLYGIVAA 291

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             G  F + A R        +     +LF  S +YL +LF  L VD  +
Sbjct: 292 ATGLMFCVEAHRMHGRARRDEDLKPMRLFHWSTSYLTLLFVALAVDSFL 340


>gi|120403705|ref|YP_953534.1| protoheme IX farnesyltransferase [Mycobacterium vanbaalenii PYR-1]
 gi|182639209|sp|A1T8M8|COXX_MYCVP RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|119956523|gb|ABM13528.1| protoheme IX farnesyltransferase [Mycobacterium vanbaalenii PYR-1]
          Length = 313

 Score =  169 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 110/294 (37%), Positives = 157/294 (53%), Gaps = 3/294 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  +I L KPRV+ L + T    ++LA  G +  L  + ++    + A  +  LN   D
Sbjct: 22  RVLGYIGLTKPRVIELLLVTTIPAMLLADRGTVDPLLILNTLVGGLLAAAGANTLNCVAD 81

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADIDK M RT  R +    +    A + G++L+V S   +    N +SA L   +I  YV
Sbjct: 82  ADIDKKMKRTERRALARATVPRSHALIFGLALSVLSFFWLWWTTNMLSAHLAGATIAFYV 141

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMFLIIF WTPPH W+LA
Sbjct: 142 LIYTLVLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFLIIFFWTPPHTWALA 201

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY+ A +PMLP V T+R     ILIYT LT    +   +       Y  +    G
Sbjct: 202 MRYKEDYEAAGVPMLPVVATERQVTKQILIYTWLTVAATLALAL--ATGWLYAAVAIVAG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERY 299
             F   A + +      +     +LFL+S  YL V+F  L VD  + + T+   
Sbjct: 260 TWFLAMAHQLYAGVRRGEPVKPLRLFLQSNNYLAVVFCALAVDSALALPTLFSV 313


>gi|302525916|ref|ZP_07278258.1| protoheme IX farnesyltransferase [Streptomyces sp. AA4]
 gi|302434811|gb|EFL06627.1| protoheme IX farnesyltransferase [Streptomyces sp. AA4]
          Length = 324

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 100/289 (34%), Positives = 149/289 (51%), Gaps = 3/289 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDADI 68
            +  L KPRV+ L + T    + LA   +      V ++    M AG++ ALN   D+DI
Sbjct: 35  AYAALAKPRVIELLLVTTIPAMFLAGREVPNPWLVVATLIGGTMAAGSANALNCVIDSDI 94

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RT  RP+    +    A + G+ L ++S  ++   +N ++A L   +I  Y+ +Y
Sbjct: 95  DKVMNRTKRRPLVKDAVPRRNALIFGLVLGLASFAVLYFTVNLLAAVLAIATILFYIFVY 154

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P +IGW +VTG V   + VMF +IF WTPPH W+L +  
Sbjct: 155 TLGLKRRTSQNVVWGGAAGCMPVLIGWVAVTGTVQWPAFVMFGVIFFWTPPHTWALGMKY 214

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           +DDY++A +PMLP V T       I+IY+ +     +L  +L   S  Y       G  F
Sbjct: 215 RDDYERAGVPMLPVVATAEHVARQIVIYSWVMVAWTLL--LLPVTSWLYATFAILAGGWF 272

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             +A R        +      LF  S TYL ++F  L VD  I +  + 
Sbjct: 273 LFYAHRLQAAVHRGEETKPMALFHRSNTYLMIVFVALAVDSAIGLPVLG 321


>gi|254471703|ref|ZP_05085104.1| protoheme IX farnesyltransferase [Pseudovibrio sp. JE062]
 gi|211958905|gb|EEA94104.1| protoheme IX farnesyltransferase [Pseudovibrio sp. JE062]
          Length = 310

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 146/287 (50%), Positives = 203/287 (70%), Gaps = 1/287 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ +I LLKPRVMSL ++TA VG+V+APG+     S ISI  IA+G GASGALNM++DAD
Sbjct: 23  VSDYIALLKPRVMSLVVFTAAVGLVMAPGNQHPFLSFISILCIAIGGGASGALNMWWDAD 82

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RT  RPIP G+I+  EA+  G+ L+  S++ +GL  NWV+A LL  +IF YVVI
Sbjct: 83  IDAVMSRTKKRPIPAGKITREEAFAFGMVLSFGSVLTLGLVANWVAAGLLAFTIFFYVVI 142

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA+PPM+GWA+VTGDV++ S+ +F+I F WTPPHFW+LAL+
Sbjct: 143 YTMWLKRSTPQNIVIGGAAGALPPMVGWAAVTGDVTLVSIALFMITFTWTPPHFWALALV 202

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DYQ+A +PMLP V  +  T+  I++Y++L   VG+ P  LGFAS  +G+    LG  
Sbjct: 203 KNGDYQEAGVPMLPVVAGETATRHQIVLYSLLLLPVGMSPYFLGFASAFFGVGSAILGLV 262

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +A R +  +E D   +    LF  S+ YL ++F  L+ +++I +
Sbjct: 263 FLGYAIRVWKVREGDAAKKAAMSLFKFSLFYLMLIFAGLLAENMIGL 309


>gi|307728359|ref|YP_003905583.1| protoheme IX farnesyltransferase [Burkholderia sp. CCGE1003]
 gi|307582894|gb|ADN56292.1| protoheme IX farnesyltransferase [Burkholderia sp. CCGE1003]
          Length = 301

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 4/289 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRMSQYIALTKPRVTQLAVFCAVIGMFLSTPGMVPWTVLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKIDAKMRRTSWRPSARGEITTAQILLFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYEDAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFISGMSGVVYLAAAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           G  F  +AW+ +L   D    + ++ F  SI YL +LF  L+VDH + +
Sbjct: 252 GAVFLAYAWKIYLEYSDD---LARRTFRYSIVYLSLLFAALLVDHYVRV 297


>gi|323524649|ref|YP_004226802.1| protoheme IX farnesyltransferase [Burkholderia sp. CCGE1001]
 gi|323381651|gb|ADX53742.1| protoheme IX farnesyltransferase [Burkholderia sp. CCGE1001]
          Length = 301

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 168/289 (58%), Gaps = 4/289 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRMSQYIALTKPRVTQLAVFCAVIGMFLSTPGMVPWTVLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKIDAKMRRTSWRPSARGEITTAQILLFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFISGMSGVVYLAAAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           G  F  +AW+ +L   D    + ++ F  SI YL +LF  L++DH + +
Sbjct: 252 GAVFLAYAWKIYLEYSDD---LARRTFRYSIVYLSLLFAALLIDHYVRV 297


>gi|294628721|ref|ZP_06707281.1| protoheme IX farnesyltransferase [Streptomyces sp. e14]
 gi|292832054|gb|EFF90403.1| protoheme IX farnesyltransferase [Streptomyces sp. e14]
          Length = 326

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 107/289 (37%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D
Sbjct: 37  RVKAFVALTKPRIIELLLITTVPVMFLAQQGVPDLKLVLLTCLGGYLSAGGANALNMYID 96

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G++LAV S ++ G  +NW+SA L   ++  YV
Sbjct: 97  RDIDALMDRTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGYTVNWLSAWLSLGALLFYV 156

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  +S A +V+FL++F WTPPH+W L+
Sbjct: 157 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWSAVTNSMSWAPVVLFLVMFFWTPPHYWPLS 216

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP + +++     I+IY+ +   V +L T LG+    Y ++    G
Sbjct: 217 MKVKEDYARVGVPMLPVIASNKVVARQIVIYSWVMVAVSLLLTPLGYTGWFYTVVALAAG 276

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 277 GFWLWEAHGLQNRAKAEVTGAKLKEMRLFHWSITYVSILFVAVAVDPFL 325


>gi|311113556|ref|YP_003984778.1| protoheme IX farnesyltransferase [Rothia dentocariosa ATCC 17931]
 gi|310945050|gb|ADP41344.1| protoheme IX farnesyltransferase [Rothia dentocariosa ATCC 17931]
          Length = 359

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 103/298 (34%), Positives = 160/298 (53%), Gaps = 3/298 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGI-VLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +L  +I L KP+++ L + T    +   A G  S    + ++   AM AGAS A N Y D
Sbjct: 62  KLKAYIHLTKPQIIELLLVTTAPTMMFAAHGMPSFWLVINTLLGGAMAAGASCAFNCYID 121

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID+ M RT  RP+  G+++  EA V   +LAV S+V +   +N +S  L   +I  YV
Sbjct: 122 RDIDRKMKRTEKRPLVTGELTDREALVFAWALAVISVVYLWTMVNPLSGLLGLAAILLYV 181

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V Y+++LK+ T QNIV GGIAG +P +I WA+V   +   +L++F +IFLWTPPH+W L+
Sbjct: 182 VFYSMYLKKRTTQNIVWGGIAGCMPVLIAWAAVRNTIEWPALILFTVIFLWTPPHYWPLS 241

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PML  +   +T  + +++Y     I  +L   +G A   YG+     G
Sbjct: 242 MKYAEDYKAAGVPMLGAIAPAQTVSVQVVLYGWAMVICSLLLIPIGGAGWVYGVSAATAG 301

Query: 246 YHFTLWAWRTFL--CKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYFF 301
             F     +      ++    R    +F  SITYL +LF  L +D  +    +E + F
Sbjct: 302 AWFLYHCHKLHYLALQQVATSRTAMVVFFGSITYLTILFIALAIDPFVGQPILESFIF 359


>gi|284053074|ref|ZP_06383284.1| protoheme IX farnesyltransferase [Arthrospira platensis str.
           Paraca]
 gi|291571289|dbj|BAI93561.1| heme O synthase [Arthrospira platensis NIES-39]
          Length = 324

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 114/285 (40%), Positives = 172/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  +  L KPR++ L + T   G+ LA  G +  L  ++++    + +GA+  +N  YD+
Sbjct: 20  LKSYYQLTKPRIILLLLITTAAGMWLAAEGEVDPLLLLVTMVGGTLASGAANTINCLYDS 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P +A +  ++LA++S  ++ +  N ++A L    I  YV 
Sbjct: 80  DIDYIMERTRWRPIPSGRVKPRDAMIFAIALAIASFTLLTVFANLLAALLAMSGIVFYVA 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIPP++GWA+VTGD+S A++++F+IIFLWTPPHFW+LA+
Sbjct: 140 IYTHWLKRHSTQNIVIGGAAGAIPPLVGWAAVTGDLSWAAVLLFVIIFLWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + +D+YQ   +PMLP +  D  T   I +Y+++     +L       +   YG I   LG
Sbjct: 200 MIRDEYQDVGVPMLPVIEGDELTAQQIWVYSLILIPTSLLLVYPLHTSGWVYGAIALVLG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW       ++D  V + LF  SI YL +L   ++VD L
Sbjct: 260 AIFLQKAWELLQTPHNRD--VARSLFKYSILYLMLLCAGMVVDSL 302


>gi|311742569|ref|ZP_07716378.1| protoheme IX farnesyltransferase [Aeromicrobium marinum DSM 15272]
 gi|311314197|gb|EFQ84105.1| protoheme IX farnesyltransferase [Aeromicrobium marinum DSM 15272]
          Length = 312

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 157/287 (54%), Gaps = 4/287 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L+KPR++ L + T    + LA  G   +   V +I    + AG++ ALN   DADI
Sbjct: 26  SYVALMKPRIIELLLLTTVPVMFLAAQGVPPLWLVVATIVGGTLSAGSANALNCVVDADI 85

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M RTA RP+P  Q++   A + G+ L V S + +GL +NW+SA L   +   YVV Y
Sbjct: 86  DTKMRRTARRPLPRHQVTTRRALIFGLVLGVVSTLWLGLLVNWLSAALALTANVFYVVGY 145

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QNIV GG AG  P +IGW +VT +++ A +V+FL++F WTPPHFWSLA+  
Sbjct: 146 TMILKRRTSQNIVWGGAAGCFPALIGWTAVTNELAWAPVVLFLVVFFWTPPHFWSLAMRY 205

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           ++DY  AS+PMLP+V T R     I+IY+ +     +    +      Y  +   LG  F
Sbjct: 206 REDYSAASVPMLPSVTTSREVGRQIVIYSYVMVATSLALWPVAGTGWFYPAVATVLGIVF 265

Query: 249 TLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLID 292
            + A       +D     I    +LF  S  YL +LF    VD  I 
Sbjct: 266 LVEAHDLSSRAKDTEDLSIIKPMRLFHFSNAYLALLFVAAAVDPFIG 312


>gi|154251127|ref|YP_001411951.1| protoheme IX farnesyltransferase [Parvibaculum lavamentivorans
           DS-1]
 gi|205693487|sp|A7HQW1|COXX_PARL1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|154155077|gb|ABS62294.1| protoheme IX farnesyltransferase [Parvibaculum lavamentivorans
           DS-1]
          Length = 318

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 147/286 (51%), Positives = 198/286 (69%), Gaps = 1/286 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             F  LLKPRVMSL I+TA VGI +APG I  + +  ++  IA+GAGASGALNM+YDADI
Sbjct: 24  RDFFELLKPRVMSLVIFTALVGIAVAPGGIHPVIAFTALLCIAVGAGASGALNMWYDADI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  MARTA+RPIP G+++  EA V G  L+V +++ MG+ +NWV+A LL  +IF Y+V+Y
Sbjct: 84  DARMARTANRPIPAGRVTAREAAVFGSILSVFAVMTMGVLVNWVAAALLAFTIFFYLVVY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+VTG VSI   V+FLIIF+WTPPHFW+LAL  
Sbjct: 144 TMWLKRRTPQNIVIGGAAGAFPPMIGWAAVTGSVSIEPFVLFLIIFMWTPPHFWALALYR 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+K  +PMLP V  ++ T+  I++Y++    V +LP  LGFA   Y      LG  F
Sbjct: 204 SGDYEKVGVPMLPVVSGEKETRRQIMLYSLALVPVTLLPGFLGFAGALYMGATAALGAGF 263

Query: 249 TLWAWRTFLCKEDKD-IRVTKKLFLESITYLFVLFTILMVDHLIDM 293
              A+  +  +      +  K+LF  SI YLF++F++L+V+ ++ +
Sbjct: 264 LWLAFGIWRTEPGAAQDKAAKRLFGYSILYLFLIFSLLLVEKMLGL 309


>gi|118471528|ref|YP_887420.1| protoheme IX farnesyltransferase [Mycobacterium smegmatis str. MC2
           155]
 gi|182639210|sp|A0QWY2|COXX_MYCS2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|118172815|gb|ABK73711.1| protoheme IX farnesyltransferase [Mycobacterium smegmatis str. MC2
           155]
          Length = 308

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 162/288 (56%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + T    ++LA  G +  L  + ++    + A  +  LN   DADI
Sbjct: 22  AYLALTKPRVIELLLVTTIPAMLLADRGTVDPLLILNTLVGGMLAAAGANTLNCVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A + G+ L V+S   + L+ N +S  L   +I  YV +Y
Sbjct: 82  DKVMKRTARRPLARATVPTRHALIFGLVLTVTSFCWLWLSTNLLSGLLAVATIAFYVFVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMFLIIF WTPPH W+LA+  
Sbjct: 142 TMLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFLIIFFWTPPHTWALAMRY 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     ILIYT LT +  ++  +       YG +    G  F
Sbjct: 202 KDDYKAAGVPMLPAVATERQVTRQILIYTWLTVLTTLVLALA--TGWLYGAVALLAGAWF 259

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            + A + +   +  +     +LFL+S  YL V+F  L +D  + + T+
Sbjct: 260 LVMAHQLYSGVKRGEPVKPLRLFLQSNNYLAVVFCALAIDSALALPTL 307


>gi|312797382|ref|YP_004030304.1| Protoheme IX farnesyltransferase [Burkholderia rhizoxinica HKI 454]
 gi|312169157|emb|CBW76160.1| Protoheme IX farnesyltransferase (EC 2.5.1.-) [Burkholderia
           rhizoxinica HKI 454]
          Length = 323

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 160/287 (55%), Gaps = 4/287 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R+  +  L KPRV  LA++ A +G+ L+ PG +   K V     I + AGA+ A+N   
Sbjct: 34  SRIAQYFALTKPRVTQLAVFCAVIGMFLSTPGMVPWQKLVGGTIGIWLFAGAAFAINCLV 93

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RTA RP   G+I+P +       L    +  +    N ++  L F +   Y
Sbjct: 94  EQRIDARMRRTAWRPSARGEITPAQILTFSAVLGGLGMWTLYTFTNALTMWLTFATFIGY 153

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+V G V   + ++ LIIF+WTPPHFW+L
Sbjct: 154 AVIYTMLLKPATPQNIVIGGASGAMPPALGWAAVQGAVPGDAWILVLIIFVWTPPHFWAL 213

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP     R T +HIL+YT++   V ++P +   + V Y      L
Sbjct: 214 ALYRRQDYESAKLPMLPVTHGVRFTALHILLYTLVLFAVTLMPFVSDMSGVLYLASAVVL 273

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           G  F  + W+ +    D    + +K F  SI YL +LF  L++DH +
Sbjct: 274 GVLFLSYVWKMY---RDYSDEIARKTFRYSIVYLSLLFVALLIDHYV 317


>gi|304393503|ref|ZP_07375431.1| protoheme IX farnesyltransferase [Ahrensia sp. R2A130]
 gi|303294510|gb|EFL88882.1| protoheme IX farnesyltransferase [Ahrensia sp. R2A130]
          Length = 319

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 138/294 (46%), Positives = 201/294 (68%), Gaps = 2/294 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
           + +I L+KPRVM L ++TA  G++ APG I  + S+I+I  IA+GAGASGALNM+YDADI
Sbjct: 23  SDYIALMKPRVMRLVVFTALCGMLAAPGSIDPVLSIIAIICIAVGAGASGALNMWYDADI 82

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RT  RPIP G ++P EA   G+ L++ S++++G+ +NW+SA +L  +IF Y VIY
Sbjct: 83  DAIMSRTTKRPIPAGNVTPEEARNFGLILSIISVLVLGMLVNWISAAILAFTIFFYAVIY 142

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPM+GWA+V+GD++   +V+F IIF+WTPPHFW+LAL  
Sbjct: 143 TMWLKRSTPQNIVIGGAAGAFPPMLGWATVSGDLAWGGVVLFAIIFIWTPPHFWALALWK 202

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY  A +PM+PN V + +T+  +L Y+ +   + +LP ++GFA + +G++   L  +F
Sbjct: 203 MRDYDDAHVPMMPNAVGEASTRNQMLAYSAVLLPITILPAVMGFAGIAFGVVAVGLSGYF 262

Query: 249 TLWAWRTFLCK-EDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYFF 301
               ++ +     D+ +R  K LF  SI YLF LF  L VD ++  +    Y  
Sbjct: 263 LWLTYKVWKIAGADEKLRAEKHLFGYSIAYLFALFAALAVDAIV-WRATGDYIL 315


>gi|146284482|ref|YP_001174635.1| protoheme IX farnesyltransferase [Pseudomonas stutzeri A1501]
 gi|182639532|sp|A4VS42|CYOE_PSEU5 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|145572687|gb|ABP81793.1| protoheme IX farnesyltransferase [Pseudomonas stutzeri A1501]
 gi|327482870|gb|AEA86180.1| protoheme IX farnesyltransferase [Pseudomonas stutzeri DSM 4166]
          Length = 299

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 159/289 (55%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     +     IA+ AG + A+N   D 
Sbjct: 14  WRDYLELTKPKVVLLMLITSLVGMFLATRAGVPWTVLLFGNLGIALCAGGAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A      L VS + ++    N ++A L   S+  Y V
Sbjct: 74  QIDSVMARTHKRPLAEGRVSPAAALTFAFVLGVSGLALLLTFTNALAAWLTLASLIGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW +VTG V+   L++ LIIF WTPPHFW+LA+
Sbjct: 134 IYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGQVTAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KD+Y K ++PMLP       TK+HIL+YT +   V  +P  +  +   Y      LG 
Sbjct: 194 HRKDEYAKVNVPMLPVTHGVHYTKVHILLYTAMLLAVSFMPFAIHMSGPLYLAAAVLLGA 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            F  W    +    D       K F  SI YLF LF  L+VDH + +  
Sbjct: 254 RFLYWTIALY---RDSRPHAAIKTFKFSIWYLFALFIALLVDHYLLLDF 299


>gi|86144411|ref|ZP_01062743.1| protoheme IX farnesyltransferase [Vibrio sp. MED222]
 gi|85837310|gb|EAQ55422.1| protoheme IX farnesyltransferase [Vibrio sp. MED222]
          Length = 324

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA P  + + ++V  +  I + AG++ A N   D 
Sbjct: 42  WKIYLTLTKPKVVALMLLTALVGMCLAVPNGLPLQQTVFGMIGIGLMAGSAAAFNHLIDK 101

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  M RT  RP+P G++S    +     + +     + + +N ++A L F S+  Y V
Sbjct: 102 KIDGQMTRTNRRPLPSGELSSVRVFSFAAGIGLLGFATLMVWVNQLTAWLTFASLLGYAV 161

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVI GIAGA+PP++GW +VT ++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 162 IYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTNELHSNAWLLVMIIFIWTPPHFWALAI 221

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +D+Y K +IPMLP       TK  IL+YT+L SIV VLP ++G +S  Y      L  
Sbjct: 222 HRRDEYAKVNIPMLPVTHGIEYTKTSILLYTLLLSIVCVLPVLVGMSSWIYLSASLVLNG 281

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW     K   +  +  K F  SI +L +LF  L+ DH +
Sbjct: 282 GFVYHAWVL---KYRDEPNMAMKTFKFSIYHLMILFVALLADHYL 323


>gi|77456299|ref|YP_345804.1| protoheme IX farnesyltransferase [Pseudomonas fluorescens Pf0-1]
 gi|77380302|gb|ABA71815.1| putative protoheme IX farnesyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 296

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 116/287 (40%), Positives = 162/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     V     IA+ AG + A+N   D 
Sbjct: 11  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALCAGGAAAVNHVVDR 70

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    + LA+    ++    N ++A L   S+  Y V
Sbjct: 71  RIDAVMARTHKRPLADGRVSPTGALTFALVLALLGQALLLTFTNPLTAWLTLASLLGYAV 130

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW + TG VS   L++ LIIF WTPPHFW+LA+
Sbjct: 131 IYTGFLKRATPQNIVIGGLAGAAPPLLGWTAATGHVSAEPLLLVLIIFAWTPPHFWALAI 190

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT     V +LP ++  + + Y I    LG 
Sbjct: 191 HRKEEYAKADIPMLPVTHGEHYTKVHILLYTFALLAVSLLPYVIHMSGLLYLICALGLGA 250

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WA   +              F  SI YLF+LF  L+VDH + +
Sbjct: 251 RFLQWAVVLYRGTR---PHAAINTFKYSIWYLFLLFIALLVDHYLLL 294


>gi|148272915|ref|YP_001222476.1| protoheme IX farnesyltransferase [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|182639199|sp|A5CRS6|COXX_CLAM3 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|147830845|emb|CAN01789.1| putative protoheme IX farnesyltransferase [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 306

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 160/288 (55%), Gaps = 1/288 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   ++ L KPRV+ L + T    ++LA  G  +    +  +    + AG++ A N Y D
Sbjct: 19  KTKAYVALTKPRVIELLLVTTAPVMILAQGGWPNPWLILGVLVGGTLSAGSANAFNCYID 78

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT  RP+  G+++  EA V    + V+SIV +G+  NW++A L   +I  YV
Sbjct: 79  RDIDRVMKRTQRRPLVTGELTDREALVFAWIIGVASIVWLGVISNWLAAALSLAAILFYV 138

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +YT+WLKR TPQNIV GG AG +P +IGWA+VTGD+S A +++F+I+FLWTPPH+W L+
Sbjct: 139 FVYTLWLKRRTPQNIVWGGAAGCMPVLIGWAAVTGDISWAPVILFMIVFLWTPPHYWPLS 198

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  +DDY   ++PML  V       +  ++Y   T    +L   +    + Y +     G
Sbjct: 199 MKYRDDYASVNVPMLAVVRGRAAVGLQTILYAWATLACSLLLIPVAGMGLVYTLAALAGG 258

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F     R +      +     ++F  SI+YL +LF  + +D L+  
Sbjct: 259 GWFVYETHRLYDLAVRHEPIKPMRVFHASISYLSLLFLAVGIDPLLPF 306


>gi|170782337|ref|YP_001710670.1| protoheme IX farnesyltransferase [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|205693221|sp|B0REI2|COXX_CLAMS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|169156906|emb|CAQ02074.1| putative cytochrome oxidase assembly factor [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 306

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 161/288 (55%), Gaps = 1/288 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   ++ L KPRV+ L + T    ++LA  G  +    +  +    + AG++ A N Y D
Sbjct: 19  KTKAYVALTKPRVIELLLVTTAPVMILAQGGWPNPWLILGVLVGGTLSAGSANAFNCYID 78

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT  RP+  G+++  EA V    + V+SI+ +G+  NW++A L   +I  YV
Sbjct: 79  RDIDRVMKRTQRRPLVTGELTDREALVFAWIIGVASIIWLGVISNWLAAALSLAAILFYV 138

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +YT+WLKR TPQNIV GG AG +P +IGWA+VTGD+S A +++F+I+FLWTPPH+W L+
Sbjct: 139 FVYTLWLKRRTPQNIVWGGAAGCMPVLIGWAAVTGDISWAPVILFMIVFLWTPPHYWPLS 198

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  +DDY   ++PML  V       +  ++Y+  T    +L   +    + Y +     G
Sbjct: 199 MKYRDDYASVNVPMLAVVRGRAAVGLQTILYSWATLACSLLLIPVAGMGLVYTLAALAGG 258

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F     R +      +     ++F  SI+YL +LF  + +D L+  
Sbjct: 259 GWFVYETHRLYDLAVRHEPIKPMRVFHASISYLSLLFLAVGIDPLLPF 306


>gi|330993423|ref|ZP_08317358.1| Protoheme IX farnesyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329759453|gb|EGG75962.1| Protoheme IX farnesyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 319

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 135/287 (47%), Positives = 186/287 (64%), Gaps = 6/287 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++ LLKPRV+SL ++T   G+ +APG ++ L + +SI  I M +GA+GA+NM+YD DI
Sbjct: 28  RDWLALLKPRVISLVVFTGAAGLAMAPGPLNPLVAAVSILCICMASGAAGAINMWYDRDI 87

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT +RPIP G+I P  A   G+ L+V+S+++M LA N ++A +L  SIF Y VIY
Sbjct: 88  DAVMKRTVTRPIPDGRIRPEAALGYGIGLSVASVILMWLATNALAAGILAFSIFFYAVIY 147

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG +++  +VMF IIFLWTPPHFWSL+L  
Sbjct: 148 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGSMAVMPVVMFGIIFLWTPPHFWSLSLYA 207

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY +A IPMLP V   R T+  IL YT++ + V ++P+ L  A   Y  +   LG  F
Sbjct: 208 CKDYGRAGIPMLPVVRGARHTRWQILWYTIILTAVSLVPSFLHLAGWLYTGVASVLGAGF 267

Query: 249 TLWAWRTFLCKEDKD------IRVTKKLFLESITYLFVLFTILMVDH 289
              A +    ++D +          ++ F  S+ YLF LF  L+ DH
Sbjct: 268 IYCAIQVLRDRQDANGVSLTGDGAARRSFRYSLAYLFFLFCGLLADH 314


>gi|238060124|ref|ZP_04604833.1| protoheme IX farnesyltransferase [Micromonospora sp. ATCC 39149]
 gi|237881935|gb|EEP70763.1| protoheme IX farnesyltransferase [Micromonospora sp. ATCC 39149]
          Length = 319

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 103/285 (36%), Positives = 154/285 (54%), Gaps = 2/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    ++LA G   S+    + +   ++ AGA+  LN Y D 
Sbjct: 36  VSAYVALTKPRIVELLLVTTVPAMMLAEGGLPSLWLMAVVLVGGSLAAGAASVLNCYIDR 95

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+P   +SP  A V G+ LA  S+ ++ L  N ++A L   +I  Y +
Sbjct: 96  DIDQLMRRTKRRPLPTHTVSPRNALVFGLVLAAVSVTLLALFTNMLAAGLTLAAIAYYDL 155

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR TPQN   GG  GA P +IGWA+VTG ++ A+  +F ++F W  PHF+ LA+
Sbjct: 156 VYTLWLKRTTPQNTFWGGACGAAPVLIGWAAVTGSLAPAAWALFAVVFFWQMPHFYPLAM 215

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY +A IPMLP V + R     I+ +  LT +  +    LG  S  YG+     G 
Sbjct: 216 KYKADYARAGIPMLPVVASSRRVNAEIIGFAWLTLLSSLAVWPLGM-SAIYGVTALLAGG 274

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   A +              +LF  S  YL +LF  + VD L+
Sbjct: 275 VFVYEAHKLCRQVARGGAVRPMRLFHWSYVYLTILFAAVAVDALV 319


>gi|167901156|ref|ZP_02488361.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei NCTC
           13177]
          Length = 300

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTIGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID +M RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAVMRRTAWRPSARGEITTLQILAFSTVLGGLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GALFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|70733581|ref|YP_257221.1| protoheme IX farnesyltransferase [Pseudomonas fluorescens Pf-5]
 gi|123658904|sp|Q4KKL2|CYOE1_PSEF5 RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|68347880|gb|AAY95486.1| protoheme IX farnesyltransferase [Pseudomonas fluorescens Pf-5]
          Length = 300

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 115/287 (40%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     V     IA+ AG + A+N   D 
Sbjct: 15  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALCAGGAAAVNHVVDR 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    + LA++   ++    N ++A L   S+  Y V
Sbjct: 75  RIDALMARTHKRPLAEGRVSPRAALAFALLLALAGQALLLTFTNPLTAWLTLASLLGYAV 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW + TG +S   L++ LIIF WTPPHFW+LA+
Sbjct: 135 VYTGFLKRATPQNIVIGGLAGAAPPLLGWVAATGHMSAEPLLLVLIIFAWTPPHFWALAI 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT     V +LP ++  + V Y +    LG 
Sbjct: 195 HRKEEYAKADIPMLPVTHGEHYTKVHILLYTFALLAVSLLPYVIHMSGVLYLVCALALGG 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +              F  SI YLF+LF  L+VDH + +
Sbjct: 255 RFLQWAWVLYRGTR---PHAAINTFKYSIYYLFLLFIALLVDHYLLL 298


>gi|323360098|ref|YP_004226494.1| polyprenyltransferase [Microbacterium testaceum StLB037]
 gi|323276469|dbj|BAJ76614.1| polyprenyltransferase [Microbacterium testaceum StLB037]
          Length = 308

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 100/287 (34%), Positives = 156/287 (54%), Gaps = 1/287 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L + T    ++LA G   ++     ++   ++ AG++ A NMY D 
Sbjct: 22  VRAYVALTKPRVLELLLVTTVPVMILAQGGLPNLWLIFATVIGGSLSAGSAAAFNMYLDR 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RP+  G++SP  A +   +LAV S V +    N ++A L   +IF YVV
Sbjct: 82  DIDAHMQRTENRPLVTGEVSPRGALIFAWTLAVFSTVWLWAFTNPLAAGLSAAAIFFYVV 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LKR T QNIV GGIAG  P +IGW++VTG ++ A L++F ++FLWTPPH+W L++
Sbjct: 142 IYTMILKRRTEQNIVWGGIAGCFPVLIGWSAVTGSLTWAPLILFALVFLWTPPHYWPLSM 201

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              D Y +  +PML    +     + +++Y   T    +L   +    + Y +     G 
Sbjct: 202 KYADQYDEVDVPMLGATRSGSQVGLQVILYAWATVACSLLLIPVASMGLVYTVSALVFGG 261

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   + R +            ++F  SITYL +LF  + VD L+  
Sbjct: 262 WFIYESHRLYSRAVRGGEPRPMRVFHASITYLTLLFVAIAVDPLLPF 308


>gi|169629842|ref|YP_001703491.1| protoheme IX farnesyltransferase [Mycobacterium abscessus ATCC
           19977]
 gi|238688898|sp|B1MC66|COXX_MYCA9 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|169241809|emb|CAM62837.1| Probable cytochrome c oxidase assembly factor CtaB [Mycobacterium
           abscessus]
          Length = 313

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 161/293 (54%), Gaps = 3/293 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +I L KPRV+ L + T    ++LA  G ++ L  + ++    M A ++  LN   DA
Sbjct: 23  ILAYIALTKPRVIELLLVTTIPAMLLADRGDVNPLLILNTLLGGVMAAASANTLNCVADA 82

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DIDK+M RTA RP+ +  ++   A + GV L V +   +    N +S  L   +I  YV 
Sbjct: 83  DIDKVMKRTARRPLAMSSVTTRNALIFGVVLGVGAFAWLWWTANLLSGLLAVATIAFYVF 142

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QN+V GG AG +P MIGW++VT  +   +LVMF +IF WTPPH W+LA+
Sbjct: 143 VYTLVLKRRTAQNVVWGGAAGCMPVMIGWSAVTNTIQWPALVMFAVIFFWTPPHTWALAM 202

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY+ A +PMLP + T+      IL+YT LT +  +   +   A V Y ++ F  G 
Sbjct: 203 RYKEDYRAAGVPMLPVIATEEKVTKLILVYTWLTVLSTLALAL--AAGVIYAVVAFLAGV 260

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERY 299
            F   A + +            +LFL+S  YL V+F  L VD ++   T+ + 
Sbjct: 261 WFLAMAHQLYSGVRKGQPIRPLRLFLQSNNYLAVVFCALAVDSVVGWPTLFQL 313


>gi|182639260|sp|Q0RH20|COXX_FRAAA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 289

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 156/289 (53%), Gaps = 1/289 (0%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNM 62
              ++  ++ L+K RV+ L + T    ++LA  G  S+    +++ A  + AG++  +N 
Sbjct: 1   MNAKIRAYVALMKLRVVELLLITTVPVMMLADRGMPSLWLIAVTLVAGTLAAGSANTINC 60

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           Y D DID++M RT  RP+    ++P EA   G+ + + S ++ GL +NW SA L   +I 
Sbjct: 61  YVDRDIDQVMGRTKRRPLVRATVTPTEALTFGIVIGIVSTLMFGLLVNWPSALLADGAIA 120

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            YV +YT+ LKR TP NIVIGG AG  P +IGW++VTG V  +++++F ++F WTPPHFW
Sbjct: 121 FYVFVYTLGLKRRTPSNIVIGGAAGCFPVLIGWSAVTGTVGWSAVLLFAVVFFWTPPHFW 180

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LA+  +DDY  A IPMLP V         I+ Y+       +    +      Y +   
Sbjct: 181 ALAMKFRDDYAAAGIPMLPVVAPVEVVTRRIVGYSYAMVAASLALVPVAHTGPVYLVSAV 240

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +G  F   A R        D     +LF  SITYL +LF  + V  ++
Sbjct: 241 VVGAWFLAEAHRIDRRTRRGDDPRPMRLFHMSITYLTLLFVAIAVTAVV 289


>gi|187479750|ref|YP_787775.1| protoheme IX farnesyltransferase [Bordetella avium 197N]
 gi|123513618|sp|Q2KTX0|COXX_BORA1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|115424337|emb|CAJ50890.1| protoheme IX farnesyltransferase (heme O synthase) [Bordetella
           avium 197N]
          Length = 298

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 165/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++VL KPRV  LA++ A +G+ LA PG   + + +     I + A A+ A+N   + 
Sbjct: 12  LRQYLVLTKPRVTQLAVFCAVIGMFLAVPGLPDLKRVLFGTIGIWLLAAAAFAINCLIEQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  M RTA R    G ISP +   L   L  + ++++   +N ++  L F +   Y V
Sbjct: 72  EIDARMTRTARRGTARGTISPAQVLSLSGLLGGAGMLVLYHLVNPLTMWLTFATFVGYAV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWASV   V   + V+ LIIF+WTPPHFW+LAL
Sbjct: 132 IYTVILKPRTPQNIVIGGLSGAMPPALGWASVANAVPAEAWVLVLIIFIWTPPHFWALAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              +DY+KA +PMLP     + T++ I++Y+     V +LP  +    + Y +    LG 
Sbjct: 192 YRTEDYRKAGLPMLPITHGSKHTRLQIMLYSFALFAVTLLPYFMHMNGLLYLLAAVILGG 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A R +    D+    +++LF  SI YL +LF  L+VDH + +
Sbjct: 252 IFVAHALRLYRSYSDE---RSRRLFRYSILYLALLFGALLVDHWVGV 295


>gi|118590728|ref|ZP_01548129.1| protoheme IX farnesyltransferase [Stappia aggregata IAM 12614]
 gi|118436704|gb|EAV43344.1| protoheme IX farnesyltransferase [Stappia aggregata IAM 12614]
          Length = 332

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 153/285 (53%), Positives = 204/285 (71%), Gaps = 1/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ ++ LLKPRVMSL I+TAFVG++LAPG +  +  V++I  IA+GAGASGALNM+YDAD
Sbjct: 45  VSDYVALLKPRVMSLVIFTAFVGLMLAPGTVHPVLGVVAILCIAIGAGASGALNMWYDAD 104

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT  RPIP G+++  EA   GV+L++ S+V++GL +NW +   L  +IF YV++
Sbjct: 105 IDEVMTRTRKRPIPAGKVTRDEALAFGVTLSIGSVVLLGLLVNWFAGAFLAFTIFFYVIV 164

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PPMIGWA+VTG VS+ S V+FLIIF+WTPPHFW+LAL+
Sbjct: 165 YTMWLKRSTPQNIVIGGAAGAFPPMIGWAAVTGSVSLESFVLFLIIFMWTPPHFWALALV 224

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DYQ A IPMLP V  +  T+ HIL Y VL + +GV P +LGFAS  YG+    L   
Sbjct: 225 KNGDYQAAKIPMLPVVAGETATRHHILAYAVLLAPIGVAPYLLGFASPVYGVASAVLSAI 284

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   ++  +  +E D       +LF  SI YLF+LF +L+ + LI
Sbjct: 285 FVGLSFDVWRKREGDPAKAACWRLFKFSIFYLFMLFALLLGESLI 329


>gi|182641988|sp|Q3KK91|CYOE1_PSEPF RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
          Length = 299

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 116/287 (40%), Positives = 162/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     V     IA+ AG + A+N   D 
Sbjct: 14  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALCAGGAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    + LA+    ++    N ++A L   S+  Y V
Sbjct: 74  RIDAVMARTHKRPLADGRVSPTGALTFALVLALLGQALLLTFTNPLTAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW + TG VS   L++ LIIF WTPPHFW+LA+
Sbjct: 134 IYTGFLKRATPQNIVIGGLAGAAPPLLGWTAATGHVSAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT     V +LP ++  + + Y I    LG 
Sbjct: 194 HRKEEYAKADIPMLPVTHGEHYTKVHILLYTFALLAVSLLPYVIHMSGLLYLICALGLGA 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WA   +              F  SI YLF+LF  L+VDH + +
Sbjct: 254 RFLQWAVVLYRGTR---PHAAINTFKYSIWYLFLLFIALLVDHYLLL 297


>gi|159038856|ref|YP_001538109.1| protoheme IX farnesyltransferase [Salinispora arenicola CNS-205]
 gi|205693564|sp|A8LW09|COXX_SALAI RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|157917691|gb|ABV99118.1| protoheme IX farnesyltransferase [Salinispora arenicola CNS-205]
          Length = 317

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 102/285 (35%), Positives = 156/285 (54%), Gaps = 2/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    ++LA G    +    + +   ++ AGA+  LN Y D 
Sbjct: 34  VAAYVALTKPRIVELLLVTTVPAMMLAHGGLPPLWLVAVVLVGGSLAAGAASVLNCYIDR 93

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+P   +SP  A + G+ LA  S+ ++ +  N ++A L   +I  Y +
Sbjct: 94  DIDQVMRRTKRRPLPTHTVSPRNALIFGLVLATVSVTLLAVFTNALAAGLTLGAILYYDL 153

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR T  N   GG  GA P +IGWA+VTG ++ A+  +F ++F W  PHF+ LA+
Sbjct: 154 IYTAWLKRTTTANTFWGGACGAAPVLIGWAAVTGSLAPAAWALFGVVFFWQMPHFYPLAM 213

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY +A IPMLP V + R     IL++  LT +V ++   LG     YG+    +G 
Sbjct: 214 KYKDDYARAGIPMLPVVASTRRVNAEILVFAWLTVLVSLVAWPLG-LGPVYGLPTLVVGA 272

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F + A +        +     +LF  S TYL V+F  + +D LI
Sbjct: 273 VFLIEAHKLCRRASRGEAVKPMRLFHWSTTYLTVVFAAVALDALI 317


>gi|167561417|ref|ZP_02354333.1| protoheme IX farnesyltransferase [Burkholderia oklahomensis EO147]
 gi|167568644|ref|ZP_02361518.1| protoheme IX farnesyltransferase [Burkholderia oklahomensis C6786]
          Length = 300

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 113/286 (39%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKALLGGTIGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  V    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTAQILVFSTVLGGLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAIFLAYAWKIY---RDYSDALARKAFRYSIVYLSLLFAALLVDHY 293


>gi|254775771|ref|ZP_05217287.1| protoheme IX farnesyltransferase [Mycobacterium avium subsp. avium
           ATCC 25291]
          Length = 308

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 157/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G ++ L  V ++    + AG + ALN   DADI
Sbjct: 22  AYLALTKPRVIELLLVTAIPAMLLAQRGTVNPLLIVNTLIGGMLAAGGANALNCVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A V G+ L   S + +    N +S  L   +I  YV +Y
Sbjct: 82  DKVMKRTARRPLARAAVPTRNALVFGLVLTAGSFLWLWWTTNLLSGLLALATIAFYVFVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMF IIF WTPPH W+LA+  
Sbjct: 142 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFAIIFFWTPPHTWALAMRY 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     IL+YT LT +  +   +       Y  +    G  F
Sbjct: 202 KDDYKAAGVPMLPAVATERQVTKQILVYTWLTVLATLALAL--ATGWLYAAVALVAGVWF 259

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL V+F  L +D  I +  +
Sbjct: 260 LAMAHQLYAGVRAGEPVKPLRLFLQSNNYLAVVFCALAIDSAIGLPHL 307


>gi|153007928|ref|YP_001369143.1| protoheme IX farnesyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151559816|gb|ABS13314.1| protoheme IX farnesyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 315

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 148/284 (52%), Positives = 206/284 (72%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+V+APGH++ + + ISI  +A+GAGASGALNM+YDADI
Sbjct: 22  RDYLVLLKPRVMSLVVFTGLVGLVVAPGHMNPVLAAISILCVAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT +RPIP G I+P +    G++L+  S+V +GL +NW+SA LL  +IF Y V+Y
Sbjct: 82  DAVMKRTRNRPIPAGIIAPNQVLAFGLTLSAFSVVTLGLMVNWLSAALLAFTIFFYAVVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  S+V+F+IIFLWTPPHFW+L+L  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSVVLFMIIFLWTPPHFWALSLFS 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y+++ + VGVLP +LGFA   YG I   LG  F
Sbjct: 202 ANDYEAARIPMMPNVKGELSTRRQALFYSIIMAPVGVLPWVLGFAGPVYGAISTLLGLAF 261

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHLI 291
             +AWR ++     ++    +KLF  S+ YL  LF +L+V+ L+
Sbjct: 262 VYYAWRMWVAGSQPEMLAAARKLFRFSLLYLSGLFAVLLVEALV 305


>gi|83721561|ref|YP_440993.1| protoheme IX farnesyltransferase [Burkholderia thailandensis E264]
 gi|167579711|ref|ZP_02372585.1| protoheme IX farnesyltransferase [Burkholderia thailandensis TXDOH]
 gi|167617787|ref|ZP_02386418.1| protoheme IX farnesyltransferase [Burkholderia thailandensis Bt4]
 gi|257140352|ref|ZP_05588614.1| protoheme IX farnesyltransferase [Burkholderia thailandensis E264]
 gi|123538088|sp|Q2T1F6|COXX_BURTA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|83655386|gb|ABC39449.1| protoheme IX farnesyltransferase [Burkholderia thailandensis E264]
          Length = 300

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTVGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTLQILAFSTVLGGLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GAIFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|167892663|ref|ZP_02480065.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 7894]
 gi|167917406|ref|ZP_02504497.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei BCC215]
          Length = 300

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTIGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTLQILAFSTVLGGVGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GALFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|15888112|ref|NP_353793.1| protoheme IX farnesyltransferase [Agrobacterium tumefaciens str.
           C58]
 gi|182637471|sp|A9CJX3|COXX_AGRT5 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|15155744|gb|AAK86578.1| protoheme IX farnesyltransferase [Agrobacterium tumefaciens str.
           C58]
          Length = 317

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 153/283 (54%), Positives = 197/283 (69%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPG I+ +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 23  RDYFELLKPRVMSLVVFTAFAGLVLAPGEINPILGLIAILCIAVGAGASGALNMWYDADI 82

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA RPIP G+I+P EA   G++L+  S+VI+GLA+NW SA LL  +IF Y V+Y
Sbjct: 83  DAVMTRTAKRPIPSGRIAPREALAFGLTLSAFSVVILGLAVNWFSAGLLAFTIFFYAVVY 142

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPM+GWA VTG VS+ S+++FLIIFLWTP HFW+LAL  
Sbjct: 143 TMWLKRSTPQNIVIGGAAGAFPPMLGWACVTGGVSLDSVILFLIIFLWTPAHFWALALFK 202

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    IPM+PNV  +R+TK  +++Y VLT+   V P   G AS  YGI    L   F
Sbjct: 203 MRDYGAVGIPMMPNVAGERSTKNQMIVYAVLTAAAAVAPFFTGLASAGYGIFAAVLSAIF 262

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHL 290
              ++      E D+ +   KK+F  S+ YLF +F+ L+ DH 
Sbjct: 263 VYCSFDVRRMPEGDEKMLPAKKMFAYSVLYLFAIFSGLLADHF 305


>gi|86356600|ref|YP_468492.1| protoheme IX farnesyltransferase [Rhizobium etli CFN 42]
 gi|123512800|sp|Q2KBM1|COXX_RHIEC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|86280702|gb|ABC89765.1| protoheme IX farnesyltransferase protein [Rhizobium etli CFN 42]
          Length = 316

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 161/283 (56%), Positives = 202/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+ +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPVLGLIAILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I+P EA   G+ L+  S+VI+GLA+NW+SA +L  +IF Y VIY
Sbjct: 82  DAIMSRTAKRPIPAGRIAPSEALAFGLVLSGFSVVILGLAVNWLSAAILAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VT  V+I S V+FLIIFLWTP HFW+LAL  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIESTVLFLIIFLWTPAHFWALALFK 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV  +R TK  I+ Y VLT+I  VLP+ LGFAS  YG++   LG  F
Sbjct: 202 MRDYEAVGVPMLPNVSGERVTKHQIVAYAVLTAICAVLPSFLGFASFGYGLVAAALGAIF 261

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHL 290
              +   +   +    +   KKLF  SI YLF +F+ LM+D L
Sbjct: 262 VYCSIAVWRMPDGDLKMIPAKKLFAFSIFYLFAVFSALMIDRL 304


>gi|182639253|sp|A6WWG0|COXX_OCHA4 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 312

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 148/284 (52%), Positives = 206/284 (72%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+V+APGH++ + + ISI  +A+GAGASGALNM+YDADI
Sbjct: 19  RDYLVLLKPRVMSLVVFTGLVGLVVAPGHMNPVLAAISILCVAVGAGASGALNMWYDADI 78

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT +RPIP G I+P +    G++L+  S+V +GL +NW+SA LL  +IF Y V+Y
Sbjct: 79  DAVMKRTRNRPIPAGIIAPNQVLAFGLTLSAFSVVTLGLMVNWLSAALLAFTIFFYAVVY 138

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  S+V+F+IIFLWTPPHFW+L+L  
Sbjct: 139 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSVVLFMIIFLWTPPHFWALSLFS 198

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y+++ + VGVLP +LGFA   YG I   LG  F
Sbjct: 199 ANDYEAARIPMMPNVKGELSTRRQALFYSIIMAPVGVLPWVLGFAGPVYGAISTLLGLAF 258

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHLI 291
             +AWR ++     ++    +KLF  S+ YL  LF +L+V+ L+
Sbjct: 259 VYYAWRMWVAGSQPEMLAAARKLFRFSLLYLSGLFAVLLVEALV 302


>gi|41407277|ref|NP_960113.1| protoheme IX farnesyltransferase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|81414489|sp|Q741B3|COXX_MYCPA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|41395629|gb|AAS03496.1| CtaB [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 308

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 157/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G ++ L  V ++    + AG + ALN   DADI
Sbjct: 22  AYLALTKPRVIELLLVTAIPAMLLAQRGTVNPLLIVNTLIGGMLAAGGANALNCVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A V G+ L   S + +    N +S  L   +I  YV IY
Sbjct: 82  DKVMKRTARRPLARAAVPTRNALVFGLVLTAGSFLWLWWTTNLLSGLLALATIAFYVFIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMF IIF WTPPH W+LA+  
Sbjct: 142 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFAIIFFWTPPHTWALAMRY 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     I++YT LT +  +   +       Y  +    G  F
Sbjct: 202 KDDYKAAGVPMLPAVATERQVTKQIVVYTWLTVLATLALAL--ATGWLYAAVALVAGVWF 259

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL V+F  L +D  I +  +
Sbjct: 260 LAMAHQLYAGVRAGEPVKPLRLFLQSNNYLAVVFCALAIDSAIGLPHL 307


>gi|309811771|ref|ZP_07705545.1| protoheme IX farnesyltransferase [Dermacoccus sp. Ellin185]
 gi|308434192|gb|EFP58050.1| protoheme IX farnesyltransferase [Dermacoccus sp. Ellin185]
          Length = 325

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 162/288 (56%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYD 65
           ++  ++ L KPR++ L + T F  + LA   +      V ++    + A ++  LN Y D
Sbjct: 31  KIGDYVALTKPRIIELLLVTTFPVMFLAERGVPEAWLIVATLVGGTLSASSANVLNCYLD 90

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+M RT  RP+  G I+P  A + G+ L V++ + +GL +NW+SA L   +I  YV
Sbjct: 91  RDIDKLMHRTEGRPLVTGAITPRAALIFGLVLGVAATLWLGLLVNWLSAWLSLGAIVLYV 150

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
             YTI LKR T QNIV GG+AG +P +IGW++VT  VS ++LV+FL++F WTPPH+W L+
Sbjct: 151 GFYTILLKRRTSQNIVWGGVAGCMPVLIGWSAVTNSVSWSALVLFLVVFFWTPPHYWPLS 210

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY  A +PMLP +  D T    I+ Y+ +T +  +    +      Y +I    G
Sbjct: 211 MRFKDDYANAGVPMLPVIAEDVTVGKQIVAYSWVTVLTSLALIPIAPMGWIYAVIAVVSG 270

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHL 290
             F L A       ++     +    +LF  SI+YL +LF  + +D +
Sbjct: 271 AVFLLEAHMLLKRAKEGAPYSVLKPMRLFHYSISYLTLLFIGVALDPI 318


>gi|330806758|ref|YP_004351220.1| protoheme IX farnesyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374866|gb|AEA66216.1| Putative protoheme IX farnesyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 299

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 114/287 (39%), Positives = 165/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     V     IA+ AG + A+N   D 
Sbjct: 14  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALCAGGAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    ++LAV    ++    N ++A L   S+  Y V
Sbjct: 74  RIDAVMARTHKRPLAEGRVSPAAALTFALALAVIGQALLLAFTNPLTAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW + TG VS   L++ LIIF WTPPHFW+LA+
Sbjct: 134 VYTGFLKRATPQNIVIGGLAGAAPPLLGWVAATGHVSAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT++   V ++P ++  + + Y +    LG 
Sbjct: 194 HRKEEYAKADIPMLPVTHGEHYTKIHILLYTLVLLAVSLMPFVIHMSGMLYLVCALVLGA 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WA   +              F  SI YLF+LF  L+VDH + +
Sbjct: 254 RFLQWAVVLYRGSR---PHAAINTFKYSIYYLFLLFIALLVDHYLLL 297


>gi|90019693|ref|YP_525520.1| protoheme IX farnesyltransferase [Saccharophagus degradans 2-40]
 gi|123278072|sp|Q21PS1|CYOE_SACD2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|89949293|gb|ABD79308.1| protoheme IX farnesyltransferase [Saccharophagus degradans 2-40]
          Length = 303

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 168/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP V++L + T+ +G++LA PG + +   ++    IA+ AG++ A+N   D 
Sbjct: 15  WRDYLELTKPNVVALMLLTSLIGMLLAVPGMVPIDILILGNLGIALCAGSAAAVNHLVDR 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            +D  MART +RPI  G+I P +A +    L ++ + I+ + +N ++A L   S+  Y  
Sbjct: 75  KVDLKMARTFNRPIAKGRIDPTKAILFAAILGLAGMAILMVWVNHLTAWLTLASLVGYAF 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR TPQNIVIGG+AGA PP++GW +VTG+V   +L++ LIIF WTPPHFW+LA+
Sbjct: 135 IYTFWLKRATPQNIVIGGLAGAAPPLLGWVAVTGEVHGHALLLVLIIFAWTPPHFWALAV 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y  A IPMLP    +  TK+ IL+YT +   V +LP      +  Y +    LG 
Sbjct: 195 HRKEEYANAKIPMLPVTHGEAYTKIQILLYTFILIAVTLLPYATHMLNELYLLGAVVLGI 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A        +K+       F  SI YL  LF ++++DH +
Sbjct: 255 GFLYYAVAMM---RNKNKNAGMDAFKYSIVYLMALFVVMLLDHYL 296


>gi|254784350|ref|YP_003071778.1| protoheme IX farnesyltransferase [Teredinibacter turnerae T7901]
 gi|259586082|sp|C5BKU5|CYOE_TERTT RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|237685808|gb|ACR13072.1| protoheme IX farnesyltransferase [Teredinibacter turnerae T7901]
          Length = 311

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 114/285 (40%), Positives = 164/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KP+V+ L + T+ +G++LA P    +   V+    I + AGA+ A+N   D 
Sbjct: 22  WRDYYELTKPKVVMLMLLTSLIGMLLATPSPAPLWLLVLGNLGIGLCAGAAAAVNHLVDR 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            +D  MART  RP+  G+I+P  A +    L    + I+   IN ++A L   S+  Y V
Sbjct: 82  HVDVKMARTFHRPVANGRITPTNALLFSALLGGVGLWILSSFINALTAWLTLASLLGYAV 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG+AGA PP++GW +VTG++    L++ LIIF WTPPHFW+LAL
Sbjct: 142 IYTLFLKRATPQNIVIGGLAGAAPPLLGWTAVTGELDGHGLLLVLIIFAWTPPHFWALAL 201

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K +Y KA IPMLP    D  T++HI++YTV+   V +LP         Y +    LG 
Sbjct: 202 YRKKEYAKAGIPMLPVTHGDSYTRLHIVLYTVILIAVTLLPFATRMMGYCYLVGALVLGA 261

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   A +  + K   D +   + F  SI YL  LF +++VDH +
Sbjct: 262 GFLYRALKLLVSK---DPKQGLETFKFSIIYLMALFVVMLVDHYL 303


>gi|53724509|ref|YP_104666.1| protoheme IX farnesyltransferase [Burkholderia mallei ATCC 23344]
 gi|67640717|ref|ZP_00439513.1| protoheme IX farnesyltransferase [Burkholderia mallei GB8 horse 4]
 gi|121598955|ref|YP_991511.1| protoheme IX farnesyltransferase [Burkholderia mallei SAVP1]
 gi|124384568|ref|YP_001027415.1| protoheme IX farnesyltransferase [Burkholderia mallei NCTC 10229]
 gi|126448220|ref|YP_001082380.1| protoheme IX farnesyltransferase [Burkholderia mallei NCTC 10247]
 gi|167001949|ref|ZP_02267739.1| protoheme IX farnesyltransferase [Burkholderia mallei PRL-20]
 gi|254174983|ref|ZP_04881644.1| protoheme IX farnesyltransferase [Burkholderia mallei ATCC 10399]
 gi|254201757|ref|ZP_04908121.1| protoheme IX farnesyltransferase [Burkholderia mallei FMH]
 gi|254207090|ref|ZP_04913441.1| protoheme IX farnesyltransferase [Burkholderia mallei JHU]
 gi|254357574|ref|ZP_04973848.1| protoheme IX farnesyltransferase [Burkholderia mallei 2002721280]
 gi|81603829|sp|Q62F61|COXX_BURMA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639193|sp|A3MQ44|COXX_BURM7 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639194|sp|A2S646|COXX_BURM9 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639195|sp|A1UZV8|COXX_BURMS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|52427932|gb|AAU48525.1| protoheme IX farnesyltransferase [Burkholderia mallei ATCC 23344]
 gi|121227765|gb|ABM50283.1| protoheme IX farnesyltransferase [Burkholderia mallei SAVP1]
 gi|124292588|gb|ABN01857.1| protoheme IX farnesyltransferase [Burkholderia mallei NCTC 10229]
 gi|126241090|gb|ABO04183.1| protoheme IX farnesyltransferase [Burkholderia mallei NCTC 10247]
 gi|147747651|gb|EDK54727.1| protoheme IX farnesyltransferase [Burkholderia mallei FMH]
 gi|147752632|gb|EDK59698.1| protoheme IX farnesyltransferase [Burkholderia mallei JHU]
 gi|148026638|gb|EDK84723.1| protoheme IX farnesyltransferase [Burkholderia mallei 2002721280]
 gi|160696028|gb|EDP85998.1| protoheme IX farnesyltransferase [Burkholderia mallei ATCC 10399]
 gi|238521487|gb|EEP84938.1| protoheme IX farnesyltransferase [Burkholderia mallei GB8 horse 4]
 gi|243062276|gb|EES44462.1| protoheme IX farnesyltransferase [Burkholderia mallei PRL-20]
          Length = 300

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTIGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTLQILAFSTVLGGLGAWTLYTFTNPLTIWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GALFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|171060498|ref|YP_001792847.1| protoheme IX farnesyltransferase [Leptothrix cholodnii SP-6]
 gi|205693517|sp|B1Y6Q4|COXX_LEPCP RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|170777943|gb|ACB36082.1| protoheme IX farnesyltransferase [Leptothrix cholodnii SP-6]
          Length = 305

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 168/287 (58%), Gaps = 7/287 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALNMY 63
              ++ L KPRV+ L ++ A +G++LA    PG   + K++ +   I + A A+ A N  
Sbjct: 15  WRQYVALTKPRVVQLIVFCAAIGMLLAVPGAPGLADLGKALWATLGIWLVASAAAAFNCL 74

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            +  ID  M RTA RP   G++S  +A +    L  + + ++  A+N ++A L   +   
Sbjct: 75  IEQQIDSRMKRTAWRPTARGELSRTQALIFSAVLCSAGMAVLHEAVNPLTAWLTLGTFVG 134

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y VIYT+ LK  TPQNIVIGGI+GA+PP++GWA++TG+V    L++ LIIFLWTPPHFW+
Sbjct: 135 YAVIYTVVLKPLTPQNIVIGGISGAMPPLLGWAAMTGEVGPEGLILCLIIFLWTPPHFWA 194

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL   +DY +A +PMLP    +  T++ IL+YT +     +LP + G +   Y    F 
Sbjct: 195 LALYRAEDYARAGLPMLPVTHGNEFTRLQILLYTFVLLAGTLLPFVQGMSGWLYLAAAFV 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           LG  F  +AWR +    +    + ++ F  SI +L +LF  L+VDH 
Sbjct: 255 LGLRFIHYAWRLW---RNYSEALARQTFRFSIWHLSLLFAALLVDHY 298


>gi|88856184|ref|ZP_01130844.1| protoheme IX farnesyltransferase [marine actinobacterium PHSC20C1]
 gi|88814503|gb|EAR24365.1| protoheme IX farnesyltransferase [marine actinobacterium PHSC20C1]
          Length = 306

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 163/290 (56%), Gaps = 1/290 (0%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMY 63
           + ++  ++ L KPRV+ L + T    +VLA   I  +   + ++    + A ++ A N Y
Sbjct: 17  LRKIRAYVALTKPRVIELLLVTTVPVMVLAANGIPNLWLVLATLIGGILSASSANAFNCY 76

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D DID++MART +RP+  G+++  EA V      + S+V + +  NW++A L   +I  
Sbjct: 77  IDRDIDRVMARTKNRPLVTGELTDREALVFAWLSGIGSVVWLAIFTNWLAAALSLFAILF 136

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+ LKR TPQNI+ GGIAG +P +IGWA+VTGD+S A+ V+F ++FLWTPPH+W 
Sbjct: 137 YVFVYTLLLKRRTPQNIIWGGIAGCMPVLIGWAAVTGDLSWAAWVLFAVVFLWTPPHYWP 196

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           L++  + +YQ   +PML  V       + +++Y   T +  +L   +    V Y ++   
Sbjct: 197 LSMKYRAEYQSVGVPMLAVVRGRAAVGLQVVLYAWATVVCSLLLVPIAGMGVVYTVVAAA 256

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            G  F + + R +            ++F  SI+YL ++F  + +D L+  
Sbjct: 257 SGAWFIIESHRLYATAIRHGEVKAMRVFHSSISYLTLVFLAVGIDPLLPF 306


>gi|53718102|ref|YP_107088.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei K96243]
 gi|76809818|ref|YP_332096.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1710b]
 gi|126440778|ref|YP_001057552.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 668]
 gi|126453695|ref|YP_001064800.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1106a]
 gi|134279644|ref|ZP_01766356.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 305]
 gi|167717932|ref|ZP_02401168.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei DM98]
 gi|167736950|ref|ZP_02409724.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 14]
 gi|167814055|ref|ZP_02445735.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 91]
 gi|167844157|ref|ZP_02469665.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei B7210]
 gi|167909376|ref|ZP_02496467.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 112]
 gi|237810703|ref|YP_002895154.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei
           MSHR346]
 gi|242317773|ref|ZP_04816789.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1106b]
 gi|254181929|ref|ZP_04888526.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1655]
 gi|254187862|ref|ZP_04894374.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196731|ref|ZP_04903155.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei S13]
 gi|254258160|ref|ZP_04949214.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1710a]
 gi|254296021|ref|ZP_04963478.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 406e]
 gi|81380510|sp|Q63XS7|COXX_BURPS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|123600389|sp|Q3JWF7|COXX_BURP1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639196|sp|A3NR29|COXX_BURP0 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639197|sp|A3N5D1|COXX_BURP6 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|52208516|emb|CAH34451.1| UbiA prenyltransferase family protein [Burkholderia pseudomallei
           K96243]
 gi|76579271|gb|ABA48746.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1710b]
 gi|126220271|gb|ABN83777.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 668]
 gi|126227337|gb|ABN90877.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1106a]
 gi|134248844|gb|EBA48926.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 305]
 gi|157805722|gb|EDO82892.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 406e]
 gi|157935542|gb|EDO91212.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653474|gb|EDS86167.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei S13]
 gi|184212467|gb|EDU09510.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1655]
 gi|237503712|gb|ACQ96030.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei
           MSHR346]
 gi|242141012|gb|EES27414.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1106b]
 gi|254216849|gb|EET06233.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 1710a]
          Length = 300

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTIGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTLQILAFSTVLGGLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GALFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|134098731|ref|YP_001104392.1| protoheme IX farnesyltransferase [Saccharopolyspora erythraea NRRL
           2338]
 gi|291003584|ref|ZP_06561557.1| protoheme IX farnesyltransferase [Saccharopolyspora erythraea NRRL
           2338]
 gi|182637465|sp|A4FBP2|COXX2_SACEN RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|133911354|emb|CAM01467.1| protoheme IX farnesyltransferase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 324

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 152/291 (52%), Gaps = 3/291 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  +  L+KPRV+ L + T    ++LA  G  S    + ++    M AG++ ALN   DA
Sbjct: 33  LKAYAGLIKPRVIELLLVTTIPAMLLAARGIPSPWLVIATLVGGTMAAGSANALNCVADA 92

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT +RP+    +S   A V G++L   S   +    N +SA L   +I  YV 
Sbjct: 93  DIDQVMKRTRARPLVRHTVSNRHALVFGIALGAGSFGWLWATTNLLSAVLAVATILFYVF 152

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GG AG +P +IGWA VTG V   +LVMF IIF WTPPH WSLA+
Sbjct: 153 VYTLVLKRRTAQNIVWGGAAGCMPVVIGWAGVTGRVDWPALVMFGIIFFWTPPHTWSLAM 212

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY++A +PMLP V         I+++T L  +  +L  +       Y       G 
Sbjct: 213 KYRDDYERAGVPMLPVVARPTYVSRQIVVFTWLMVLWTLL--LAPATGWLYTAFAIAAGA 270

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            F + A R        +     KLF  S TYL ++   L VD  + +  + 
Sbjct: 271 WFLVLAHRLHAQTRRGEPTKPLKLFHLSNTYLMIVCVALAVDSALSLPVLG 321


>gi|186475055|ref|YP_001856525.1| protoheme IX farnesyltransferase [Burkholderia phymatum STM815]
 gi|184191514|gb|ACC69479.1| protoheme IX farnesyltransferase [Burkholderia phymatum STM815]
          Length = 301

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 107/286 (37%), Positives = 164/286 (57%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 12  SRISQYIALTKPRVTQLAVFCAVIGMFLATPGMVPWTVLIGGAVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  +D  M RTA RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKVDAKMRRTAWRPSARGEITTSQILLFSAVLGAVGMWTLYTFTNALTMWLTIATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            +IYT+ LK +TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AIIYTLLLKPYTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HI +YTV+   V ++P + G + + Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPITHGEQYTRLHIFLYTVILFAVTMMPFISGMSGIVYLASAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L++DH 
Sbjct: 252 GAVFLAYAWKIYREYSDD---LARKTFRYSIVYLSLLFAALLIDHY 294


>gi|330818382|ref|YP_004362087.1| Protoheme IX farnesyltransferase [Burkholderia gladioli BSR3]
 gi|327370775|gb|AEA62131.1| Protoheme IX farnesyltransferase [Burkholderia gladioli BSR3]
          Length = 300

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ +  L KPRV  LA++ A +G+ LA PG + +   +     I + AGA+ A+N   
Sbjct: 11  SRLSQYFALTKPRVTQLAVFCAVIGMFLATPGMVPLRVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RTA RP   G+I+  +       L  +    +    N ++  L   +   Y
Sbjct: 71  EQKIDAKMRRTAWRPSARGEITTPQILAFSTVLGGAGAWTLYTFTNALTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGSVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL    DY+ + +PMLP     + T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 191 ALYRVKDYENSGLPMLPVTHGAKFTRLHILLYTVILFAVTLMPFISGMSGVVYLASAVVL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ ++   D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GAIFLAYAWKVYV---DYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|190890670|ref|YP_001977212.1| protoheme IX farnesyltransferase [Rhizobium etli CIAT 652]
 gi|238692507|sp|B3PSB2|COXX_RHIE6 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|190695949|gb|ACE90034.1| protoheme IX farnesyltransferase protein [Rhizobium etli CIAT 652]
          Length = 316

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 159/283 (56%), Positives = 200/283 (70%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPG I+ +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYFELLKPRVMSLVVFTAFAGLVLAPGQINPVLGLIAILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I+P EA   G+ L+  S+ I+GLA+NW+SA +L  +IF Y VIY
Sbjct: 82  DAIMSRTAKRPIPAGRIAPSEALAFGLVLSCFSVAILGLAVNWLSAGILAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VT  V+I S V+FLIIFLWTP HFW+LAL  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIESTVLFLIIFLWTPAHFWALALFK 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV  +R TK  I+ Y VLT+I  VLP+ LGFAS  YG++   LG  F
Sbjct: 202 MRDYEAVGVPMLPNVSGERVTKHQIVAYAVLTAICAVLPSYLGFASFAYGLVAAALGAIF 261

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHL 290
              +   +   +    +   KKLF  SI YLF +F+ LM+D L
Sbjct: 262 IYCSIAVWRMPDGDLKMIPAKKLFAFSIFYLFAIFSALMIDRL 304


>gi|116250796|ref|YP_766634.1| protoheme IX farnesyltransferase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|182639231|sp|Q1MKI5|COXX_RHIL3 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|115255444|emb|CAK06520.1| putative protoheme IX farnesyltransferase (heme o synthase)
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 316

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 159/286 (55%), Positives = 203/286 (70%), Gaps = 1/286 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI  +   I+I  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYFELLKPRVMSLVVFTAFAGLVLAPGHIHPVLGTIAILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA+RPIP G+I+P EA   G+ L+  S+VI+GLA+NW+SA +L  +IF Y V+Y
Sbjct: 82  DAIMSRTANRPIPAGRIAPSEALAFGLVLSGFSVVILGLAVNWLSAGILAFTIFFYAVVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VT  V+I S V+FLIIFLWTP HFW+LAL  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIESTVLFLIIFLWTPAHFWALALFK 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV  +R TK  I+ Y VLT++  VLP+ LGFAS+ YG++   LG  F
Sbjct: 202 MRDYEAVGVPMLPNVAGERVTKHQIVAYAVLTAVCAVLPSFLGFASLGYGLVAAALGAIF 261

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
              +   +   +    +   KKLF  SI YLF +F+ LM+D L  +
Sbjct: 262 IYCSIAVWRMPDGDLKMIPAKKLFGFSIFYLFAVFSALMIDRLAPV 307


>gi|327192581|gb|EGE59529.1| protoheme IX farnesyltransferase protein [Rhizobium etli CNPAF512]
          Length = 316

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 161/283 (56%), Positives = 202/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+ +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPVLGLIAILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I+P EA   G+ L+  S+VI+GLA+NW+SA +L  +IF Y VIY
Sbjct: 82  DAIMSRTAKRPIPAGRIAPSEALAFGLVLSCFSVVILGLAVNWLSAGILAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VT  V+I S V+FLIIFLWTP HFW+LAL  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIESTVLFLIIFLWTPAHFWALALFK 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV  +R TK  I+ Y VLT+I  VLP+ LGFAS  YG++   LG  F
Sbjct: 202 MRDYEAVGVPMLPNVSGERVTKHQIVAYAVLTAICAVLPSYLGFASFAYGVVAAALGAIF 261

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHL 290
              +   +   +    +   KKLF  SI YLF +F+ LM+D L
Sbjct: 262 IYCSIAVWRMPDGDLKMIPAKKLFAFSIFYLFAIFSALMIDRL 304


>gi|157119461|ref|XP_001653393.1| protoheme ix farnesyltransferase [Aedes aegypti]
 gi|108883176|gb|EAT47401.1| protoheme ix farnesyltransferase [Aedes aegypti]
          Length = 487

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 65/282 (23%), Positives = 137/282 (48%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +++L K R+ SL + T   G  +AP    +   ++      + +GA+ ++N   +  
Sbjct: 128 IYHYLMLSKIRLTSLVVMTTMAGYAMAPAPFELSTFLLCAVGTTLVSGAANSINQVIETS 187

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M RT +R +  G +S   A    +  +   + ++   +N ++A L   ++  Y  I
Sbjct: 188 FDAQMPRTRNRVLVKGHLSRLHAVGFALGASSIGVGMLYFGVNELTAFLGAANLILYTSI 247

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR++  N  +G + G IPP++GWA+ TGD+ + + ++  +++ W  PHF +L+  
Sbjct: 248 YTP-MKRYSILNTWVGSLVGGIPPLMGWAACTGDIGVGAWILAGLLYCWQFPHFNALSWN 306

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + +Y KA   M+ N    +   +  L +T   + + +L       +V + +    +  +
Sbjct: 307 IRPEYLKAGYKMMANS-HPKLCTLVSLRHTGYITALSLLAPAFDVTNVWFAVESLPVNAY 365

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   AW      +  D + ++KLF  S+ +L +L  + +++ 
Sbjct: 366 FAYLAWDFH---QKADSKSSRKLFRFSLIHLPILMALFLLNK 404


>gi|84387586|ref|ZP_00990604.1| protoheme IX farnesyltransferase [Vibrio splendidus 12B01]
 gi|84377634|gb|EAP94499.1| protoheme IX farnesyltransferase [Vibrio splendidus 12B01]
          Length = 324

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA P  +   ++V  +  I + AG++ A N   D 
Sbjct: 42  WKIYLTLTKPKVVALMLLTALVGMCLAVPNGLPFQQTVFGMIGIGLMAGSAAAFNHLIDK 101

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  M RT  RP+P G++S    +     + +   V + + +N ++A L F S+  Y V
Sbjct: 102 KIDGQMTRTNRRPLPSGELSSVRVFSFAAGIGLLGFVTLVVWVNQLTAWLTFASLLGYAV 161

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVI GIAGA+PP++GW +VT ++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 162 IYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTNELHSNAWLLVMIIFIWTPPHFWALAI 221

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +D+Y K +IPMLP       TK  IL+YT+L SIV +LP ++G +S  Y      L  
Sbjct: 222 HRRDEYAKVNIPMLPVTHGIAYTKTSILLYTLLLSIVCILPVLVGMSSWIYLSASLVLNG 281

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW     K   +  +  K F  SI +L +LF  L+ DH +
Sbjct: 282 GFVYHAWVL---KYRDEPNMAMKTFKFSIYHLMILFVALLADHYL 323


>gi|209523200|ref|ZP_03271756.1| protoheme IX farnesyltransferase [Arthrospira maxima CS-328]
 gi|209496351|gb|EDZ96650.1| protoheme IX farnesyltransferase [Arthrospira maxima CS-328]
          Length = 324

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 115/285 (40%), Positives = 171/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  +  L KPR++ L + T   G+ LA  G +  L  ++++    + +GA+  +N  YD+
Sbjct: 20  LKSYYQLTKPRIILLLLITTAAGMWLAAEGEVDPLLLLVTMVGGTLASGAANTINCLYDS 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P +A +  ++LA++S  ++ +  N ++A L    I  YV 
Sbjct: 80  DIDYIMERTRWRPIPSGRVKPRDAMIFAIALAIASFTLLTVFANLLAALLAMSGIVFYVA 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIPP++GWA+VTGD+S A+ ++F+IIFLWTPPHFW+LA+
Sbjct: 140 IYTHWLKRHSTQNIVIGGAAGAIPPLVGWAAVTGDLSWAAWLLFVIIFLWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + +D+YQ   +PMLP +  D  T   I IY+++     +L       +   YG I   LG
Sbjct: 200 MIRDEYQDVGVPMLPVIEGDELTAQQIWIYSLVLIPTSLLLVYPLHTSGWVYGAIALGLG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW       ++D  V + LF  SI YL +L   ++VD L
Sbjct: 260 AVFLQKAWELLQTPHNRD--VARSLFKYSILYLMLLCAGMVVDSL 302


>gi|222147788|ref|YP_002548745.1| protoheme IX farnesyltransferase [Agrobacterium vitis S4]
 gi|221734776|gb|ACM35739.1| protoheme IX farnesyltransferase [Agrobacterium vitis S4]
          Length = 325

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 147/283 (51%), Positives = 194/283 (68%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             F  LLKPRVMSL ++TAF G+VLAPG I+ +  VI+I  IA+GAGASGALNM+YDADI
Sbjct: 31  KDFFALLKPRVMSLVVFTAFAGLVLAPGTINPILGVIAILCIAVGAGASGALNMWYDADI 90

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA RPIP G+I P EA   G++L+V S+ I+GLA+NW +A  L  +I  Y V+Y
Sbjct: 91  DAVMTRTARRPIPAGRIRPQEALAFGITLSVFSVSILGLAVNWFAAAFLAFTILFYAVVY 150

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG +GA PPMIGWA VTG VS+ S+++F++IFLWTP HFW+LAL  
Sbjct: 151 TMWLKRSTPQNIVIGGASGAFPPMIGWACVTGGVSLDSVILFMVIFLWTPAHFWALALYK 210

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    +PM+PNV  + +TK  + +Y VLT +  V P   G AS+ YG++   L   F
Sbjct: 211 MRDYGSVGVPMMPNVAGETSTKRQMFVYAVLTGVFAVAPAFTGLASLWYGLVAGVLSAVF 270

Query: 249 TLWAWRTFLCKEDKDIRV-TKKLFLESITYLFVLFTILMVDHL 290
              +   +  +E  +     +K+F  SI YLF +F+ L+VDH 
Sbjct: 271 VACSVAVWRMREGDERMAPARKMFAYSIFYLFAVFSALLVDHY 313


>gi|50954828|ref|YP_062116.1| protoheme IX farnesyltransferase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|81390971|sp|Q6AF34|COXX_LEIXX RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|50951310|gb|AAT89011.1| protoheme IX farnesyltransferase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 307

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 160/288 (55%), Gaps = 1/288 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KPRV+ L + T    ++LA  G  ++   + ++    M AG++GA N Y D
Sbjct: 20  KVKAYISLTKPRVVELLLVTTVPTMILAARGIPNLWLVLATVVGGYMSAGSAGAFNCYID 79

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT +RP+  G++S  EA V   +L V+S++++G   NW++A L   +I  YV
Sbjct: 80  RDIDRVMRRTKNRPLVTGELSDREALVFAWALGVASVLVLGFFTNWLAAGLSVAAILIYV 139

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V YT+ LKR T QNIV GG+AG +P +IGWA VT  V  A +++F +IFLWTPPH+W L+
Sbjct: 140 VFYTLILKRRTTQNIVWGGVAGCMPVLIGWAVVTNSVGWAPVILFGVIFLWTPPHYWPLS 199

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  ++DY+ A +PML  V       + +++Y        +L   +    V Y  +    G
Sbjct: 200 MKYREDYKDAGVPMLAVVRGRAVVGLQVVLYAWAMVACSLLLIPVARMGVLYTAVALVAG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F   + R +            ++F  SI YL ++F  + +D L+  
Sbjct: 260 GWFLYESHRLYNLAICHATVSPMRVFHGSIAYLTLIFLAVAIDPLLPF 307


>gi|209966878|ref|YP_002299793.1| protoheme IX farnesyltransferase [Rhodospirillum centenum SW]
 gi|209960344|gb|ACJ00981.1| protoheme IX farnesyltransferase [Rhodospirillum centenum SW]
          Length = 302

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 138/284 (48%), Positives = 195/284 (68%), Gaps = 1/284 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ LLKPRVM L +Y+A  G+++APG +  + ++ ++  I +GAGASGA+NM+YD D
Sbjct: 19  VGDYMALLKPRVMILVVYSAIAGMMVAPGGLHPVLALAAVLCITVGAGASGAINMWYDRD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA+RPIP G+I P EA   G+ L+V  ++++GLA+NWV+A LL ++   YV +
Sbjct: 79  IDAVMKRTAARPIPQGRIDPDEALTFGIVLSVVPVLLLGLAVNWVAAGLLALASAFYVFV 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR TPQNIVIGG AGA PPMIGWA+VTGDV++AS+++F IIF WTPPHFW+L+L 
Sbjct: 139 YTIWLKRRTPQNIVIGGAAGAFPPMIGWAAVTGDVTLASVILFAIIFFWTPPHFWALSLF 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY+KA +PMLP V   + TK  +L YT++   +   P  +G A   Y      LG  
Sbjct: 199 ASADYEKAGVPMLPVVAGAQETKRQMLAYTLILLPLATAPWFVGIAGTAYLATSVVLGLL 258

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F L A R     +  D++  +++F  SI YLFVLF +L+ + L+
Sbjct: 259 FVLCAVRVLRA-DATDMKPARRMFGFSILYLFVLFGVLIAERLV 301


>gi|115352945|ref|YP_774784.1| protoheme IX farnesyltransferase [Burkholderia ambifaria AMMD]
 gi|170699771|ref|ZP_02890804.1| protoheme IX farnesyltransferase [Burkholderia ambifaria IOP40-10]
 gi|122322160|sp|Q0BBM3|COXX_BURCM RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|115282933|gb|ABI88450.1| protoheme IX farnesyltransferase [Burkholderia ambifaria AMMD]
 gi|170135298|gb|EDT03593.1| protoheme IX farnesyltransferase [Burkholderia ambifaria IOP40-10]
          Length = 300

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTIGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTPQILLFSAVLGSVGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVVYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTLMPFISGMSGVVYLASAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIY---RDYSDELARKAFRYSIVYLSLLFAALLVDHY 293


>gi|56459364|ref|YP_154645.1| protoheme IX farnesyltransferase [Idiomarina loihiensis L2TR]
 gi|81363584|sp|Q5R0Y6|CYOE_IDILO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|56178374|gb|AAV81096.1| Polyprenyltransferase [Idiomarina loihiensis L2TR]
          Length = 298

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 170/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV++L + TA VG+ LA    +S+   V ++  I + + A+ A+N   D 
Sbjct: 17  WRDYLELTKPRVVALLLLTAVVGMCLATEELVSLKVLVPALTGIGLMSAAAAAINHLVDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART  RP+P G +SP +      S+ V   V +   +N ++A L F S+  Y V
Sbjct: 77  HIDAKMARTLRRPLPQGNLSPAKVTTFAASIGVIGFVTLYAWVNPLTAWLTFASMVGYAV 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA PP++GW SVT +++  ++++ +IIF WTPPHFW+LA+
Sbjct: 137 VYTMFLKRATPQNIVIGGLAGAAPPLLGWTSVTNEINAPAVLLVMIIFTWTPPHFWALAV 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY +A +PMLP       TK  I +YTVL ++V ++P ++G   + Y + V  L  
Sbjct: 197 HRAKDYARAKVPMLPVTHGIEFTKTCIFLYTVLLTVVCLMPFLIGMTGMIYLVGVSVLNA 256

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +AW+    K     +    +F  SI +L +LF IL+VDH +
Sbjct: 257 IFLAYAWKL---KYSPSKKTAFNMFAFSIWHLMLLFVILLVDHYV 298


>gi|312139618|ref|YP_004006954.1| protoheme ix farnesyltransferase cyoe [Rhodococcus equi 103S]
 gi|325676706|ref|ZP_08156380.1| protoheme IX farnesyltransferase [Rhodococcus equi ATCC 33707]
 gi|311888957|emb|CBH48270.1| protoheme IX farnesyltransferase CyoE [Rhodococcus equi 103S]
 gi|325552488|gb|EGD22176.1| protoheme IX farnesyltransferase [Rhodococcus equi ATCC 33707]
          Length = 329

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 168/294 (57%), Gaps = 3/294 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L +      ++LA  GHI ++  + ++F   MGA ++ +LN   DA
Sbjct: 38  ILAYVALTKPRVIELLLVATIPAMLLADRGHIDLVLILSTLFGGWMGAASANSLNCVVDA 97

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DIDK+M RTA RP+    +    A+V G++L V+S V +    N ++  L+ ++I  YV+
Sbjct: 98  DIDKVMKRTALRPLARQAVPTKHAFVFGMTLGVASFVWLWWRANLLAGFLVVLTIAFYVL 157

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QN++ GG AG +P M+GWA+VTG +S   +V+FLIIF WTPPH W+LA+
Sbjct: 158 VYTMVLKRRTWQNVIWGGAAGCMPVMVGWAAVTGSLSWEPVVLFLIIFFWTPPHTWALAM 217

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY+ A +PMLP + ++      I+IYT  T +  +   ++  A   Y I+    G 
Sbjct: 218 RYKEDYKAAGVPMLPVIASETHVTKQIVIYTWATVLASLA--LVPAAGWIYAIVTLLAGA 275

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
            F   A + +            KLFL+S  YL V+   L VD ++   T+   F
Sbjct: 276 WFLFVAHQLYNSVRGGTPIKPLKLFLQSNNYLAVVCCGLAVDSVLGWDTIGSLF 329


>gi|172061795|ref|YP_001809447.1| protoheme IX farnesyltransferase [Burkholderia ambifaria MC40-6]
 gi|205693157|sp|B1YN86|COXX_BURA4 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|171994312|gb|ACB65231.1| protoheme IX farnesyltransferase [Burkholderia ambifaria MC40-6]
          Length = 300

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 163/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTIGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L  +    +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTPQILLFSAVLGSAGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVVYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTLMPFISGMSGVVYLASAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIY---RDYSDELARKAFRYSIVYLSLLFAALLVDHY 293


>gi|167835324|ref|ZP_02462207.1| protoheme IX farnesyltransferase [Burkholderia thailandensis
           MSMB43]
          Length = 300

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTIGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTLQILAFSTVLGGLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GAIFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|85373374|ref|YP_457436.1| protoheme IX farnesyltransferase [Erythrobacter litoralis HTCC2594]
 gi|122545051|sp|Q2NCF2|COXX_ERYLH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|84786457|gb|ABC62639.1| heme O synthase [Erythrobacter litoralis HTCC2594]
          Length = 307

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 132/286 (46%), Positives = 181/286 (63%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  L KPRVM+L I+T   G++ APG I+ +    +I  IAMGAG S ALN +++AD
Sbjct: 14  WRDFFALTKPRVMTLVIFTGICGLLAAPGAINPILGFTAILCIAMGAGGSAALNQWWEAD 73

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA RP+P G++   +A   G+ ++V+S+ IMG+AINW+SA +L  +I  Y VI
Sbjct: 74  IDAGMKRTAKRPLPSGRMQATDARDFGILISVASVGIMGIAINWLSAIILAAAIVYYAVI 133

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLK  TPQNIVIGG AGA PPMIGW +VTG++++  +++F IIF+WTPPHFW+LAL 
Sbjct: 134 YTIWLKPRTPQNIVIGGGAGAFPPMIGWVAVTGEITLMPVLLFAIIFMWTPPHFWALALF 193

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY+K  IPM+P V  + +T+  IL+Y++L     V P  +G     YG+    L   
Sbjct: 194 VKTDYEKVGIPMMPVVKGEASTRRQILVYSILLIPFAVAPWAIGATGAIYGVSALLLTGA 253

Query: 248 FTLWA--WRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   +    T    E   ++  K+LF  SI YLF LF  L+ D  +
Sbjct: 254 FAALSVPVATRRQIEGDTMKPEKRLFGFSILYLFALFAALVADRYL 299


>gi|241203391|ref|YP_002974487.1| protoheme IX farnesyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857281|gb|ACS54948.1| protoheme IX farnesyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 316

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 159/283 (56%), Positives = 202/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI  +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYFELLKPRVMSLVVFTAFAGLVLAPGHIHPVLGLIAILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA+RPIP G+I+P EA   G+ L+  S+VI+GLA+NW+SA +L  +IF Y V+Y
Sbjct: 82  DAIMSRTANRPIPAGRIAPSEALAFGLVLSGFSVVILGLAVNWLSAGILAFTIFFYAVVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VT  V+I S V+FLIIFLWTP HFW+LAL  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIESTVLFLIIFLWTPAHFWALALFK 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV  +R TK  I+ Y VLT++  VLP+ LGFAS  YG++   LG  F
Sbjct: 202 MRDYEAVGVPMLPNVAGERVTKHQIVAYAVLTAVCAVLPSFLGFASFGYGLVAAALGAIF 261

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHL 290
              +   +   +    +   KKLF  SI YLF +F+ LM+D L
Sbjct: 262 IYCSIAVWRMPDGDLKMIPAKKLFGFSIFYLFAVFSALMIDRL 304


>gi|49084596|gb|AAT51213.1| PA0113 [synthetic construct]
          Length = 305

 Score =  166 bits (419), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 116/294 (39%), Positives = 173/294 (58%), Gaps = 8/294 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-----PGHISVLKSVISIFAIAMGAGASGALNM 62
              F+ L KP+V+ L + T+ +G++LA      G +     +     I + AGA+ A+N 
Sbjct: 13  WRDFLELTKPKVVVLMLITSLIGMLLATKAPLDGFVPWQVLIFGNLGIGLCAGAAAAVNH 72

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             D  ID +MART  RP+  G++SP  A    + LA++ + ++    N ++A L   S+ 
Sbjct: 73  VVDRRIDSIMARTHKRPLAEGRVSPSMALGFALLLALAGMAVLLAFTNPLTAWLTLASLL 132

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y  +YT +LKR TPQNIVIGG+AGA PP++GW ++TG +S   L++ LIIF WTPPHFW
Sbjct: 133 GYAALYTGFLKRATPQNIVIGGLAGAAPPLLGWVAITGHLSAEPLLLVLIIFAWTPPHFW 192

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +L +  KD+Y KA IPMLP    +R TK+HIL+YT++   V ++P ++  + + Y +   
Sbjct: 193 ALCIHRKDEYAKADIPMLPVTHGERYTKLHILLYTLVLFAVSLMPFVIHMSGLVYLLCAL 252

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            LG  F  WAW  +    D       K F  SI YLF+LF  L+VDH + +K +
Sbjct: 253 ALGARFLDWAWALYC---DSRPHAAIKTFKYSIVYLFLLFMALLVDHYLPLKLL 303


>gi|329114642|ref|ZP_08243401.1| Protoheme IX farnesyltransferase [Acetobacter pomorum DM001]
 gi|326696122|gb|EGE47804.1| Protoheme IX farnesyltransferase [Acetobacter pomorum DM001]
          Length = 336

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 136/292 (46%), Positives = 187/292 (64%), Gaps = 6/292 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
            R   +I LLKPRV+SL ++T   G+++APGH+++  ++++IF I M +GA+GA+NM+YD
Sbjct: 41  TRARDWIQLLKPRVISLVVFTGAAGMIVAPGHMNLFVALVTIFCICMASGAAGAINMWYD 100

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT +RPIP G+I   EA   GV L+  S+ +M +A N ++A +L  SIF Y 
Sbjct: 101 RDIDAVMQRTITRPIPGGRIPENEALAYGVGLSCLSVCLMWMATNTLAAGILAFSIFFYA 160

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+WLKR TPQNIVIGG AGA PPMIGWA+VTG +++  +VMF I+F WTPPHFWSL+
Sbjct: 161 VIYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAVTGHMAVLPVVMFGIVFFWTPPHFWSLS 220

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L    DY +A IPMLP V   R T+  I IYT++   V ++P+ +      Y +    LG
Sbjct: 221 LYACKDYGRAGIPMLPVVRGARHTRWQIFIYTLVLLAVSLVPSFMHLCGWLYTVTALVLG 280

Query: 246 YHFTLWAWRTFLCKED------KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F   A R  L  +D      K  +  +  F  S+ YLF LF  L+ DH +
Sbjct: 281 LGFVACAVRVLLEPQDAQGVSLKGDKAARISFRFSLAYLFFLFCGLLADHFL 332


>gi|78067636|ref|YP_370405.1| protoheme IX farnesyltransferase [Burkholderia sp. 383]
 gi|123567591|sp|Q39CQ5|COXX_BURS3 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|77968381|gb|ABB09761.1| Protoheme IX farnesyltransferase [Burkholderia sp. 383]
          Length = 300

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 160/286 (55%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTPQILIFSAVLGSVGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTLMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+      D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIH---RDYSDELARKAFRYSIVYLSLLFAALLVDHY 293


>gi|120553013|ref|YP_957364.1| protoheme IX farnesyltransferase [Marinobacter aquaeolei VT8]
 gi|120322862|gb|ABM17177.1| protoheme IX farnesyltransferase [Marinobacter aquaeolei VT8]
          Length = 306

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 120/289 (41%), Positives = 175/289 (60%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV++L I T+ +G++LA PG       +     IA+ AGA+  +N   D 
Sbjct: 21  WRDYLELTKPRVVALMILTSVIGMLLAAPGVPEWSVLLFGNLGIALLAGAAAVVNHVVDQ 80

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+I+P +A +    LA   +V++   +N ++A L   S+  Y  
Sbjct: 81  KIDTVMARTRKRPVATGRIAPLDALLFATVLAALGMVVLVWQVNELTAWLTLASLVGYAG 140

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA+PP++GW +VTG V   +L++ LIIF WTPPHFW+LA+
Sbjct: 141 VYTLFLKRATPQNIVIGGLAGAMPPLLGWTAVTGQVEGHALLLVLIIFAWTPPHFWALAI 200

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +R T++HIL+YT++   V +LP + G +   Y +    LG 
Sbjct: 201 HRKEEYAKAGIPMLPVTHGNRYTELHILLYTLMLLAVSLLPFVTGMSGGIYLVGALALGL 260

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            F  +A R        D RV    F  SITYL  LF +L+VDH + +  
Sbjct: 261 RFLQYAVRLL---RGDDRRVALNTFKYSITYLMALFVVLLVDHFVFVPA 306


>gi|325525369|gb|EGD03204.1| protoheme IX farnesyltransferase [Burkholderia sp. TJI49]
          Length = 300

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  +D MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKVDAMMRRTAWRPSARGEITTPQILLFSAVLGSLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTLMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIY---RDYSDELARKAFRYSIVYLSLLFAALLVDHY 293


>gi|313836741|gb|EFS74455.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL037PA2]
 gi|314929852|gb|EFS93683.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL044PA1]
 gi|314972280|gb|EFT16377.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL037PA3]
 gi|328907710|gb|EGG27474.1| protoheme IX farnesyltransferase [Propionibacterium sp. P08]
          Length = 340

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 100/290 (34%), Positives = 156/290 (53%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    + LA   +  +  +V ++      A ++   N   D 
Sbjct: 51  VGAYVALTKPRIIELLLVTTLPVMFLASHGVPKLGLAVATMLGGLFAAASANVFNCVIDV 110

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A++ G++L + + +I+GL  NW+SA L  ++   YV 
Sbjct: 111 DIDEKMRRTRRRPLPRHQVPRRGAFIYGIALGIIATIILGLGANWLSAGLALVANLFYVF 170

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+FLI+F WTPPH W+L+ 
Sbjct: 171 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGRVGWEPLVLFLIVFWWTPPHTWALSF 230

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + IL+YTV T    ++   +      YG++    G 
Sbjct: 231 RYREDYKAAGVPMLPVVREAPEVAVQILVYTVATVATSLVLWPVAHTGWIYGVVAVLAGA 290

Query: 247 HFTLWAWRTFLCKEDKDIR---VTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +               + +LF  S TYL +LF  + VD LI +
Sbjct: 291 VFIVEAVQLLRRANAGLRDVVLKSMRLFHWSNTYLSLLFLAIAVDPLIHL 340


>gi|15595311|ref|NP_248803.1| protoheme IX farnesyltransferase [Pseudomonas aeruginosa PAO1]
 gi|107099105|ref|ZP_01363023.1| hypothetical protein PaerPA_01000114 [Pseudomonas aeruginosa PACS2]
 gi|116053834|ref|YP_788271.1| protoheme IX farnesyltransferase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218888858|ref|YP_002437722.1| protoheme IX farnesyltransferase [Pseudomonas aeruginosa LESB58]
 gi|254237645|ref|ZP_04930968.1| hypothetical protein PACG_03730 [Pseudomonas aeruginosa C3719]
 gi|254243220|ref|ZP_04936542.1| hypothetical protein PA2G_04025 [Pseudomonas aeruginosa 2192]
 gi|296386600|ref|ZP_06876099.1| protoheme IX farnesyltransferase [Pseudomonas aeruginosa PAb1]
 gi|313112322|ref|ZP_07798089.1| putative cytochrome c oxidase assembly factor [Pseudomonas
           aeruginosa 39016]
 gi|81542085|sp|Q9I719|CYOE1_PSEAE RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|122262029|sp|Q02UW5|CYOE1_PSEAB RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|9945940|gb|AAG03503.1|AE004449_12 probable cytochrome c oxidase assembly factor [Pseudomonas
           aeruginosa PAO1]
 gi|115589055|gb|ABJ15070.1| putative cytochrome c oxidase assembly factor [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126169576|gb|EAZ55087.1| hypothetical protein PACG_03730 [Pseudomonas aeruginosa C3719]
 gi|126196598|gb|EAZ60661.1| hypothetical protein PA2G_04025 [Pseudomonas aeruginosa 2192]
 gi|218769081|emb|CAW24841.1| probable cytochrome c oxidase assembly factor [Pseudomonas
           aeruginosa LESB58]
 gi|310884591|gb|EFQ43185.1| putative cytochrome c oxidase assembly factor [Pseudomonas
           aeruginosa 39016]
          Length = 304

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 116/294 (39%), Positives = 173/294 (58%), Gaps = 8/294 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-----PGHISVLKSVISIFAIAMGAGASGALNM 62
              F+ L KP+V+ L + T+ +G++LA      G +     +     I + AGA+ A+N 
Sbjct: 13  WRDFLELTKPKVVVLMLITSLIGMLLATKAPLDGFVPWQVLIFGNLGIGLCAGAAAAVNH 72

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             D  ID +MART  RP+  G++SP  A    + LA++ + ++    N ++A L   S+ 
Sbjct: 73  VVDRRIDSIMARTHKRPLAEGRVSPSMALGFALLLALAGMAVLLAFTNPLTAWLTLASLL 132

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y  +YT +LKR TPQNIVIGG+AGA PP++GW ++TG +S   L++ LIIF WTPPHFW
Sbjct: 133 GYAALYTGFLKRATPQNIVIGGLAGAAPPLLGWVAITGHLSAEPLLLVLIIFAWTPPHFW 192

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +L +  KD+Y KA IPMLP    +R TK+HIL+YT++   V ++P ++  + + Y +   
Sbjct: 193 ALCIHRKDEYAKADIPMLPVTHGERYTKLHILLYTLVLFAVSLMPFVIHMSGLVYLLCAL 252

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            LG  F  WAW  +    D       K F  SI YLF+LF  L+VDH + +K +
Sbjct: 253 ALGARFLDWAWALYC---DSRPHAAIKTFKYSIVYLFLLFMALLVDHYLPLKLL 303


>gi|13476227|ref|NP_107797.1| protoheme IX farnesyltransferase [Mesorhizobium loti MAFF303099]
 gi|81776742|sp|Q985X0|COXX2_RHILO RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|14026987|dbj|BAB53583.1| heme O synthase [Mesorhizobium loti MAFF303099]
          Length = 314

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 153/283 (54%), Positives = 207/283 (73%), Gaps = 1/283 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVMSL ++TAFVG+V AP  I+ L +VI+I +IA+GAGASGALNM+YDADID
Sbjct: 23  DFFALLKPRVMSLVVFTAFVGLVAAPVTINPLLAVIAILSIAIGAGASGALNMWYDADID 82

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RTASRP+P G+I P EA   G+ L+V S++ +G+ +NW+SATLL  +IF Y V+YT
Sbjct: 83  AVMTRTASRPVPSGRIQPHEALSFGLVLSVLSVMTLGVLVNWLSATLLAFTIFFYAVVYT 142

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR+TPQNIVIGG AGAIPP+IGWA+VTG VS+ S+V+FLIIFLWTPPHFW+LAL   
Sbjct: 143 MWLKRWTPQNIVIGGAAGAIPPVIGWAAVTGSVSLESIVLFLIIFLWTPPHFWALALFKS 202

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY++A IPM+PNV    +T+  I  Y ++ + VGV P +LG+ +  YG+    LG  F 
Sbjct: 203 GDYERAGIPMMPNVAGHASTRRQIFAYALVLAPVGVAPWLLGYTTPFYGVAAMLLGLGFV 262

Query: 250 LWAWRTF-LCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +AW+   +  +D+ ++  K LF  S+ YLF +F   + D ++
Sbjct: 263 WYAWKVLGMADDDRAMKPAKALFAYSLLYLFAIFAAYLADSVV 305


>gi|171320553|ref|ZP_02909578.1| protoheme IX farnesyltransferase [Burkholderia ambifaria MEX-5]
 gi|171094212|gb|EDT39294.1| protoheme IX farnesyltransferase [Burkholderia ambifaria MEX-5]
          Length = 300

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTIGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTPQILLFSAVLGSVGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTLMPFISGMSGAVYLASAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIY---RDYSDELARKAFRYSIVYLSLLFAALLVDHY 293


>gi|148975701|ref|ZP_01812532.1| protoheme IX farnesyltransferase [Vibrionales bacterium SWAT-3]
 gi|145964774|gb|EDK30026.1| protoheme IX farnesyltransferase [Vibrionales bacterium SWAT-3]
          Length = 312

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 169/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA P  + + +++  +  I + AG++ A N   D 
Sbjct: 30  WKVYLTLTKPKVVALMLLTALVGMCLAVPNGLPLQQALFGMIGIGLMAGSAAAFNHLIDK 89

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  M+RT  RP+P G++S    +     + +   V + L +N ++A L F S+  Y V
Sbjct: 90  KIDGQMSRTNRRPLPSGELSSVRVFAFAAGIGLLGFVTLALLVNPLTAWLTFASLLGYAV 149

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVI GIAGA+PP++GW +VT ++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 150 IYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTNELHSNAWLLVMIIFIWTPPHFWALAI 209

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +D+Y K +IPMLP       TK  IL+YT+L SIV VLP ++G +S  Y      L  
Sbjct: 210 HRRDEYAKVNIPMLPVTHGIAYTKTSILLYTLLLSIVCVLPVLVGMSSWIYLSASLLLNG 269

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW     K   +  +  K F  SI +L +LF  L+ DH +
Sbjct: 270 GFVYHAWVL---KYRDEPNMAMKTFKFSIYHLMILFVALLADHYL 311


>gi|107023771|ref|YP_622098.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116690857|ref|YP_836480.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia HI2424]
 gi|170734182|ref|YP_001766129.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia MC0-3]
 gi|206559156|ref|YP_002229916.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia J2315]
 gi|254247136|ref|ZP_04940457.1| Protoheme IX farnesyltransferase [Burkholderia cenocepacia PC184]
 gi|123244631|sp|Q1BTD0|COXX_BURCA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639192|sp|A0KAR0|COXX_BURCH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|205693168|sp|B1JZ41|COXX_BURCC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|238693087|sp|B4EA84|COXX_BURCJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|105893960|gb|ABF77125.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia AU 1054]
 gi|116648946|gb|ABK09587.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia HI2424]
 gi|124871912|gb|EAY63628.1| Protoheme IX farnesyltransferase [Burkholderia cenocepacia PC184]
 gi|169817424|gb|ACA92007.1| protoheme IX farnesyltransferase [Burkholderia cenocepacia MC0-3]
 gi|198035193|emb|CAR51067.1| UbiA prenyltransferase family protein [Burkholderia cenocepacia
           J2315]
          Length = 300

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 160/286 (55%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTPQILLFSAVLGSVGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTLMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+      D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIH---RDYSDELARKAFRYSIVYLSLLFAALLVDHY 293


>gi|167822575|ref|ZP_02454046.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 9]
 gi|217419983|ref|ZP_03451489.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 576]
 gi|226193695|ref|ZP_03789298.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei
           Pakistan 9]
 gi|217397287|gb|EEC37303.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei 576]
 gi|225934273|gb|EEH30257.1| protoheme IX farnesyltransferase [Burkholderia pseudomallei
           Pakistan 9]
          Length = 300

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            RL+ ++ L KPRV  LA++ A +G+ LA PG +     +     I + AG++ A+N   
Sbjct: 11  SRLSQYLALTKPRVTQLAVFCAVIGMFLATPGMVPWKVLLGGTIGIGLLAGSAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +       L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTLQILAFSTVLGGLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y +    L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQFTRLHILLYTVILFAVTMMPFISGMSGAVYLMSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + ++ F  SI YL +LF  L+VDH 
Sbjct: 251 GALFLAYAWKIY---RDYSDALARRAFRYSIVYLSLLFAALLVDHY 293


>gi|15608589|ref|NP_215967.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis H37Rv]
 gi|15840911|ref|NP_335948.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis
           CDC1551]
 gi|148661243|ref|YP_001282766.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis H37Ra]
 gi|148822670|ref|YP_001287424.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis F11]
 gi|167966642|ref|ZP_02548919.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis H37Ra]
 gi|218753165|ref|ZP_03531961.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis GM
           1503]
 gi|253799500|ref|YP_003032501.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis KZN 1435]
 gi|254231687|ref|ZP_04925014.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis C]
 gi|289554760|ref|ZP_06443970.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis KZN 605]
 gi|289761610|ref|ZP_06520988.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis GM 1503]
 gi|297634015|ref|ZP_06951795.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis KZN
           4207]
 gi|297731001|ref|ZP_06960119.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis KZN
           R506]
 gi|306775637|ref|ZP_07413974.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu001]
 gi|306779458|ref|ZP_07417795.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu002]
 gi|306784188|ref|ZP_07422510.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu003]
 gi|306788555|ref|ZP_07426877.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu004]
 gi|306792893|ref|ZP_07431195.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu005]
 gi|306797276|ref|ZP_07435578.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu006]
 gi|306803157|ref|ZP_07439825.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu008]
 gi|306807736|ref|ZP_07444404.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu007]
 gi|306967555|ref|ZP_07480216.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu009]
 gi|306971746|ref|ZP_07484407.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu010]
 gi|307079466|ref|ZP_07488636.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu011]
 gi|307084024|ref|ZP_07493137.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu012]
 gi|313658334|ref|ZP_07815214.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis KZN
           V2475]
 gi|81668801|sp|O06809|COXX_MYCTU RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639207|sp|A5U2F4|COXX_MYCTA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|205693468|sp|A1QRH1|COXX_MYCTF RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|2131045|emb|CAB09270.1| PROBABLE CYTOCHROME C OXIDASE ASSEMBLY FACTOR CTAB [Mycobacterium
           tuberculosis H37Rv]
 gi|13881114|gb|AAK45762.1| cytochrome c oxidase folding protein, putative [Mycobacterium
           tuberculosis CDC1551]
 gi|124600746|gb|EAY59756.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis C]
 gi|148505395|gb|ABQ73204.1| putative cytochrome C oxidase assembly factor CtaB [Mycobacterium
           tuberculosis H37Ra]
 gi|148721197|gb|ABR05822.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis F11]
 gi|253321003|gb|ACT25606.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis KZN 1435]
 gi|289439392|gb|EFD21885.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis KZN 605]
 gi|289709116|gb|EFD73132.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis GM 1503]
 gi|308215880|gb|EFO75279.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu001]
 gi|308327590|gb|EFP16441.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu002]
 gi|308331054|gb|EFP19905.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu003]
 gi|308334873|gb|EFP23724.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu004]
 gi|308338667|gb|EFP27518.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu005]
 gi|308342363|gb|EFP31214.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu006]
 gi|308345859|gb|EFP34710.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu007]
 gi|308350160|gb|EFP39011.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu008]
 gi|308354798|gb|EFP43649.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu009]
 gi|308358751|gb|EFP47602.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu010]
 gi|308362679|gb|EFP51530.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu011]
 gi|308366336|gb|EFP55187.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis SUMu012]
 gi|323720040|gb|EGB29150.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis CDC1551A]
 gi|326903074|gb|EGE50007.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis W-148]
 gi|328459248|gb|AEB04671.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis KZN 4207]
          Length = 308

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 163/294 (55%), Gaps = 3/294 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           +  L  ++ L KPRV+ L + TA   ++LA  G I  L  + ++    M A  +  LN  
Sbjct: 17  MSTLLAYLALTKPRVIELLLVTAIPAMLLADRGAIHPLLMLNTLVGGMMAAAGANTLNCV 76

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            DADIDK+M RTA RP+    +    A  LG++L V S   +  A N ++  L  +++  
Sbjct: 77  ADADIDKVMKRTARRPLAREAVPTRNALALGLTLTVISFFWLWCATNLLAGVLALVTVAF 136

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+WLKR T QN+V GG AG +P MIGW+++TG ++  +L MF IIF WTPPH W+
Sbjct: 137 YVFVYTLWLKRRTSQNVVWGGAAGCMPVMIGWSAITGTIAWPALAMFAIIFFWTPPHTWA 196

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K DYQ A +PMLP V T+R     ILIYT LT    ++  +    S  YG +   
Sbjct: 197 LAMRYKQDYQVAGVPMLPAVATERQVTKQILIYTWLTVAATLVLALA--TSWLYGAVALV 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            G  F   A + +      +     +LFL+S  YL V+F  L VD +I + T+ 
Sbjct: 255 AGGWFLTMAHQLYAGVRAGEPVRPLRLFLQSNNYLAVVFCALAVDSVIALPTLH 308


>gi|312958166|ref|ZP_07772689.1| protoheme 9 farnesyltransferase [Pseudomonas fluorescens WH6]
 gi|311287597|gb|EFQ66155.1| protoheme 9 farnesyltransferase [Pseudomonas fluorescens WH6]
          Length = 299

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 117/287 (40%), Positives = 166/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     V     IA+ AG + A+N   D 
Sbjct: 14  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALCAGGAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    + LAV+ + ++    N ++A L   S+  Y V
Sbjct: 74  RIDAVMARTHKRPLAEGRVSPVAALAFALFLAVAGLALLLAFTNPLAAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW +VTG +S   L++ LIIF WTPPHFW+LA+
Sbjct: 134 IYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGHISAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT +   V ++P ++  +   Y I    LG 
Sbjct: 194 HRKEEYAKADIPMLPVTHGEHYTKVHILLYTCVLLAVSLMPYVIHMSGPLYLICALVLGG 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +              F  SI YLF+LF  L+VDH + +
Sbjct: 254 RFLQWAWVLYRGGR---PHAAINTFKYSIWYLFLLFIALLVDHYLLL 297


>gi|296536351|ref|ZP_06898458.1| protoheme IX farnesyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296263327|gb|EFH09845.1| protoheme IX farnesyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 322

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 144/293 (49%), Positives = 195/293 (66%), Gaps = 6/293 (2%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYY 64
           +  +  ++ LLKPRVMSL ++T  VG+++APG I  + +  +I  IA+ AGASGA+NM+Y
Sbjct: 27  LSEVRDWVALLKPRVMSLVVFTGLVGLLVAPGQIHPVLAATAILCIAVAAGASGAINMWY 86

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D DID +M RTASRPIP G+I    A   GV L ++S+V+MGLA NWV+A +L  SI  Y
Sbjct: 87  DRDIDAVMRRTASRPIPAGRIRAEAALSFGVFLGLASVVLMGLATNWVAAAVLAGSIGFY 146

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V IYT+WLKR TPQNIVIGG AGA PPMIGWA+VTG VS+ ++VMF IIF WTPPHFW+L
Sbjct: 147 VFIYTMWLKRRTPQNIVIGGAAGAFPPMIGWAAVTGHVSVEAVVMFAIIFFWTPPHFWAL 206

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           +L    DY +A +PMLP V   + T+  I +Y+++ + +G++PT++G A + YG     L
Sbjct: 207 SLFASGDYARAGVPMLPVVAGAKETRRQIWLYSLVMAPLGLVPTLIGMAGLAYGAAALVL 266

Query: 245 GYHFTLWAWRTFLCKEDKDIRV------TKKLFLESITYLFVLFTILMVDHLI 291
           G  F    WR     +D++ R        +  F  SI YLF+LF  L  D L+
Sbjct: 267 GLFFLDSMWRVKRDAQDEEGRSLTNEAPARAAFKFSILYLFMLFAALAADRLV 319


>gi|31792645|ref|NP_855138.1| protoheme IX farnesyltransferase [Mycobacterium bovis AF2122/97]
 gi|121637381|ref|YP_977604.1| protoheme IX farnesyltransferase [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|224989856|ref|YP_002644543.1| protoheme IX farnesyltransferase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|260186395|ref|ZP_05763869.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis
           CPHL_A]
 gi|289447052|ref|ZP_06436796.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis CPHL_A]
 gi|81422322|sp|Q7U021|COXX_MYCBO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639215|sp|A1KIP0|COXX_MYCBP RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|254765943|sp|C1AN96|COXX_MYCBT RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|31618235|emb|CAD96153.1| PROBABLE CYTOCHROME C OXIDASE ASSEMBLY FACTOR CTAB [Mycobacterium
           bovis AF2122/97]
 gi|121493028|emb|CAL71499.1| Probable cytochrome C oxidase assembly factor ctaB [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|224772969|dbj|BAH25775.1| protoheme IX farnesyltransferase [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|289420010|gb|EFD17211.1| cytochrome C oxidase assembly factor ctaB [Mycobacterium
           tuberculosis CPHL_A]
          Length = 308

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 163/294 (55%), Gaps = 3/294 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           +  L  ++ L KPRV+ L + TA   ++LA  G I  L  + ++    M A  +  LN  
Sbjct: 17  MSTLLAYLALTKPRVIELLLVTAIPAMLLADRGAIHPLLMLNTLVGGMMAATGANTLNCV 76

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            DADIDK+M RTA RP+    +    A  LG++L V S   +  A N ++  L  +++  
Sbjct: 77  ADADIDKVMKRTARRPLAREAVPTRNALALGLTLTVISFFWLWCATNLLAGVLALVTVAF 136

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+WLKR T QN+V GG AG +P MIGW+++TG ++  +L MF IIF WTPPH W+
Sbjct: 137 YVFVYTLWLKRRTSQNVVWGGAAGCMPVMIGWSAITGTIAWPALAMFAIIFFWTPPHTWA 196

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K DYQ A +PMLP V T+R     ILIYT LT    ++  +    S  YG +   
Sbjct: 197 LAMRYKQDYQVAGVPMLPAVATERQVTKQILIYTWLTVAATLVLALA--TSWLYGAVALV 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            G  F   A + +      +     +LFL+S  YL V+F  L VD +I + T+ 
Sbjct: 255 AGGWFLTMAHQLYAGVRAGEPVRPLRLFLQSNNYLAVVFCALAVDSVIALPTLH 308


>gi|256823546|ref|YP_003147509.1| protoheme IX farnesyltransferase [Kangiella koreensis DSM 16069]
 gi|256797085|gb|ACV27741.1| protoheme IX farnesyltransferase [Kangiella koreensis DSM 16069]
          Length = 315

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 107/289 (37%), Positives = 162/289 (56%), Gaps = 8/289 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-----HISVLKSVISIFAIAMGAGASGALNM 62
              +  L KP+V+ L ++TA VG+ LA          +   +     IA  +GA+  +N 
Sbjct: 24  WRDYYELTKPKVVYLLVFTAVVGMFLANDVTQSWFPPLSALIFGTLGIAFASGAAAVVNH 83

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             DA ID MMART  RP+  G++ P  A +   +LA+ ++ ++   +N ++A L    + 
Sbjct: 84  VVDARIDTMMARTMQRPVAQGRVKPRNAVIFSAALAIVAMAMLWFLVNPLTAVLTLGGLV 143

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y  +YT++LKR TPQNIVIGG++GAIPP++GW SVTG     + ++ LIIF WTPPHFW
Sbjct: 144 GYAFVYTMFLKRATPQNIVIGGLSGAIPPLLGWTSVTGSADPHAWLLVLIIFTWTPPHFW 203

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +L++   +DY KA IPMLP    +  TK  I++YTVL  +  +LP + G + + Y +   
Sbjct: 204 ALSIHRIEDYAKAEIPMLPVTHGEDFTKTSIVLYTVLLILSTILPYLTGMSGIIYLVAAV 263

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            LG  F  +       + +    +  K F  SI YL  LF  L++DH +
Sbjct: 264 ALGLWFLYYTVVLKYREREG---IAMKTFGVSIGYLTFLFAFLLIDHYV 309


>gi|152987657|ref|YP_001345584.1| protoheme IX farnesyltransferase [Pseudomonas aeruginosa PA7]
 gi|205716272|sp|A6UXP9|CYOE1_PSEA7 RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|150962815|gb|ABR84840.1| protoheme IX farnesyltransferase [Pseudomonas aeruginosa PA7]
          Length = 304

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 115/294 (39%), Positives = 173/294 (58%), Gaps = 8/294 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-----PGHISVLKSVISIFAIAMGAGASGALNM 62
              F+ L KP+V+ L + T+ +G++LA      G +     +     I + AGA+ A+N 
Sbjct: 13  WRDFLELTKPKVVVLMLITSLIGMLLATKAPLDGFVPWQVLIFGNLGIGLCAGAAAAVNH 72

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             D  ID +MART  RP+  G++SP  A    + LA++ + ++    N ++A L   S+ 
Sbjct: 73  VVDRRIDSIMARTHKRPLAEGRVSPSMALGFALLLALAGMAVLLAFTNPLTAWLTLASLL 132

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y  +YT +LKR TPQNIVIGG+AGA PP++GW ++TG +S   L++ LIIF WTPPHFW
Sbjct: 133 GYAALYTGFLKRATPQNIVIGGLAGAAPPLLGWVAITGHLSAEPLLLVLIIFAWTPPHFW 192

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +L +  KD+Y KA IPMLP    +R TK+HIL+YT++   V ++P ++  + + Y +   
Sbjct: 193 ALCIHRKDEYAKADIPMLPVTHGERYTKLHILLYTLVLFAVSLMPFVIHMSGLVYLLCAL 252

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            LG  F  WAW  +    D       + F  SI YLF+LF  L+VDH + +K +
Sbjct: 253 ALGARFLDWAWALYC---DSRPHAAIRTFKYSIVYLFLLFMALLVDHYLPLKLL 303


>gi|182639245|sp|Q0S0I5|COXX_RHOSR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 301

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 107/295 (36%), Positives = 170/295 (57%), Gaps = 3/295 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KPRV+ L +      ++LA  G++ +   + ++F   MGA ++ +LN   D
Sbjct: 8   KVLAYIALTKPRVIELLLVATIPAMLLADRGNVDIALILSTLFGGWMGAASANSLNCVVD 67

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADIDK+M RTA RP+    +    A+V G++L V+S + +    N ++  L+ ++I  YV
Sbjct: 68  ADIDKVMKRTARRPLARDAVPTSHAFVFGMTLGVASFLWLWWRANLLAGCLVVLTIAFYV 127

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           ++YT+ LKR T QN+V GG AG +P M+GW++VTG +S   +V+FL+IF WTPPH W+LA
Sbjct: 128 LVYTMVLKRRTWQNVVWGGAAGCMPVMVGWSAVTGSLSWQPIVLFLVIFFWTPPHTWALA 187

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY+ A +PMLP + T+      IL+Y+     V    T++  A V Y  +    G
Sbjct: 188 MRYKEDYKAAGVPMLPVIATEEHVTKQILLYSWAM--VITSLTLVPAAGVVYAAVTLVAG 245

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             F L A + +            +LFL+S  YL V+F  L VD ++ ++TV    
Sbjct: 246 AWFLLMAHQLYRSVRGGAAVKPLRLFLQSNNYLAVVFVGLAVDSVLGLQTVGSLL 300


>gi|254504815|ref|ZP_05116966.1| protoheme IX farnesyltransferase [Labrenzia alexandrii DFL-11]
 gi|222440886|gb|EEE47565.1| protoheme IX farnesyltransferase [Labrenzia alexandrii DFL-11]
          Length = 311

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 151/285 (52%), Positives = 206/285 (72%), Gaps = 1/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ ++ LLKPRVMSL I+TAFVG++LAPG I  +   ++I  IA+GAGASGALNM+YDAD
Sbjct: 24  VSDYVALLKPRVMSLVIFTAFVGMMLAPGSIHPVLGAVAILCIAIGAGASGALNMWYDAD 83

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M+RTA RPIP G+I+P EA+  G++L++ S++ +GL +NW +   L  +I  YVVI
Sbjct: 84  IDEVMSRTAKRPIPAGKITPEEAFAFGITLSIGSVLTLGLLVNWFAGAFLAFTIAFYVVI 143

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PPM+GWASVTG VS+ S V+FLIIF+WTPPHFW+LAL 
Sbjct: 144 YTMWLKRSTPQNIVIGGAAGAFPPMVGWASVTGGVSLESFVLFLIIFMWTPPHFWALALF 203

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY+ A +PMLP V  +  T+  ILIY++L + +GV P  +G+AS+ YG+    LG  
Sbjct: 204 KKGDYETAGVPMLPVVAGETNTRHQILIYSILLAPIGVAPYFMGYASLFYGVASGLLGLA 263

Query: 248 FTLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   A   +  +E     +   +LF  SI YLF+LF +L+ + L+
Sbjct: 264 FVAMAADIWRKREGDVARKACIRLFKFSIFYLFMLFALLLGESLV 308


>gi|167585379|ref|ZP_02377767.1| protoheme IX farnesyltransferase [Burkholderia ubonensis Bu]
          Length = 300

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     V     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWRVLVGGTIGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTAQILLFSGVLGSLGAWTLYTFTNALTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+      D+   + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIHREYSDE---LARKAFRYSIVYLSLLFAALLVDHY 293


>gi|295687730|ref|YP_003591423.1| protoheme IX farnesyltransferase [Caulobacter segnis ATCC 21756]
 gi|295429633|gb|ADG08805.1| protoheme IX farnesyltransferase [Caulobacter segnis ATCC 21756]
          Length = 337

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 129/312 (41%), Positives = 182/312 (58%), Gaps = 21/312 (6%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           R   +  L+KPRVMSL ++T   G++ A   I  +   +++  IA+GAGASGALNM+YDA
Sbjct: 23  RWQDYFQLMKPRVMSLVVFTGLTGLLAARAPIHPILGAVAVLCIAIGAGASGALNMWYDA 82

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P G++   EA  LGV L++ S++ +G AINW +A LL  +I  Y V
Sbjct: 83  DIDQQMRRTRGRPVPAGKVKGEEAASLGVVLSLLSVMFLGFAINWFAAGLLAFTIVFYAV 142

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR+T QNIVIGG+AGA+PP IGWA+ TG   + + +M  IIF WTPPHFW+L+L
Sbjct: 143 VYTMWLKRWTAQNIVIGGLAGALPPAIGWAAATGHAPLNAWLMVAIIFFWTPPHFWALSL 202

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA +PMLP V   R T+  IL+Y+++   + + P + G     Y  +    G 
Sbjct: 203 YVTTDYAKAGVPMLPVVKGARETRKQILLYSLVFVPICLAPVLTGLGGPFYLAVAALGGA 262

Query: 247 HFTLWAWRTFLCK---------------------EDKDIRVTKKLFLESITYLFVLFTIL 285
            F L A R F  K                          +  + LF  SI YLF LF  L
Sbjct: 263 VFLLLAARVFASKAGDAADPRVADRALYEVTEDERAAGAKAARNLFAFSILYLFALFAAL 322

Query: 286 MVDHLIDMKTVE 297
           + + ++ ++ +E
Sbjct: 323 LGEAVMGVRALE 334


>gi|182639236|sp|Q9XAC2|COXX_STRCO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 315

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 105/289 (36%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G  ++   +++     + AG + ALNMY D
Sbjct: 26  RVKAFVALTKPRIIELLLITTVPVMFLAEQGVPNLKLVLLTCVGGYLSAGGANALNMYID 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E  V G++LA+ S ++ G  +NW+SA L   ++  YV
Sbjct: 86  RDIDALMDRTSQRPLVTGMVSPVECLVFGITLAIVSTLLFGFTVNWLSAWLSLGALLFYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  +S A +++F ++F WTPPH+W L+
Sbjct: 146 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWSAVTNSMSWAPVILFGVMFFWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP + +++     I+IY+ +  +V +L   LG+    Y  +    G
Sbjct: 206 MKVKEDYARVGVPMLPVIASNKVVARQIVIYSWVMVVVSLLLQPLGYTGWFYTAVALAAG 265

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ VLF  + VD  +
Sbjct: 266 GMWLWEAHGLQNRAKAEVTGGKLKEMRLFHWSITYVSVLFLAIAVDPFL 314


>gi|209548210|ref|YP_002280127.1| protoheme IX farnesyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226723590|sp|B5ZSV2|COXX_RHILW RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|209533966|gb|ACI53901.1| protoheme IX farnesyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 316

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 159/283 (56%), Positives = 202/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI  +  +I+I  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYFELLKPRVMSLVVFTAFAGLVLAPGHIHPVLGLIAILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I+P EA   G+ L+  S+VI+GLA+NW+SA +L  +IF Y V+Y
Sbjct: 82  DAIMSRTAKRPIPAGRIAPSEALAFGLVLSGFSVVILGLAVNWLSAGILAFTIFFYAVVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VT  V+I S V+FLIIFLWTP HFW+LAL  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTNSVTIESTVLFLIIFLWTPAHFWALALFK 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY+   +PMLPNV  +R TK  I+ Y VLT++ G+LP+ LGFAS  YG++   LG  F
Sbjct: 202 MRDYEAVGVPMLPNVAGERVTKHQIVAYAVLTAVCGILPSFLGFASFGYGLVAAALGAIF 261

Query: 249 TLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHL 290
              +   +   +    +   KKLF  SI YLF +F+ LM+D L
Sbjct: 262 IYCSIAVWRMPDGDLKMIPAKKLFAFSIFYLFAVFSALMIDRL 304


>gi|163760333|ref|ZP_02167415.1| protoheme IX farnesyltransferase protein [Hoeflea phototrophica
           DFL-43]
 gi|162282284|gb|EDQ32573.1| protoheme IX farnesyltransferase protein [Hoeflea phototrophica
           DFL-43]
          Length = 312

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 154/283 (54%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  LLKPRVMSL ++TAFVG++LAPG I  +   ++I  IA+GAGASGALNM+YDADID
Sbjct: 22  DYFALLKPRVMSLVVFTAFVGMLLAPGEIHPVLGFLAIVCIAVGAGASGALNMWYDADID 81

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RTA RP+P G++S       G+ L+V S+ ++GL +NW+SA LL  +IF Y VIYT
Sbjct: 82  VLMGRTAKRPVPAGKVSAETTLAFGLFLSVFSVGVLGLTVNWLSAGLLAFTIFFYAVIYT 141

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TP NIVIGG AGA PP+IGWA VT  +SI S+V+F IIFLWTP HFW+LAL   
Sbjct: 142 MWLKRSTPHNIVIGGAAGAFPPIIGWACVTNSISIESIVLFSIIFLWTPAHFWALALFKS 201

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY +A +PMLPNV  +R TK  I++Y VLT+I GV+PT++GFA + YGI+   LG  F 
Sbjct: 202 ADYGRAGVPMLPNVSGERATKHQIVLYAVLTAISGVVPTLMGFAGIVYGIVAAALGVAFI 261

Query: 250 LWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++ +T+   + D+ +   KKLF  S+ YLF +FT L VD L+
Sbjct: 262 WYSVKTWQMPDGDEKMIPAKKLFGYSLLYLFGVFTALAVDGLV 304


>gi|289772345|ref|ZP_06531723.1| protoheme IX farnesyltransferase [Streptomyces lividans TK24]
 gi|289702544|gb|EFD69973.1| protoheme IX farnesyltransferase [Streptomyces lividans TK24]
          Length = 317

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 105/289 (36%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G  ++   +++     + AG + ALNMY D
Sbjct: 28  RVKAFVALTKPRIIELLLITTVPVMFLAEQGVPNLKLVLLTCVGGYLSAGGANALNMYID 87

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E  V G++LA+ S ++ G  +NW+SA L   ++  YV
Sbjct: 88  RDIDALMDRTSQRPLVTGMVSPVECLVFGITLAIVSTLLFGFTVNWLSAWLSLGALLFYV 147

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  +S A +++F ++F WTPPH+W L+
Sbjct: 148 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWSAVTNSMSWAPVILFGVMFFWTPPHYWPLS 207

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP + +++     I+IY+ +  +V +L   LG+    Y  +    G
Sbjct: 208 MKVKEDYARVGVPMLPVIASNKVVARQIVIYSWVMVVVSLLLQPLGYTGWFYTAVALAAG 267

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ VLF  + VD  +
Sbjct: 268 GMWLWEAHGLQNRAKAEVTGGKLKEMRLFHWSITYVSVLFLAIAVDPFL 316


>gi|296392902|ref|YP_003657786.1| protoheme IX farnesyltransferase [Segniliparus rotundus DSM 44985]
 gi|296180049|gb|ADG96955.1| protoheme IX farnesyltransferase [Segniliparus rotundus DSM 44985]
          Length = 318

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 100/293 (34%), Positives = 159/293 (54%), Gaps = 3/293 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             ++ L KPRV+ L +      ++LA  G + +   + ++F   +GA ++  LN   DAD
Sbjct: 27  RDYLALTKPRVIELLLVATIPVMLLAHRGTVDLRLILETLFGGWLGAASANTLNCVVDAD 86

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           IDK+M RT +RP+  G +S   A + G+ L  +S + +  + N ++A+L+  +I  YV++
Sbjct: 87  IDKVMDRTKNRPLARGAMSRRAALLFGLGLGSASFLWLWRSANLLAASLVVATIAFYVLV 146

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y+++LKR T QN+V GG AG +P ++GWA+VTG +   +LV+F++IF WTPPH WSLA+ 
Sbjct: 147 YSMFLKRRTSQNVVWGGAAGCMPALVGWAAVTGSLDWPALVVFMVIFFWTPPHTWSLAMK 206

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +DDY  A +PMLP V  +R     ++ YT  T +      ++    + Y  +    G  
Sbjct: 207 YRDDYSTAGVPMLPTVADERLVAKRMVWYTWATVLTTFA--LIPVVGLLYAGVAIAAGSW 264

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
           F   A R              +LFL+S  YL  +F  L VD  +   TV    
Sbjct: 265 FLYEAHRLSAGLAAGRPVTPFRLFLQSNNYLAAVFVGLAVDSALAWPTVASLL 317


>gi|254412158|ref|ZP_05025933.1| protoheme IX farnesyltransferase [Microcoleus chthonoplastes PCC
           7420]
 gi|196181124|gb|EDX76113.1| protoheme IX farnesyltransferase [Microcoleus chthonoplastes PCC
           7420]
          Length = 342

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T   G+ +A  G +     +I++    + A ++  LN  YD 
Sbjct: 32  IQSYYQLTKPRIIPLLLITTAAGMWMASEGQVDPFLLLITLVGGTLAAASAQVLNCIYDR 91

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT SRPIP G+I   +A +  ++L  +S  ++ +  N ++A L    I  Y+ 
Sbjct: 92  DIDYEMLRTRSRPIPSGRIQTRDALLFAIALGSASFTLLAVFANLLAALLAMSGIIFYMG 151

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT  LKR TPQNIVIGG AGAIP ++GWA+VTG++S+ + ++F ++FLWTPPHFW+LAL
Sbjct: 152 IYTHLLKRHTPQNIVIGGAAGAIPALVGWAAVTGELSLPAWLLFAVVFLWTPPHFWALAL 211

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + ++DY K  IPMLP V  + +T   I +YT+L     +L     G + V YG I   LG
Sbjct: 212 MIREDYAKVGIPMLPVVAGEESTTRQIWVYTLLVVPASLLFIYPLGVSGVVYGAIALVLG 271

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+        + ++ + LF  SI Y+ +L T ++VD L
Sbjct: 272 SIFLQKAWQLLQS--PTNNQLARGLFKYSILYMMLLCTGIVVDSL 314


>gi|83954524|ref|ZP_00963235.1| protoheme IX farnesyltransferase [Sulfitobacter sp. NAS-14.1]
 gi|83840808|gb|EAP79979.1| protoheme IX farnesyltransferase [Sulfitobacter sp. NAS-14.1]
          Length = 311

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 129/289 (44%), Positives = 181/289 (62%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   +  L+KPRVM L ++TA VG++ AP  +  +    SI  +A+GAGASGALNM++DA
Sbjct: 15  QFGDYFALMKPRVMQLVVFTALVGMLAAPESVHPVIGFASILFVAIGAGASGALNMWWDA 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P EA  +GV+L+  S+V++GLA N ++A +L  +I  Y V
Sbjct: 75  DIDAIMRRTQGRPIPSGRVQPGEALAIGVALSGMSVVMLGLAANLLAAGMLLFTILFYAV 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            Y++WLKR TPQNIVIGG AGA PP+IGW   TG  S+ + +MF +IF+WTPPHFW+LAL
Sbjct: 135 FYSMWLKRATPQNIVIGGAAGAFPPVIGWIIATGSFSVEAWLMFALIFMWTPPHFWALAL 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PML      R+T+ HIL YTVL  I+ V           Y      L  
Sbjct: 195 FMRNDYDDAKVPMLTVTHGRRSTRRHILAYTVLLVILAVGTGFTSIGGPIYLATAGVLNL 254

Query: 247 HFTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F + A+R +   ED     D RV +K F  S+ YLF+ F  ++++  +
Sbjct: 255 LFLVGAFRIWQRDEDDSEADDFRVERKFFRLSLWYLFLHFGAILLEATL 303


>gi|21220420|ref|NP_626199.1| protoheme IX farnesyltransferase [Streptomyces coelicolor A3(2)]
 gi|5459401|emb|CAB50759.1| putative cytochrome oxidase assembly factor [Streptomyces
           coelicolor A3(2)]
          Length = 340

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 105/289 (36%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G  ++   +++     + AG + ALNMY D
Sbjct: 51  RVKAFVALTKPRIIELLLITTVPVMFLAEQGVPNLKLVLLTCVGGYLSAGGANALNMYID 110

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E  V G++LA+ S ++ G  +NW+SA L   ++  YV
Sbjct: 111 RDIDALMDRTSQRPLVTGMVSPVECLVFGITLAIVSTLLFGFTVNWLSAWLSLGALLFYV 170

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  +S A +++F ++F WTPPH+W L+
Sbjct: 171 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWSAVTNSMSWAPVILFGVMFFWTPPHYWPLS 230

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP + +++     I+IY+ +  +V +L   LG+    Y  +    G
Sbjct: 231 MKVKEDYARVGVPMLPVIASNKVVARQIVIYSWVMVVVSLLLQPLGYTGWFYTAVALAAG 290

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ VLF  + VD  +
Sbjct: 291 GMWLWEAHGLQNRAKAEVTGGKLKEMRLFHWSITYVSVLFLAIAVDPFL 339


>gi|220906638|ref|YP_002481949.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 7425]
 gi|254765937|sp|B8HMH3|COXX_CYAP4 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|219863249|gb|ACL43588.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 7425]
          Length = 324

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 120/285 (42%), Positives = 170/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  +  L KPR++ L + T   G+ +A  G +  + ++I++   AM AG++  +N  YD 
Sbjct: 20  LLNYYQLTKPRLIVLFLITTAAGMWVAARGEVDPVLALITLLTGAMAAGSANTINCLYDR 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RP+P G++ PWEA V  ++LAV +  +  L  N +SA L    I  YV 
Sbjct: 80  DIDYIMERTRHRPLPSGRVQPWEALVFAIALAVGAFSLQTLCANLLSACLEMAGIAVYVG 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR + QNIVIGG AGAIPP++GWA+VTG++S A+ V+F IIF+WTPPHFW LA+
Sbjct: 140 VYTHWLKRSSTQNIVIGGAAGAIPPLVGWAAVTGELSWAAWVLFAIIFIWTPPHFWPLAM 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFA-SVTYGIIVFFLG 245
           L ++DY K ++PM+P V  DR T   I  YT++     +L      A  + YG I   LG
Sbjct: 200 LIQEDYAKVNVPMMPVVDGDRPTAWQIFGYTLVLLPTTLLLVYPLHACGLIYGAIALVLG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW      EDKD    + +F  SI Y+ +L   + +D L
Sbjct: 260 VVFIRKAWELVQTPEDKDQ--ARAVFKFSILYMMILCAAMGIDSL 302


>gi|83943951|ref|ZP_00956408.1| protoheme IX farnesyltransferase [Sulfitobacter sp. EE-36]
 gi|83845198|gb|EAP83078.1| protoheme IX farnesyltransferase [Sulfitobacter sp. EE-36]
          Length = 311

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 129/289 (44%), Positives = 181/289 (62%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   +  L+KPRVM L ++TA VG++ AP  +  +    SI  +A+GAGASGALNM++DA
Sbjct: 15  QFGDYFALMKPRVMQLVVFTALVGMLAAPESVHPVIGFASILFVAIGAGASGALNMWWDA 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P EA  +GV+L+  S+V++GLA N ++A +L  +I  Y V
Sbjct: 75  DIDAIMRRTQGRPIPSGRVQPGEALAIGVALSGMSVVMLGLAANLLAAGMLLFTILFYAV 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            Y++WLKR TPQNIVIGG AGA PP+IGW   TG  S+ + +MF +IF+WTPPHFW+LAL
Sbjct: 135 FYSMWLKRATPQNIVIGGAAGAFPPVIGWIIATGSFSVEAWLMFALIFMWTPPHFWALAL 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PML      R+T+ HIL YTVL  I+ V           Y      L  
Sbjct: 195 FMRNDYDDAKVPMLTVTHGRRSTRRHILAYTVLLVILAVGTGFTSIGGPIYLATAGVLNL 254

Query: 247 HFTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F + A+R +   ED     D RV +K F  S+ YLF+ F  ++++  +
Sbjct: 255 LFLIGAFRIWQRDEDDSEADDFRVERKFFRLSLWYLFLHFGAILLEATL 303


>gi|295395296|ref|ZP_06805500.1| protoheme IX farnesyltransferase [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971847|gb|EFG47718.1| protoheme IX farnesyltransferase [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 330

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 101/291 (34%), Positives = 150/291 (51%), Gaps = 4/291 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            +   +I L KPRV+ L + T    + LA  G       + ++   +  A ++   N Y 
Sbjct: 37  SKFRAYIALTKPRVIELLLVTTAPVMFLAQRGLPDWWLILATLVGGSAAAASASVFNCYL 96

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D DID  M RT +RP+  G+++P EA V   +L + SI  MG   NWV+A L  ++I  Y
Sbjct: 97  DRDIDAKMHRTENRPLVTGEVTPREALVFAFALGIGSIFWMGGFTNWVAAGLTAIAILLY 156

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           VV YTI LKR T QNIV GG AG +P +IGW++VTG +++   ++FL++F WTPPH+W L
Sbjct: 157 VVFYTIMLKRHTTQNIVWGGAAGCMPVLIGWSAVTGSLALEPFILFLVVFFWTPPHYWPL 216

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  K DY  A +PMLP+ V   +    I++Y     +  +    L      Y  +    
Sbjct: 217 AIKYKRDYDAAGVPMLPSKVPPASVGKQIILYAWAMVLSSLALIPLAPMGPLYISVAVLA 276

Query: 245 GYHFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           G  F    +      +           K+F  SITYL VLF  + +D  ++
Sbjct: 277 GAWFLYECYTFVRRAKQGLSGTRLRAMKVFHGSITYLSVLFLAVAIDPFLN 327


>gi|260777097|ref|ZP_05885991.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260606763|gb|EEX33037.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 298

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 118/285 (41%), Positives = 178/285 (62%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA PG + V +S++ +  IA+ AG++ A N   D 
Sbjct: 16  WRTYLTLTKPKVVALMLLTALVGMCLAVPGSLPVQQSILGMLGIALMAGSAAAFNHLIDR 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+P G+++    +     + ++  V++ + +N ++A L F S+  Y V
Sbjct: 76  RIDAVMARTYKRPLPSGELNVRNVFAFATGIGLAGFVVLYVWVNALTAWLTFASLLGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 136 IYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGEMHANAWLLVMIIFIWTPPHFWALAI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY KA IPMLP    +  TK  IL+YTVL  IV + P ++G A V Y   V  L  
Sbjct: 196 HRKEDYAKADIPMLPVTHGEEYTKTSILLYTVLLLIVCLFPVLVGMAGVFYLASVTILSA 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW+    K   D +   K F  SI +L +LF+ L+ +H +
Sbjct: 256 LFVYHAWKL---KFGTDEKQAIKTFKFSIWHLMLLFSALLAEHYL 297


>gi|254251350|ref|ZP_04944668.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia dolosa
           AUO158]
 gi|124893959|gb|EAY67839.1| 4-hydroxybenzoate octaprenyltransferase [Burkholderia dolosa
           AUO158]
          Length = 300

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  +D MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKVDAMMRRTAWRPSARGEITTPQILLFSAVLGSLGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIY---RDYSDALARKAFRYSIVYLSLLFAALLVDHY 293


>gi|134297028|ref|YP_001120763.1| protoheme IX farnesyltransferase [Burkholderia vietnamiensis G4]
 gi|182639198|sp|A4JI25|COXX_BURVG RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|134140185|gb|ABO55928.1| protoheme IX farnesyltransferase [Burkholderia vietnamiensis G4]
          Length = 300

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWRVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKIDAMMRRTAWRPSARGEITTPQILLFSAVLGSIGAWTLYTFTNPLTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEQYTRLHILLYTVILFAVTLMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L+VDH 
Sbjct: 251 GAVFLAYAWKIY---RDYSDALARKAFRYSIVYLSLLFAALLVDHY 293


>gi|145595606|ref|YP_001159903.1| protoheme IX farnesyltransferase [Salinispora tropica CNB-440]
 gi|145304943|gb|ABP55525.1| protoheme IX farnesyltransferase [Salinispora tropica CNB-440]
          Length = 342

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 157/286 (54%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    ++LA G   S+    + +   ++ AGA+  LN Y D 
Sbjct: 57  VAAYVALTKPRIVELLLVTTVPAMMLAHGGLPSLWLMAVVLVGGSLAAGAASVLNCYIDR 116

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+P   ++P  A + G+ LA  S+ ++ +  N ++A L   +I  Y +
Sbjct: 117 DIDQVMRRTKRRPLPAHTVAPRNALIFGLVLATVSVTLLAVFTNALAAGLTLAAILYYDL 176

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR T  N   GG  GA P +IGWA+VTG ++ A+  +F ++F W  PHF+ LA+
Sbjct: 177 VYTAWLKRTTTANTFWGGACGAAPVLIGWAAVTGSLAPAAWALFGVVFFWQMPHFYPLAM 236

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLG-FASVTYGIIVFFLG 245
             KDDY +A IPMLP V + R     IL++  LT +V ++   LG      YG+    +G
Sbjct: 237 KYKDDYARAGIPMLPVVASTRRVNAEILVFAWLTVLVSLVTWPLGAGMGPIYGLPTLVVG 296

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F + A R        +     +LF  S TYL V+F  + +D LI
Sbjct: 297 VIFLVEAHRLCRRAARGEAVKPMRLFHWSTTYLTVVFAAVALDALI 342


>gi|150395744|ref|YP_001326211.1| protoheme IX farnesyltransferase [Sinorhizobium medicae WSM419]
 gi|182639230|sp|A6U6U6|COXX_SINMW RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|150027259|gb|ABR59376.1| protoheme IX farnesyltransferase [Sinorhizobium medicae WSM419]
          Length = 316

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 158/284 (55%), Positives = 205/284 (72%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G++LAPGHI+      +I  IA+GAGASGALNM+YDADI
Sbjct: 24  RDYFELLKPRVMSLVVFTAFAGLILAPGHINPFIGFTAILCIAIGAGASGALNMWYDADI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I P EA   G++L+  S++I+GLA++W++A LL  +IF YV +Y
Sbjct: 84  DAVMSRTAKRPIPAGKILPQEALAFGLTLSAFSVIILGLAVHWLAAGLLAFTIFFYVAVY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VTG +S+ S+V+FLIIFLWTP HFW+LAL  
Sbjct: 144 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTGGISVESIVLFLIIFLWTPAHFWALALFK 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             +Y    +PM+PNV  + TTK  I+IY VLT+I G+ PT+LGFAS+ YG +   LG  F
Sbjct: 204 MGEYGAVGVPMMPNVCGEATTKRQIVIYAVLTAISGICPTLLGFASLGYGALATALGLGF 263

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++       E DK +   KKLF  SI YLF +F+ L+VD+ I
Sbjct: 264 VGYSLGVLRMPEGDKRMVPAKKLFAFSIVYLFAIFSALLVDYAI 307


>gi|311696671|gb|ADP99544.1| protoheme IX farnesyltransferase [marine bacterium HP15]
          Length = 306

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 119/287 (41%), Positives = 172/287 (59%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV++L I T+ +G++LA PG       V     IA+ AGA+  +N   D 
Sbjct: 23  WRDYLELTKPRVVALMILTSVIGMLLAAPGVPGWGVLVWGNLGIALLAGAAAVVNHVVDQ 82

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+ISP +A +    LA   + ++   +N ++A L   S+  Y  
Sbjct: 83  KIDTVMARTRKRPVATGKISPVDAILFATILACVGMAVLMWQVNHLTAWLTLASLVGYAG 142

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNI IGG+AGA+PP++GW +VTG V   +L++ LIIF WTPPHFW+LA+
Sbjct: 143 VYTLFLKRATPQNITIGGLAGAMPPLLGWTAVTGQVEGHALLLVLIIFAWTPPHFWALAI 202

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    ++ T++HIL+YT++   V +LP + G +   Y +    LG 
Sbjct: 203 HRKEEYAKAGIPMLPVTHGNKFTELHILLYTLMLLAVSLLPFVTGMSGGIYLVGALALGL 262

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +A R        D RV    F  SITYL  LF +L+VDH +  
Sbjct: 263 RFLQYAVRLLK---GDDRRVALNTFKYSITYLMALFVVLLVDHFVFF 306


>gi|15827232|ref|NP_301495.1| protoheme IX farnesyltransferase [Mycobacterium leprae TN]
 gi|221229710|ref|YP_002503126.1| protoheme IX farnesyltransferase [Mycobacterium leprae Br4923]
 gi|13092781|emb|CAC30092.1| putative protoheme IX farnesyltransferase [Mycobacterium leprae]
 gi|219932817|emb|CAR70677.1| putative protoheme IX farnesyltransferase [Mycobacterium leprae
           Br4923]
          Length = 321

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 107/292 (36%), Positives = 160/292 (54%), Gaps = 3/292 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            R+  ++ L KPRV+ L + TA   ++LA  G  + L  + ++      A  +   N   
Sbjct: 31  SRVLAYLALTKPRVIELLLVTAIPAMLLADRGSANPLLILNTLLGGISAAAGANTFNCVA 90

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           DADIDK+M RT+ RP+    + P  A VLG++L   S   +    N +S  L   ++  Y
Sbjct: 91  DADIDKLMKRTSRRPLARAAVPPRNALVLGLALTAGSFFWLWWTTNLLSGLLALATVAFY 150

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YT+ LKR T QN+V GG AG +P MIGW+++T  +   +L MF IIF WTPPH W+L
Sbjct: 151 VFVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAITDTIGWPALAMFAIIFFWTPPHTWAL 210

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  KDDY+ AS+PMLP V T+R     ILIYT LT++  ++  +       Y  +    
Sbjct: 211 AMRYKDDYKVASVPMLPAVATERHVTKQILIYTWLTALSTLVLALA--TGWLYMAVAVVA 268

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           G  F   A + ++     +     +LFL+S  YL V+F  L VD ++ + T+
Sbjct: 269 GAWFLTMAHQLYVGVCAGEPVKPLRLFLQSNNYLAVVFCALAVDSVLALPTL 320


>gi|149187236|ref|ZP_01865534.1| protoheme IX farnesyltransferase [Vibrio shilonii AK1]
 gi|148838772|gb|EDL55711.1| protoheme IX farnesyltransferase [Vibrio shilonii AK1]
          Length = 305

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 179/288 (62%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
               ++ L KP+V++L I TA VG+ LA PG + V  +V+ +  IA+ AG++ A N   D
Sbjct: 21  NWRVYLTLTKPKVVALMILTALVGMCLAIPGALPVQATVLGLLGIALMAGSAAAFNHLID 80

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART  RP+P G +S  + +   +S+ V    I+ L +NW++A L F S+  Y 
Sbjct: 81  RRIDAVMARTHKRPLPSGDLSVGKVFTFALSIGVLGFAILALGVNWLTAWLTFASLLGYA 140

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA
Sbjct: 141 VVYTLYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHANAWLLVMIIFIWTPPHFWALA 200

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY KA IPMLP       TK  IL+YT+L ++V +LP ++G   + Y     FL 
Sbjct: 201 IHRKDDYAKADIPMLPVTHGIEYTKTSILLYTILLALVCLLPALVGMTGLVYLAGSTFLS 260

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F  +AW+    K     +     F  SI +L +LF +L+VDH + +
Sbjct: 261 AGFIYYAWKL---KYAATEKTAMDTFKFSIMHLMILFVVLLVDHYLPI 305


>gi|182637556|sp|A4F9B0|COXX1_SACEN RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
          Length = 312

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 111/290 (38%), Positives = 158/290 (54%), Gaps = 3/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KPRV+ L + T    + LA  G  S    ++++   AM AG++ ALN   D+
Sbjct: 23  LAAYLALTKPRVIELLLVTTVPAMFLAQRGIPSPWLVLVTLAGGAMSAGSANALNCVADS 82

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RP+   ++    A V G+ L V S  ++ L  N ++A L   +I  YV 
Sbjct: 83  DIDAVMDRTKKRPLVSYEVPRRSALVFGIVLGVVSFAVLALGANLLAAVLSLAAILFYVF 142

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GG AG +P +IGWA+VTG V   +LVMF ++FLWTPPHFWSLA+
Sbjct: 143 VYTLVLKRRTSQNIVWGGAAGCMPVVIGWAAVTGSVEWPALVMFGVVFLWTPPHFWSLAM 202

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY +A +PMLP V T R     IL+Y+  T    +L  ++   S  Y       G 
Sbjct: 203 KYREDYARAGVPMLPVVATPRQVSARILVYSWATVACTLL--LVPATSWVYVAFAVLAGA 260

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            F + A R              KLF  S +YL +LF  + VD  + + + 
Sbjct: 261 AFLIVAQRLHNSIRRGHAYNPMKLFHLSNSYLALLFVAIAVDSAVGLPSF 310


>gi|182641984|sp|A1TWQ8|CYOE_MARAV RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 302

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 120/289 (41%), Positives = 175/289 (60%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV++L I T+ +G++LA PG       +     IA+ AGA+  +N   D 
Sbjct: 17  WRDYLELTKPRVVALMILTSVIGMLLAAPGVPEWSVLLFGNLGIALLAGAAAVVNHVVDQ 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+I+P +A +    LA   +V++   +N ++A L   S+  Y  
Sbjct: 77  KIDTVMARTRKRPVATGRIAPLDALLFATVLAALGMVVLVWQVNELTAWLTLASLVGYAG 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA+PP++GW +VTG V   +L++ LIIF WTPPHFW+LA+
Sbjct: 137 VYTLFLKRATPQNIVIGGLAGAMPPLLGWTAVTGQVEGHALLLVLIIFAWTPPHFWALAI 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +R T++HIL+YT++   V +LP + G +   Y +    LG 
Sbjct: 197 HRKEEYAKAGIPMLPVTHGNRYTELHILLYTLMLLAVSLLPFVTGMSGGIYLVGALALGL 256

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            F  +A R        D RV    F  SITYL  LF +L+VDH + +  
Sbjct: 257 RFLQYAVRLL---RGDDRRVALNTFKYSITYLMALFVVLLVDHFVFVPA 302


>gi|162147884|ref|YP_001602345.1| protoheme IX farnesyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209542501|ref|YP_002274730.1| protoheme IX farnesyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|205693383|sp|A9HKH7|COXX_GLUDA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|161786461|emb|CAP56043.1| putative protoheme IX farnesyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530178|gb|ACI50115.1| protoheme IX farnesyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 315

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 137/292 (46%), Positives = 187/292 (64%), Gaps = 6/292 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRV+SL ++T   G+ +APG I+ L + +SI  I M +GA+GA+NM+YD DI
Sbjct: 24  RDWFALLKPRVISLVVFTGAAGLAMAPGPINPLIAAVSILCICMASGAAGAINMWYDRDI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA RPIP G+I   +A   G+ L+V+S+++M LA N ++A +L  SIF Y VIY
Sbjct: 84  DAVMTRTARRPIPDGRIRDDQALGFGIGLSVASVLLMWLAANALAAFILAFSIFFYAVIY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG + +  +VMF I+FLWTPPHFWSL+L  
Sbjct: 144 TMWLKRSTPQNIVIGGAAGAFPPMIGWAATTGSLGVLPVVMFAIVFLWTPPHFWSLSLYA 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY +A IPMLP V   R T+  IL YT++ S V ++P+ L  A   Y  +   L   F
Sbjct: 204 CKDYGRAGIPMLPVVRGARHTRWQILFYTLILSAVSLVPSFLHQAGWLYTGVASLLDAGF 263

Query: 249 TLWAWRTFLCKEDK------DIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
              A      ++D+        R  ++ F  S+ YLF+LF  L+ DH + M+
Sbjct: 264 VACAVGVLTDRQDEAGVSLTGDRPARRAFRYSLAYLFLLFCGLLADHFLIMR 315


>gi|269966182|ref|ZP_06180272.1| protoheme IX farnesyltransferase [Vibrio alginolyticus 40B]
 gi|269829329|gb|EEZ83573.1| protoheme IX farnesyltransferase [Vibrio alginolyticus 40B]
          Length = 299

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 114/284 (40%), Positives = 164/284 (57%), Gaps = 4/284 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
           ++ L KP+V++L + TA VG+ LAP      L++V+ +  I + AG++ A N   D  ID
Sbjct: 19  YLKLTKPKVVALMLVTAVVGMSLAPVDDFPWLQAVVGLTGIGLMAGSAAAFNHLIDRRID 78

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
             MART  RP+P G+  P         L V   V++   +N ++A L  MS+  Y ++YT
Sbjct: 79  ARMARTHKRPLPSGETKPSSVIAFATVLGVLGFVLLYAMVNPLTAWLTLMSLLGYAMVYT 138

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           ++LKR TPQNIVI GIAGA+PP++GW +VTG +   + ++ +IIF+WTPPHFW+LA+   
Sbjct: 139 MYLKRATPQNIVIAGIAGAMPPLLGWTAVTGQLHANAWLLVMIIFIWTPPHFWALAIHRV 198

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY+K  IPMLP       TK  IL+YTVL ++V VLP ++G   V Y      L   F 
Sbjct: 199 EDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVLPVLVGMVGVVYLFASLLLNAGFM 258

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             AW+    K   +     + F  SI +L  LF  L+ DH I  
Sbjct: 259 YHAWKL---KYAPEPNTAMETFKFSIYHLLALFIALLSDHYIGF 299


>gi|205696357|sp|A4X9F8|COXX_SALTO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 320

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 157/286 (54%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    ++LA G   S+    + +   ++ AGA+  LN Y D 
Sbjct: 35  VAAYVALTKPRIVELLLVTTVPAMMLAHGGLPSLWLMAVVLVGGSLAAGAASVLNCYIDR 94

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+P   ++P  A + G+ LA  S+ ++ +  N ++A L   +I  Y +
Sbjct: 95  DIDQVMRRTKRRPLPAHTVAPRNALIFGLVLATVSVTLLAVFTNALAAGLTLAAILYYDL 154

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR T  N   GG  GA P +IGWA+VTG ++ A+  +F ++F W  PHF+ LA+
Sbjct: 155 VYTAWLKRTTTANTFWGGACGAAPVLIGWAAVTGSLAPAAWALFGVVFFWQMPHFYPLAM 214

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLG-FASVTYGIIVFFLG 245
             KDDY +A IPMLP V + R     IL++  LT +V ++   LG      YG+    +G
Sbjct: 215 KYKDDYARAGIPMLPVVASTRRVNAEILVFAWLTVLVSLVTWPLGAGMGPIYGLPTLVVG 274

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F + A R        +     +LF  S TYL V+F  + +D LI
Sbjct: 275 VIFLVEAHRLCRRAARGEAVKPMRLFHWSTTYLTVVFAAVALDALI 320


>gi|254228905|ref|ZP_04922327.1| protoheme IX farnesyltransferase [Vibrio sp. Ex25]
 gi|262396748|ref|YP_003288601.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           sp. Ex25]
 gi|151938582|gb|EDN57418.1| protoheme IX farnesyltransferase [Vibrio sp. Ex25]
 gi|262340342|gb|ACY54136.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           sp. Ex25]
          Length = 299

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 114/284 (40%), Positives = 166/284 (58%), Gaps = 4/284 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDADID 69
           ++ L KP+V++L + TA VG+ LAP      L++ + +  I + AG++ A N   D  ID
Sbjct: 19  YLKLTKPKVVALMLVTAVVGMSLAPVTEFPWLQAAVGLTGIGLMAGSAAAFNHLIDRRID 78

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
             MART  RP+P G+  P        +L V   V++   +N ++A L  MS+  Y ++YT
Sbjct: 79  ARMARTHKRPLPSGEAKPLSVITFATALGVIGFVLLYALVNPLTAWLTLMSLLGYAMVYT 138

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           ++LKR TPQNIVI GIAGA+PP++GW +VTG +   + ++ +IIF+WTPPHFW+LA+   
Sbjct: 139 MYLKRATPQNIVIAGIAGAMPPLLGWTAVTGQLHANAWLLVMIIFIWTPPHFWALAIHRV 198

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY+K  IPMLP       TK  IL+YTVL ++V VLP ++G   V Y      L   F 
Sbjct: 199 EDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVLPVLVGMVGVVYLFASLLLNAGFM 258

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             AW+    K   +     + F  SI +LF LF  L+ DH I +
Sbjct: 259 YHAWKL---KYAPEPNTAMEAFKFSIYHLFALFIALLSDHYIGL 299


>gi|103486889|ref|YP_616450.1| protoheme IX farnesyltransferase [Sphingopyxis alaskensis RB2256]
 gi|123379862|sp|Q1GTA5|COXX_SPHAL RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|98976966|gb|ABF53117.1| protoheme IX farnesyltransferase [Sphingopyxis alaskensis RB2256]
          Length = 308

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 130/288 (45%), Positives = 178/288 (61%), Gaps = 2/288 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
               + L KPRVMSL ++TA  G++ APG +  +    SI AIA+GAGASGALN +Y+A 
Sbjct: 21  WRDLLALTKPRVMSLVVFTALCGLLAAPGDVHPVLGFSSILAIALGAGASGALNQWYEAG 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           +D  M RTA RP+P G++ P  A   G+ LA  S+ +M  A NW +  LL  SI  YVVI
Sbjct: 81  LDARMKRTAGRPLPAGRLDPQTALQFGIGLAAFSLFLMLFASNWQATVLLAGSILFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLK  TPQNIVIGG AGA PP+IGW + TG ++   +++FL+IFLWTPPHFW+LAL 
Sbjct: 141 YTMWLKPRTPQNIVIGGAAGAFPPLIGWVAATGSIAPLPVLLFLLIFLWTPPHFWALALF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A IPM+P V  +++T+  IL Y ++ +   + P  LG+    YG     L   
Sbjct: 201 VRSDYAAAGIPMMPVVAGEKSTRRQILFYALIMAAAAIAPWPLGYTGALYGWTAILLSAI 260

Query: 248 FTLWAWR--TFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F L + +       ED  ++  K+LF  SI YLF+LF  ++ DH   +
Sbjct: 261 FVLLSVQVGIRTTAEDDRMQPEKRLFAFSIAYLFILFGAVVADHWWPL 308


>gi|254495813|ref|ZP_05108725.1| protoheme IX farnesyltransferase [Legionella drancourtii LLAP12]
 gi|254354970|gb|EET13593.1| protoheme IX farnesyltransferase [Legionella drancourtii LLAP12]
          Length = 294

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 109/285 (38%), Positives = 172/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T  VG+ LA PG + +     S+F I + AG++ A+N   D 
Sbjct: 13  WRDYVELCKPRVVMLMLLTVLVGMYLAAPGWVHLPLLGTSLFGIGLCAGSAAAINHLVDR 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RPI  G++S  +A    + +    + ++ + +N ++A L F+++  Y  
Sbjct: 73  RIDSIMARTKKRPIAHGRVSVRQASWFALIMGGLGLTVLIIFVNKLTALLTFITLIGYAG 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW +VT  +   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 IYTGYLKRATPQNIVIGGLAGAAPPLLGWTAVTNHLDPQALLLVLIIFTWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              ++YQ A IPMLP     + TK+++ +YT+L  +V +LP ++G + + Y +    LG 
Sbjct: 193 YRHEEYQHAEIPMLPVTHGIQFTKLNVYLYTILLLVVSILPFVVGMSGLFYLMGALVLGA 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  WA + +   +     +  + F  SI YL +LF  L++DH +
Sbjct: 253 RFLFWAHKLYRTDK---SVIAMQTFRFSIVYLMLLFVFLLIDHYL 294


>gi|306845097|ref|ZP_07477677.1| protoheme IX farnesyltransferase [Brucella sp. BO1]
 gi|306274512|gb|EFM56307.1| protoheme IX farnesyltransferase [Brucella sp. BO1]
          Length = 315

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 148/283 (52%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYLVLLKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RPIP G I+P +    G++L+  S++ +GL +NW++A LL  +IF Y VIY
Sbjct: 82  DAVMKRTRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  S+V+F+IIFLWTPPHFW+L+L  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSVVLFMIIFLWTPPHFWALSLFT 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F
Sbjct: 202 TNDYEAARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAF 261

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 262 VYYAWRLWAADSQPQMLAAARKLFRFSLLYLAGIFAVLLFEAL 304


>gi|289705468|ref|ZP_06501860.1| protoheme IX farnesyltransferase [Micrococcus luteus SK58]
 gi|289557697|gb|EFD50996.1| protoheme IX farnesyltransferase [Micrococcus luteus SK58]
          Length = 327

 Score =  163 bits (411), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 169/294 (57%), Gaps = 3/294 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  ++ L KPRV+ L + T    ++ A  G   VL  + ++   A+ AGASG  N Y D
Sbjct: 31  KVRAYVELTKPRVIELLLVTTLPTMIFAQRGFPDVLTMIATLVGGALAAGASGTFNCYID 90

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT +RP+  G+++P  A V      V SI+I+G   NW++A L   +IF YV
Sbjct: 91  RDIDRVMKRTENRPLVTGEVTPRGALVFAWVQTVVSILILGFGANWLAAGLGVAAIFFYV 150

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+Y++ LKR T QNIV GGIAG  P +IGWA+V G V   ++V+FL++FLWTPPH+W L+
Sbjct: 151 VVYSLVLKRRTEQNIVWGGIAGCFPVLIGWAAVRGTVEWPAIVLFLVVFLWTPPHYWPLS 210

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K DYQ+A +PML  + + R     +++Y   T    +L   +G+A + Y  +   +G
Sbjct: 211 MKYKRDYQQADVPMLGAIASARHVSNQVVLYAWATVACSLLLVPMGWAGIVYTAVALVVG 270

Query: 246 YHFTL--WAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             F       +    +ED + R   K+F  SITYL +LF  L VD  +    + 
Sbjct: 271 GWFIWESHVLQVQAQREDFEDRKAMKVFHLSITYLTLLFIALAVDPFVGAPLMH 324


>gi|226306533|ref|YP_002766493.1| protoheme IX farnesyltransferase [Rhodococcus erythropolis PR4]
 gi|226185650|dbj|BAH33754.1| putative protoheme IX farnesyltransferase [Rhodococcus erythropolis
           PR4]
          Length = 301

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 103/295 (34%), Positives = 168/295 (56%), Gaps = 3/295 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KPRV+ L +      ++LA  G + ++  + ++F   MGA ++ +LN   D
Sbjct: 8   KVLAYIALTKPRVIELLLVATIPAMLLADRGTVDIVLILSTLFGGWMGAASANSLNCVVD 67

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADIDK+M RTA RP+    +    A V G+ L ++S + +    N ++  L+ ++I  YV
Sbjct: 68  ADIDKVMKRTAKRPLAREAVPTRNALVFGLLLGLASFLWLWWRANLLAGILVVITIAFYV 127

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT+ LKR T QN++ GG AG +P ++GWA+VTG +S   +V+FLIIF WTPPH W+LA
Sbjct: 128 LIYTMVLKRRTWQNVIWGGAAGCMPVLVGWAAVTGSLSWQPVVLFLIIFFWTPPHTWALA 187

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY+ A +PMLP + T+      IL Y+    +  ++  ++  + V Y  I    G
Sbjct: 188 MRYKEDYKAAGVPMLPVIATEEHVTKQILFYSWAMVVTTLV--LVPASGVIYAAITIVAG 245

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             F L A + +            +LFL+S  YL ++F  L VD ++ ++T+    
Sbjct: 246 AWFLLMAHQLYRSVRGGAQVKPLRLFLQSNNYLAIVFVGLAVDSVLGLQTISDML 300


>gi|239917646|ref|YP_002957204.1| protoheme IX farnesyltransferase [Micrococcus luteus NCTC 2665]
 gi|281413863|ref|ZP_06245605.1| protoheme IX farnesyltransferase [Micrococcus luteus NCTC 2665]
 gi|239838853|gb|ACS30650.1| protoheme IX farnesyltransferase [Micrococcus luteus NCTC 2665]
          Length = 326

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 112/294 (38%), Positives = 170/294 (57%), Gaps = 3/294 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  ++ L KPRV+ L + T    ++ A  G   VL  + ++   A+ AGASG  N Y D
Sbjct: 30  KVRAYVELTKPRVIELLLVTTLPTMIFAQRGFPDVLTMIATLVGGALAAGASGTFNCYID 89

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT +RP+  G+++P EA V      V S++I+G   NW++A L   +IF YV
Sbjct: 90  RDIDRVMKRTENRPLVTGEVTPREALVFAWVQTVVSLLILGFGANWLAAGLGVAAIFFYV 149

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+Y++ LKR T QNIV GGIAG  P +IGWA+V G V   ++V+FL++FLWTPPH+W L+
Sbjct: 150 VVYSLVLKRRTEQNIVWGGIAGCFPVLIGWAAVRGTVEWPAIVLFLVVFLWTPPHYWPLS 209

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K DYQ+A +PML  + + R     +++Y   T    +L   +G+A + Y  +   +G
Sbjct: 210 MKYKRDYQQADVPMLGAIASARHVSNQVVLYAWATVACSLLLVPMGWAGMVYTAVALVVG 269

Query: 246 YHFTL--WAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             F       +    +ED + R   K+F  SITYL +LF  L VD  +    + 
Sbjct: 270 GWFIWESHVLQVQAQREDFEDRKAMKVFHLSITYLTLLFIALAVDPFVGAPLMH 323


>gi|258542758|ref|YP_003188191.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|229365489|dbj|BAH57995.1| protoheme IX farnesyltransferase [Acetobacter lovaniensis]
 gi|256633836|dbj|BAH99811.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636895|dbj|BAI02864.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639948|dbj|BAI05910.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643004|dbj|BAI08959.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646059|dbj|BAI12007.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649112|dbj|BAI15053.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652099|dbj|BAI18033.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655156|dbj|BAI21083.1| protoheme IX farnesyltransferase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 322

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 136/292 (46%), Positives = 185/292 (63%), Gaps = 6/292 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
            R   +I LLKPRV+SL ++T   G+++APGH++   ++++IF I M +GA+GA+NM+YD
Sbjct: 27  TRARDWIQLLKPRVISLVVFTGAAGMIVAPGHMNFFVALVTIFCICMASGAAGAINMWYD 86

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT +RPIP G+I   EA   GV L+  S+ +M +A N ++A +L  SIF Y 
Sbjct: 87  RDIDAVMQRTITRPIPGGRIPENEALAYGVGLSCLSVCLMWMATNTLAAGILAFSIFFYA 146

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+WLKR TPQNIVIGG AGA PPMIGWA+VTG +++  +VMF I+F WTPPHFWSL+
Sbjct: 147 VIYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAVTGHMAVLPIVMFGIVFFWTPPHFWSLS 206

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L    DY +A IPMLP V   R T+  I IYT++   V ++P+ +      Y      LG
Sbjct: 207 LYACKDYGRAGIPMLPVVRGARHTRWQIFIYTLVLLAVSLVPSFMHLCGWLYTTTALVLG 266

Query: 246 YHFTLWAWRTFLCKED------KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F   A R  L  +D      K  +  +  F  S+ YLF LF  L+ DH +
Sbjct: 267 LGFVACAVRVLLEPQDAQGVSLKGDKAARISFRFSLAYLFFLFCGLLADHFL 318


>gi|227821104|ref|YP_002825074.1| protoheme IX farnesyltransferase [Sinorhizobium fredii NGR234]
 gi|254765944|sp|C3MHJ3|COXX_RHISN RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|227340103|gb|ACP24321.1| protoheme IX farnesyltransferase [Sinorhizobium fredii NGR234]
          Length = 318

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 161/284 (56%), Positives = 207/284 (72%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPG I+ +   I+I  IA+GAGASGALNM+YDADI
Sbjct: 24  RDYFELLKPRVMSLVVFTAFAGLVLAPGQINPVIGFIAILCIAIGAGASGALNMWYDADI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I P EA   G++L+  S++I+GLA+NW++A LL  +IF YVVIY
Sbjct: 84  DAVMSRTAKRPIPAGKILPQEALAFGLTLSAFSVIILGLAVNWLAAGLLAFTIFFYVVIY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VTG VS+ S+V+FLIIFLWTP HFW+LAL  
Sbjct: 144 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTGGVSVESIVLFLIIFLWTPAHFWALALFK 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    +PM+PNV  + TTK  I++Y +LT++ G+ PT+LGFAS+ YG     LG  F
Sbjct: 204 MGDYGAVGVPMMPNVCGEATTKRQIVVYALLTALSGICPTLLGFASLGYGAFATALGLGF 263

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++       E DK +   KKLF  SI YLF +F+ L+VD++I
Sbjct: 264 IWYSLAVLRMPEADKRMLPAKKLFAFSIAYLFAIFSALLVDYMI 307


>gi|91227004|ref|ZP_01261541.1| protoheme IX farnesyltransferase [Vibrio alginolyticus 12G01]
 gi|91188806|gb|EAS75092.1| protoheme IX farnesyltransferase [Vibrio alginolyticus 12G01]
          Length = 299

 Score =  163 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 114/284 (40%), Positives = 164/284 (57%), Gaps = 4/284 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
           ++ L KP+V++L + TA VG+ LAP      L++V+ +  I + AG++ A N   D  ID
Sbjct: 19  YLKLTKPKVVALMLVTAVVGMSLAPVDDFPWLQAVVGLTGIGLMAGSAAAFNHLIDRRID 78

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
             MART  RP+P G+  P         L V   V++   +N ++A L  MS+  Y ++YT
Sbjct: 79  ARMARTHKRPLPSGETKPSSVIAFATVLGVLGFVLLYAMVNPLTAWLTLMSLLGYAMVYT 138

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           ++LKR TPQNIVI GIAGA+PP++GW +VTG +   + ++ +IIF+WTPPHFW+LA+   
Sbjct: 139 MYLKRATPQNIVIAGIAGAMPPLLGWTAVTGQLHANAWLLVMIIFIWTPPHFWALAIHRV 198

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY+K  IPMLP       TK  IL+YTVL ++V VLP ++G   V Y      L   F 
Sbjct: 199 EDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVLPVLVGMVGVVYLFASLLLNVGFM 258

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             AW+    K   +     + F  SI +L  LF  L+ DH I  
Sbjct: 259 YHAWKL---KYAPEPNTAMETFKFSIYHLLALFIALLSDHYIGF 299


>gi|302868778|ref|YP_003837415.1| protoheme IX farnesyltransferase [Micromonospora aurantiaca ATCC
           27029]
 gi|315504752|ref|YP_004083639.1| protoheme ix farnesyltransferase [Micromonospora sp. L5]
 gi|302571637|gb|ADL47839.1| protoheme IX farnesyltransferase [Micromonospora aurantiaca ATCC
           27029]
 gi|315411371|gb|ADU09488.1| protoheme IX farnesyltransferase [Micromonospora sp. L5]
          Length = 319

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 101/285 (35%), Positives = 159/285 (55%), Gaps = 2/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    ++LA  G  S+    + +   ++ AGA+  +N Y D 
Sbjct: 36  VAAYVTLTKPRIVELLLVTTVPAMMLAHGGMPSLWLVAVVLVGGSLAAGAASVINCYIDR 95

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+P   +SP  A V G+ LA  S+ +M +A NW++  L   +I  Y +
Sbjct: 96  DIDQLMRRTKRRPLPAHTVSPRSALVFGLVLAAVSVALMAVATNWLATVLTVAAIAYYDL 155

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR T  N   GGI GA P +IGWA+VTG ++ A+  +F ++F W  PHF++LA+
Sbjct: 156 VYTLWLKRTTAANTFWGGICGAAPVLIGWAAVTGTLAPAAWGLFAVVFFWQMPHFYALAI 215

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY +A +PMLP V + R     I+ ++ LT +  +    LG  S  YG+    +G 
Sbjct: 216 KYKADYARAGVPMLPVVASVRRVNAEIIGFSWLTVLSSLAVWPLGM-SPIYGVTALVVGG 274

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F + A +        +     +LF  S TYL +LF  + +D L+
Sbjct: 275 IFLVEAHKLCRRATRGEAVKPMRLFHWSTTYLTILFAAVALDALL 319


>gi|254718643|ref|ZP_05180454.1| protoheme IX farnesyltransferase [Brucella sp. 83/13]
 gi|265983624|ref|ZP_06096359.1| protoheme IX farnesyltransferase [Brucella sp. 83/13]
 gi|306839836|ref|ZP_07472634.1| protoheme IX farnesyltransferase [Brucella sp. NF 2653]
 gi|264662216|gb|EEZ32477.1| protoheme IX farnesyltransferase [Brucella sp. 83/13]
 gi|306405022|gb|EFM61303.1| protoheme IX farnesyltransferase [Brucella sp. NF 2653]
          Length = 315

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 147/283 (51%), Positives = 202/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYLVLLKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RPIP G I+P +    G++L+  S++ +G  +NW++A LL  +IF Y VIY
Sbjct: 82  DAVMKRTRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGFMVNWLAAALLAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  S+V+F+IIFLWTPPHFW+L+L  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSVVLFMIIFLWTPPHFWALSLFT 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F
Sbjct: 202 TNDYEAARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAF 261

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 262 VYYAWRLWAADSQPQMLAAARKLFRFSLLYLAGIFAVLLFEAL 304


>gi|156744219|ref|YP_001434348.1| protoheme IX farnesyltransferase [Roseiflexus castenholzii DSM
           13941]
 gi|205693557|sp|A7NRY4|COXX_ROSCS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|156235547|gb|ABU60330.1| protoheme IX farnesyltransferase [Roseiflexus castenholzii DSM
           13941]
          Length = 535

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 164/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KP V+SL I T    + + P  I      + +     + A  S ++N Y D 
Sbjct: 252 LKDYVSLTKPGVISLLILTTITSMYITPAGIPEWSLVLWTTIGGWLMASGSHSINCYLDK 311

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT+ RPIP G+I  W A  LGV L + +  I+ + +N ++A L     F YVV
Sbjct: 312 DIDINMGRTSRRPIPSGRIPAWHALALGVVLGMIAFAILAIFVNMLTALLALAGFFYYVV 371

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYTIWLKR +  NIVIGG AGA PP++GWA+VTG ++  +L+++LI+F WTPPHFW+LAL
Sbjct: 372 IYTIWLKRTSKHNIVIGGGAGAFPPLVGWAAVTGSLAPEALLLWLIVFFWTPPHFWALAL 431

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + + DY +A +PMLP V  D  T+  I++YT+    +  LP +LG    +Y ++    G 
Sbjct: 432 IREKDYARAGVPMLPVVAGDVETRRQIVLYTLSMLALTALPPLLGMLGWSYLLMASIFGG 491

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A +    + D        L+  S+ YL +LF  ++VD  +
Sbjct: 492 LFLYYALKL---RRDGTTATAWALYKYSLLYLALLFVAMVVDRAV 533


>gi|302546299|ref|ZP_07298641.1| protoheme IX farnesyltransferase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302463917|gb|EFL27010.1| protoheme IX farnesyltransferase [Streptomyces himastatinicus ATCC
           53653]
          Length = 321

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 109/289 (37%), Positives = 161/289 (55%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPRV+ L + T    + LA  G   +   + +     + AG + A NMYYD
Sbjct: 32  RVKAFVTLTKPRVIELLLMTTVPVMFLAAQGVPDLWLVLATCIGGYLSAGGAAAFNMYYD 91

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E  V   SLA  S       +N +S+ L   ++  YV
Sbjct: 92  RDIDALMDRTSQRPVVTGMVSPRECLVFAFSLAAVSTAWFWFLVNPLSSMLALGALVFYV 151

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SVT +VS A++++FL+IF WTPPH+W L+
Sbjct: 152 VVYTMLLKRRTSQNIVWGGIAGCMPVLIGWSSVTNEVSWAAVILFLVIFFWTPPHYWPLS 211

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY++AS+PMLP +  ++     I++Y+ L   V +L   LG+    Y      LG
Sbjct: 212 MKVKEDYERASVPMLPVIAGNKAVARQIVLYSWLMVGVSLLLWPLGYTGWFYPAAATVLG 271

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A         +         +LF  SITY+ +LF  + VD  +
Sbjct: 272 AFWLKEAHGLQARARAEVTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 320


>gi|17987747|ref|NP_540381.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|23501370|ref|NP_697497.1| protoheme IX farnesyltransferase [Brucella suis 1330]
 gi|161618441|ref|YP_001592328.1| protoheme IX farnesyltransferase [Brucella canis ATCC 23365]
 gi|225626975|ref|ZP_03785014.1| protoheme IX farnesyltransferase [Brucella ceti str. Cudo]
 gi|225852005|ref|YP_002732238.1| protoheme IX farnesyltransferase [Brucella melitensis ATCC 23457]
 gi|254701271|ref|ZP_05163099.1| protoheme IX farnesyltransferase [Brucella suis bv. 5 str. 513]
 gi|254703818|ref|ZP_05165646.1| protoheme IX farnesyltransferase [Brucella suis bv. 3 str. 686]
 gi|254707803|ref|ZP_05169631.1| protoheme IX farnesyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|254712971|ref|ZP_05174782.1| protoheme IX farnesyltransferase [Brucella ceti M644/93/1]
 gi|254716675|ref|ZP_05178486.1| protoheme IX farnesyltransferase [Brucella ceti M13/05/1]
 gi|256044183|ref|ZP_05447090.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060600|ref|ZP_05450768.1| protoheme IX farnesyltransferase [Brucella neotomae 5K33]
 gi|256112998|ref|ZP_05453895.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159179|ref|ZP_05456992.1| protoheme IX farnesyltransferase [Brucella ceti M490/95/1]
 gi|256254509|ref|ZP_05460045.1| protoheme IX farnesyltransferase [Brucella ceti B1/94]
 gi|256264490|ref|ZP_05467022.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368922|ref|YP_003106428.1| protoheme IX farnesyltransferase [Brucella microti CCM 4915]
 gi|260168237|ref|ZP_05755048.1| protoheme IX farnesyltransferase [Brucella sp. F5/99]
 gi|260563542|ref|ZP_05834028.1| farnesyltransferase IX [Brucella melitensis bv. 1 str. 16M]
 gi|260566928|ref|ZP_05837398.1| protoheme IX farnesyltransferase [Brucella suis bv. 4 str. 40]
 gi|261218480|ref|ZP_05932761.1| protoheme IX farnesyltransferase [Brucella ceti M13/05/1]
 gi|261221686|ref|ZP_05935967.1| protoheme IX farnesyltransferase [Brucella ceti B1/94]
 gi|261315287|ref|ZP_05954484.1| protoheme IX farnesyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261320670|ref|ZP_05959867.1| protoheme IX farnesyltransferase [Brucella ceti M644/93/1]
 gi|261324598|ref|ZP_05963795.1| protoheme IX farnesyltransferase [Brucella neotomae 5K33]
 gi|261751813|ref|ZP_05995522.1| protoheme IX farnesyltransferase [Brucella suis bv. 5 str. 513]
 gi|261754469|ref|ZP_05998178.1| protoheme IX farnesyltransferase [Brucella suis bv. 3 str. 686]
 gi|261757700|ref|ZP_06001409.1| protoheme IX farnesyltransferase [Brucella sp. F5/99]
 gi|265990598|ref|ZP_06103155.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994430|ref|ZP_06106987.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997648|ref|ZP_06110205.1| protoheme IX farnesyltransferase [Brucella ceti M490/95/1]
 gi|205693141|sp|A9M8Z3|COXX_BRUC2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|254765936|sp|C0RHH6|COXX_BRUMB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|17983468|gb|AAL52645.1| protoheme ix farnesyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|23347264|gb|AAN29412.1| protoheme IX farnesyltransferase [Brucella suis 1330]
 gi|161335252|gb|ABX61557.1| protoheme IX farnesyltransferase [Brucella canis ATCC 23365]
 gi|225618632|gb|EEH15675.1| protoheme IX farnesyltransferase [Brucella ceti str. Cudo]
 gi|225640370|gb|ACO00284.1| protoheme IX farnesyltransferase [Brucella melitensis ATCC 23457]
 gi|255999080|gb|ACU47479.1| protoheme IX farnesyltransferase [Brucella microti CCM 4915]
 gi|260153558|gb|EEW88650.1| farnesyltransferase IX [Brucella melitensis bv. 1 str. 16M]
 gi|260156446|gb|EEW91526.1| protoheme IX farnesyltransferase [Brucella suis bv. 4 str. 40]
 gi|260920270|gb|EEX86923.1| protoheme IX farnesyltransferase [Brucella ceti B1/94]
 gi|260923569|gb|EEX90137.1| protoheme IX farnesyltransferase [Brucella ceti M13/05/1]
 gi|261293360|gb|EEX96856.1| protoheme IX farnesyltransferase [Brucella ceti M644/93/1]
 gi|261300578|gb|EEY04075.1| protoheme IX farnesyltransferase [Brucella neotomae 5K33]
 gi|261304313|gb|EEY07810.1| protoheme IX farnesyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261737684|gb|EEY25680.1| protoheme IX farnesyltransferase [Brucella sp. F5/99]
 gi|261741566|gb|EEY29492.1| protoheme IX farnesyltransferase [Brucella suis bv. 5 str. 513]
 gi|261744222|gb|EEY32148.1| protoheme IX farnesyltransferase [Brucella suis bv. 3 str. 686]
 gi|262552116|gb|EEZ08106.1| protoheme IX farnesyltransferase [Brucella ceti M490/95/1]
 gi|262765543|gb|EEZ11332.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001382|gb|EEZ13957.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094821|gb|EEZ18559.1| protoheme IX farnesyltransferase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408499|gb|ADZ65564.1| protoheme IX farnesyltransferase [Brucella melitensis M28]
          Length = 315

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 149/283 (52%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYLVLLKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RPIP G I+P +    G++L+  S++ +GL +NW++A LL  +IF Y VIY
Sbjct: 82  DAVMKRTRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  SLV+F+IIFLWTPPHFW+L+L  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFT 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F
Sbjct: 202 TNDYEAARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAF 261

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 262 VYYAWRLWAADSQPQMLAAARKLFRFSLLYLAGIFAVLLFEAL 304


>gi|119488479|ref|ZP_01621652.1| protoheme IX farnesyltransferase [Lyngbya sp. PCC 8106]
 gi|119455290|gb|EAW36430.1| protoheme IX farnesyltransferase [Lyngbya sp. PCC 8106]
          Length = 333

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 119/299 (39%), Positives = 177/299 (59%), Gaps = 4/299 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T   G+ LA  G +  L  VI++ +    AG++  +N  YD+
Sbjct: 20  VQSYYQLTKPRIILLLLITTAAGMWLAAKGEVDPLLLVITLASGTFAAGSANTINCIYDS 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P  A    ++LAV S  ++ +  N ++A L  + I  YVV
Sbjct: 80  DIDYIMERTRWRPIPSGRVKPRHALFFAIALAVLSFSLLTVFANLLAAVLAMLGIAFYVV 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIPP++GWA+VTGD+S A+ ++FLIIFLWTPPHFW+LA+
Sbjct: 140 IYTHWLKRNSVQNIVIGGAAGAIPPLVGWAAVTGDLSWAAWLLFLIIFLWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIV-GVLPTMLGFASVTYGIIVFFLG 245
           + +D+Y++  +PMLP +  D  T   I +YT++      +L   L  + + Y  I   LG
Sbjct: 200 MIRDEYKEVGVPMLPVIAGDEPTAKQIWVYTLIMIPFTFMLVYPLHTSGIVYAAIALGLG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYFFSSF 304
             F   AW+       +D +V + LF  SI Y+ +L T +++D L     +   F   F
Sbjct: 260 AIFVQKAWQLLQS--PEDQKVARSLFKYSILYMMLLCTGMVIDSLPVTHHIVTAFGDHF 316


>gi|328881611|emb|CCA54850.1| Heme O synthase, protoheme IX farnesyltransferase COX10-CtaB
           [Streptomyces venezuelae ATCC 10712]
          Length = 315

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 168/289 (58%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  ++ L KPR++ L + T    + LA  G   +   + + F   + AG + ALNMY D
Sbjct: 26  RVKAYVALTKPRIIELLLITTVPVMFLAEQGVPDLWLVLATCFGGYLSAGGANALNMYID 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ++P E  V G++LAV S +  GL +NW+SA L   ++  YV
Sbjct: 86  RDIDALMDRTSQRPLVTGVLTPREGLVFGLTLAVVSTLWFGLLVNWLSAALSLGALLFYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LKR T QNIV GGIAG +P +IGW++VT  +S A++++FL+IF WTPPH+W L+
Sbjct: 146 VIYTMILKRRTAQNIVWGGIAGCLPVLIGWSAVTDSMSWAAVILFLVIFFWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +A +PMLP + +++     I+ Y+ +   V +L T LG+    Y  +    G
Sbjct: 206 MKVKDDYARAGVPMLPVLASNKVVAKQIVAYSWVMVAVSLLLTPLGYTGWFYLAVALLTG 265

Query: 246 YHFTLWAWRTFLCKED---KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       ++          +LF  SITY+ +LF  + VD  +
Sbjct: 266 GWWLWEAHALLHRAKNGATGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 314


>gi|148558864|ref|YP_001258487.1| protoheme IX farnesyltransferase [Brucella ovis ATCC 25840]
 gi|182639191|sp|A5VP40|COXX_BRUO2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182676413|sp|P67053|COXX_BRUME RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182676414|sp|P67054|COXX_BRUSU RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|148370121|gb|ABQ60100.1| protoheme IX farnesyltransferase [Brucella ovis ATCC 25840]
          Length = 312

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 149/283 (52%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGASGALNM+YDADI
Sbjct: 19  RDYLVLLKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADI 78

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RPIP G I+P +    G++L+  S++ +GL +NW++A LL  +IF Y VIY
Sbjct: 79  DAVMKRTRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIY 138

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  SLV+F+IIFLWTPPHFW+L+L  
Sbjct: 139 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFT 198

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F
Sbjct: 199 TNDYEAARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAF 258

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 259 VYYAWRLWAADSQPQMLAAARKLFRFSLLYLAGIFAVLLFEAL 301


>gi|119962469|ref|YP_947842.1| protoheme IX farnesyltransferase [Arthrobacter aurescens TC1]
 gi|182637473|sp|A1R6I0|COXX_ARTAT RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|119949328|gb|ABM08239.1| protoheme IX farnesyltransferase [Arthrobacter aurescens TC1]
          Length = 320

 Score =  162 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 102/289 (35%), Positives = 155/289 (53%), Gaps = 3/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   ++ L KPRV+ L + +    ++ A  G  S+   + ++   A  AG++G  N Y D
Sbjct: 26  KFKAYLALTKPRVIELLLVSTLPTMIFAQRGFPSIGLILATLVGGAFAAGSAGVFNCYID 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+M RT  RP+  G+++P EA V    L  +SI I+    N +SA L   +I  YV
Sbjct: 86  RDIDKLMHRTEKRPLVTGEVTPREALVFAWILGAASIAILWFGANPLSAWLGLGAIVFYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LKR T QNIV GG AG  P +I WA+VT  V   ++V+F++IFLWTPPH+W L+
Sbjct: 146 VIYTMILKRRTAQNIVWGGAAGCFPVLIAWAAVTNTVEWPAIVLFMVIFLWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PML  +   +   + +++Y        +L   +G A   Y I     G
Sbjct: 206 MRYGEDYRNAKVPMLGAIAGAKVVSVQVVLYAWAMVACSLLMVPVGGAGWVYTIAAVAAG 265

Query: 246 YHFTLWAWRTFLCKEDKD--IRVTKKLFLESITYLFVLFTILMVDHLID 292
             F   +   +   +  D   +   K+F  SI+YL +LF  L VD  + 
Sbjct: 266 AWFLYESHALYKRAQGGDVSNKGAMKVFHGSISYLTLLFIALAVDPFVG 314


>gi|297198873|ref|ZP_06916270.1| protoheme IX farnesyltransferase [Streptomyces sviceus ATCC 29083]
 gi|197711206|gb|EDY55240.1| protoheme IX farnesyltransferase [Streptomyces sviceus ATCC 29083]
          Length = 317

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 109/289 (37%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D
Sbjct: 28  RVKGFVALTKPRIIELLLITTVPVMFLAQQGVPDLKLVLLTCLGGYLSAGGANALNMYID 87

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G++LAV S ++ GL +NW+SA L   ++  YV
Sbjct: 88  RDIDALMDRTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGLTVNWLSAWLSLGALLFYV 147

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SVT  +S A L++FL++F WTPPH+W L+
Sbjct: 148 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWSSVTNSMSWAPLILFLVMFFWTPPHYWPLS 207

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  ++DY +  +PMLP V +++     I+IY+ +   V +L T LG+    Y  +    G
Sbjct: 208 MKVREDYARVGVPMLPVVASNKVVAKQIVIYSWVMVAVSLLLTPLGYTGWFYTAVALLAG 267

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 268 GFWLWEAHGLQNRAKAEVTGAKLKEMRLFHWSITYVSILFLAVAVDPFL 316


>gi|110834767|ref|YP_693626.1| prenyltransferase family protein [Alcanivorax borkumensis SK2]
 gi|123345406|sp|Q0VN94|CYOE_ALCBS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|110647878|emb|CAL17354.1| prenyltransferase family, putative [Alcanivorax borkumensis SK2]
          Length = 303

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 168/289 (58%), Gaps = 6/289 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYY 64
              ++ L KP V+ L + TA  G+ LA    G + +   + +   +++   AS A+N   
Sbjct: 7   WRDYLALTKPGVVMLLMVTAVAGMFLATEPAGMVPLATFIPAFVGLSLAMMASAAINQIM 66

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D  ID +M RT  RP+  G+++P  A    V LA +S++++   +N ++A L       Y
Sbjct: 67  DQKIDAIMKRTEKRPLVAGKLTPKAAITFAVLLATASMIMLYFLVNPLTAWLTLFGFVGY 126

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
             IYT++LKR TPQNIVIGGIAGAIPP++GW +VTG+    + ++ LIIF+WTPPHFW+L
Sbjct: 127 AFIYTLYLKRATPQNIVIGGIAGAIPPLLGWTAVTGEAHPYAWLLVLIIFVWTPPHFWAL 186

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  +D+Y KA IPMLP       T+  +L YT+L  I  +LP + G + + Y +    L
Sbjct: 187 AIHRRDEYAKADIPMLPVTHGIPFTRESVLYYTILLFICTLLPYLTGMSDLIYLLSALIL 246

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           G  F   A R       +D ++  K F  SITYLF LFT L+VDH + +
Sbjct: 247 GLVFLYHAVRLRFS---EDPKLPMKTFGYSITYLFALFTALLVDHYLPV 292


>gi|22299436|ref|NP_682683.1| protoheme IX farnesyltransferase [Thermosynechococcus elongatus
           BP-1]
 gi|22295619|dbj|BAC09445.1| cytochrome c oxidase folding protein [Thermosynechococcus elongatus
           BP-1]
          Length = 337

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 114/288 (39%), Positives = 171/288 (59%), Gaps = 4/288 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            +L  ++ L KPR++ L + T    + +A  G +S    +I++ +    A A+  +N  Y
Sbjct: 36  TKLVDYVQLTKPRLILLFLITTAAAMEVAGQGRVSPQLLLITLGSGTCAAAAANTINCLY 95

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D DID +M RT  RP+P G+++PWEA  L V LA+++  ++    N +SA L    I  Y
Sbjct: 96  DRDIDAVMERTRHRPLPAGRVAPWEAVFLAVLLAITAFSLLAAFANLLSACLAMAGIAVY 155

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YT WLKR +PQNIVIGG AGAIPP++GWA+VTG++S A+ V+F +IF+WTPPHFW L
Sbjct: 156 VGVYTHWLKRSSPQNIVIGGAAGAIPPLVGWAAVTGELSWAAWVLFGMIFVWTPPHFWPL 215

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVG-VLPTMLGFASVTYGIIVFF 243
           A+L ++DY +  +PMLP V  DR T   I +YT+       +L    G  S  YG++   
Sbjct: 216 AMLIQEDYARVQVPMLPVVGGDRVTAQQIFLYTLALVPTSLLLVYPCGVVSWGYGVVAIA 275

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           LG  F   AW+    +   +    ++LF  SI Y+ +L   ++ D L+
Sbjct: 276 LGSWFIYRAWQL--TQAPAERERARRLFKFSILYMMLLCAAMVGDRLL 321


>gi|254428063|ref|ZP_05041770.1| protoheme IX farnesyltransferase [Alcanivorax sp. DG881]
 gi|196194232|gb|EDX89191.1| protoheme IX farnesyltransferase [Alcanivorax sp. DG881]
          Length = 303

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 168/289 (58%), Gaps = 6/289 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYY 64
              ++ L KP V+ L + TA  G+ LA    G + +   + +   +++   AS A+N   
Sbjct: 7   WRDYLALTKPGVVMLLMVTAVAGMFLATEPAGMVPLGTFIPAFVGLSLAMMASAAINQIM 66

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D  ID +M RT  RP+  G+++P  A    V LA +S++++   +N ++A L       Y
Sbjct: 67  DQKIDAIMKRTEKRPLVAGKLTPKAAITFAVLLAAASMIMLYFLVNPITAWLTLFGFVGY 126

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
             IYT++LKR TPQNIVIGGIAGAIPP++GW +VTG+    + ++ LIIF+WTPPHFW+L
Sbjct: 127 AFIYTLYLKRATPQNIVIGGIAGAIPPLLGWTAVTGEAHPYAWLLVLIIFVWTPPHFWAL 186

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  +D+Y KA IPMLP       T+  +L YT+L  I  +LP + G + + Y +    L
Sbjct: 187 AIHRRDEYAKADIPMLPVTHGIPFTRESVLYYTILLFICTLLPYLTGMSDLIYLLSALIL 246

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           G  F   A R       +D ++  K F  SITYLF LFT L+VDH + +
Sbjct: 247 GLVFLYHAVRLRFS---EDPKLPMKTFGYSITYLFALFTALLVDHYLPV 292


>gi|317124823|ref|YP_004098935.1| protoheme IX farnesyltransferase [Intrasporangium calvum DSM 43043]
 gi|315588911|gb|ADU48208.1| protoheme IX farnesyltransferase [Intrasporangium calvum DSM 43043]
          Length = 320

 Score =  161 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 104/290 (35%), Positives = 156/290 (53%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L+KPR++ L + T    + LA G +  +L  + ++    + AGA+  LN Y D 
Sbjct: 25  VGQYVSLMKPRIIELLLITTIPVMFLAAGGVPNLLLVLATLVGGTLSAGAANTLNCYIDR 84

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT+ RP+  G ISP  A   G  L V+S V +GL +NW+SA L   ++  YV 
Sbjct: 85  DIDAVMHRTSKRPLVTGTISPRAALTFGAVLGVASTVWLGLLVNWLSAWLALAALLFYVF 144

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT+ LKR T QNIV GG AG +P +IGW++VTG +S ++L++F++IF WTPPH+W L++
Sbjct: 145 GYTLLLKRRTAQNIVWGGAAGCMPVLIGWSAVTGSISWSALILFMVIFFWTPPHYWPLSM 204

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY KA +PMLP +         I +Y     +  +    +G     Y       G 
Sbjct: 205 RFKQDYAKAEVPMLPVLEEMVVVARQIALYAWAMVLTSLALVPVGSMGWIYTATAVGAGV 264

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A R          +      +LF  SITYL +LF  + +D +  +
Sbjct: 265 LFLAEAHRLLASARSGAPESKLRPMRLFHFSITYLTILFVGVALDPIWHL 314


>gi|221236452|ref|YP_002518889.1| protoheme IX farnesyltransferase [Caulobacter crescentus NA1000]
 gi|220965625|gb|ACL96981.1| protoheme IX farnesyltransferase coxE [Caulobacter crescentus
           NA1000]
          Length = 339

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 131/312 (41%), Positives = 184/312 (58%), Gaps = 21/312 (6%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           R   +  L+KPRVMSL ++T   G++ A   I  + + I++  IA+GAGASGALNM+YDA
Sbjct: 25  RWQDYFQLMKPRVMSLVVFTGLTGLLAARAPIHPVLAAIAVLCIAVGAGASGALNMWYDA 84

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P G+I   EA  LGV L++ S++ +G A+NW++A LL  +I  Y V
Sbjct: 85  DIDQKMRRTRGRPVPAGKIKGEEAASLGVVLSLLSVMFLGFAVNWLAAGLLAFTIVFYAV 144

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR+T QNIVIGG+AGA+PP IGWA+ TG   + + +M  IIF WTPPHFW+L+L
Sbjct: 145 VYTMWLKRWTAQNIVIGGLAGALPPAIGWAAATGSAPLNAWLMVAIIFFWTPPHFWALSL 204

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA +PMLP V   R T+  IL+Y+++   + + P + G     Y  +    G 
Sbjct: 205 YVTTDYAKAGVPMLPVVKGARETRKQILLYSLILFPICLSPVLTGLGGPIYLAVSGLGGL 264

Query: 247 HFTLWAWRTFLCKEDK---------------------DIRVTKKLFLESITYLFVLFTIL 285
            F L AWR F  K                          +  + LF  SI YLF LF  L
Sbjct: 265 VFLLLAWRVFASKAGDAADPRVADRALYDVTEDEKAAGAKAARNLFAFSILYLFALFAAL 324

Query: 286 MVDHLIDMKTVE 297
           + + +  ++ +E
Sbjct: 325 LGEAVTGVRPLE 336


>gi|297195067|ref|ZP_06912465.1| cytochrome oxidase assembly factor [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721544|gb|EDY65452.1| cytochrome oxidase assembly factor [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 317

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 112/289 (38%), Positives = 165/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   F+ L KPR++ L + T    + LA  G   +   + +     + AG + ALNMY D
Sbjct: 28  RAKAFVALTKPRIIELLLITTVPVMFLAEQGVPDLWLVLATCLGGYLSAGGANALNMYID 87

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E  V G++LAV S +  GL +NW+SA L   ++  YV
Sbjct: 88  RDIDALMDRTSQRPLVTGMVSPREGLVFGLTLAVVSTLWFGLLVNWLSAALSLGALLFYV 147

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SVT  +S A++++FL+IF WTPPH+W L+
Sbjct: 148 VVYTMILKRRTAQNIVWGGIAGCMPVLIGWSSVTNSMSWAAVILFLVIFFWTPPHYWPLS 207

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V  +R     I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 208 MKVKDDYARVGVPMLPVVAGNRVVARQIVLYSWVMVAVSLLLTPLGYTGWFYTAVALVSG 267

Query: 246 YHFTLWAWRTFLCKEDKD---IRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +  +        +LF  SITY+ +LF  + VD  +
Sbjct: 268 GWWLWEAHGLQSRAKAGETGGKLKEMRLFHWSITYVSLLFVAVAVDPFL 316


>gi|182639243|sp|Q92RG8|COXX_RHIME RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 316

 Score =  161 bits (408), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 161/284 (56%), Positives = 204/284 (71%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+      +I  IA+GAGASGALNM+YDADI
Sbjct: 24  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPFIGFTAILCIAIGAGASGALNMWYDADI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I P EA   G++L+  S++I+GLA++W++A LL  +IF YV IY
Sbjct: 84  DAVMSRTAKRPIPAGKILPQEALAFGLTLSAFSVIILGLAVHWLAAGLLAFTIFFYVAIY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VTG VS+ S+V+FLIIFLWTP HFW+LAL  
Sbjct: 144 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTGGVSVESIVLFLIIFLWTPAHFWALALFK 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    +PM+PNV  + TTK  I+IY VLT++ GV PT+LGFAS+ YG     +G  F
Sbjct: 204 MGDYGAVGVPMMPNVCGEATTKRQIVIYAVLTAVSGVCPTLLGFASLGYGAFATVMGLGF 263

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++       E DK +   KKLF  SI YLF +F+ L+VD+ I
Sbjct: 264 VWYSLGVLRMPEGDKRMVPAKKLFAFSIAYLFAIFSALLVDYAI 307


>gi|167622192|ref|YP_001672486.1| protoheme IX farnesyltransferase [Shewanella halifaxensis HAW-EB4]
 gi|205716430|sp|B0TNS4|CYOE_SHEHH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|167352214|gb|ABZ74827.1| protoheme IX farnesyltransferase [Shewanella halifaxensis HAW-EB4]
          Length = 301

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 112/290 (38%), Positives = 175/290 (60%), Gaps = 4/290 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           +F+   +  + KP+V++L + T  VG+ LA PG + ++  +  +  I M AG++ A N  
Sbjct: 15  LFQWRAYYEMTKPKVVALMLLTVLVGMCLAVPGVVPIVPLIAGMAGIGMMAGSAAAFNHL 74

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D  ID +MART +RP+P G++S  +A     SL +   V++ + +N ++A L F S+  
Sbjct: 75  IDRRIDGLMARTYNRPLPKGRVSIAKALTFSCSLGILGFVVLYVLVNPLTAWLTFASLIG 134

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT +LKR TPQNIV+GG+AGA+PP++GW +VTG+    +L++ +IIF WTPPHFW+
Sbjct: 135 YAVVYTAYLKRATPQNIVVGGLAGAMPPLLGWTAVTGEFHGNALLLVIIIFAWTPPHFWA 194

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  + +Y K  IPMLP       TK  I +YT+L +I  +LP ++G     Y +    
Sbjct: 195 LAIHRRVEYAKVDIPMLPVTHGVEFTKTCIFLYTILLAIACLLPVLVGMCGPVYLVSSTL 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           L   F   AW+    K  ++  +  KLF  SI +L +LF  L+VDH + +
Sbjct: 255 LSVTFIYKAWQL---KFHEEPGMAMKLFKFSIYHLMLLFIALLVDHYLWL 301


>gi|182639233|sp|Q8DHQ2|COXX_THEEB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 317

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 114/288 (39%), Positives = 171/288 (59%), Gaps = 4/288 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            +L  ++ L KPR++ L + T    + +A  G +S    +I++ +    A A+  +N  Y
Sbjct: 16  TKLVDYVQLTKPRLILLFLITTAAAMEVAGQGRVSPQLLLITLGSGTCAAAAANTINCLY 75

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D DID +M RT  RP+P G+++PWEA  L V LA+++  ++    N +SA L    I  Y
Sbjct: 76  DRDIDAVMERTRHRPLPAGRVAPWEAVFLAVLLAITAFSLLAAFANLLSACLAMAGIAVY 135

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YT WLKR +PQNIVIGG AGAIPP++GWA+VTG++S A+ V+F +IF+WTPPHFW L
Sbjct: 136 VGVYTHWLKRSSPQNIVIGGAAGAIPPLVGWAAVTGELSWAAWVLFGMIFVWTPPHFWPL 195

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVG-VLPTMLGFASVTYGIIVFF 243
           A+L ++DY +  +PMLP V  DR T   I +YT+       +L    G  S  YG++   
Sbjct: 196 AMLIQEDYARVQVPMLPVVGGDRVTAQQIFLYTLALVPTSLLLVYPCGVVSWGYGVVAIA 255

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           LG  F   AW+    +   +    ++LF  SI Y+ +L   ++ D L+
Sbjct: 256 LGSWFIYRAWQL--TQAPAERERARRLFKFSILYMMLLCAAMVGDRLL 301


>gi|16127635|ref|NP_422199.1| protoheme IX farnesyltransferase [Caulobacter crescentus CB15]
 gi|81534314|sp|Q9A301|COXX_CAUCR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|13425115|gb|AAK25367.1| protoheme IX farnesyl transferase [Caulobacter crescentus CB15]
          Length = 333

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 131/312 (41%), Positives = 184/312 (58%), Gaps = 21/312 (6%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           R   +  L+KPRVMSL ++T   G++ A   I  + + I++  IA+GAGASGALNM+YDA
Sbjct: 19  RWQDYFQLMKPRVMSLVVFTGLTGLLAARAPIHPVLAAIAVLCIAVGAGASGALNMWYDA 78

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P G+I   EA  LGV L++ S++ +G A+NW++A LL  +I  Y V
Sbjct: 79  DIDQKMRRTRGRPVPAGKIKGEEAASLGVVLSLLSVMFLGFAVNWLAAGLLAFTIVFYAV 138

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR+T QNIVIGG+AGA+PP IGWA+ TG   + + +M  IIF WTPPHFW+L+L
Sbjct: 139 VYTMWLKRWTAQNIVIGGLAGALPPAIGWAAATGSAPLNAWLMVAIIFFWTPPHFWALSL 198

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA +PMLP V   R T+  IL+Y+++   + + P + G     Y  +    G 
Sbjct: 199 YVTTDYAKAGVPMLPVVKGARETRKQILLYSLILFPICLSPVLTGLGGPIYLAVSGLGGL 258

Query: 247 HFTLWAWRTFLCKEDK---------------------DIRVTKKLFLESITYLFVLFTIL 285
            F L AWR F  K                          +  + LF  SI YLF LF  L
Sbjct: 259 VFLLLAWRVFASKAGDAADPRVADRALYDVTEDEKAAGAKAARNLFAFSILYLFALFAAL 318

Query: 286 MVDHLIDMKTVE 297
           + + +  ++ +E
Sbjct: 319 LGEAVTGVRPLE 330


>gi|307304236|ref|ZP_07583988.1| protoheme IX farnesyltransferase [Sinorhizobium meliloti BL225C]
 gi|307320541|ref|ZP_07599956.1| protoheme IX farnesyltransferase [Sinorhizobium meliloti AK83]
 gi|306893817|gb|EFN24588.1| protoheme IX farnesyltransferase [Sinorhizobium meliloti AK83]
 gi|306902704|gb|EFN33297.1| protoheme IX farnesyltransferase [Sinorhizobium meliloti BL225C]
          Length = 316

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 161/284 (56%), Positives = 204/284 (71%), Gaps = 1/284 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL ++TAF G+VLAPGHI+      +I  IA+GAGASGALNM+YDADI
Sbjct: 24  RDYFELLKPRVMSLVVFTAFAGLVLAPGHINPFIGFTAILCIAIGAGASGALNMWYDADI 83

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RTA RPIP G+I P EA   G++L+  S++I+GLA++W++A LL  +IF YV IY
Sbjct: 84  DAVMSRTAKRPIPAGKILPQEALAFGLTLSAFSVIILGLAVHWLAAGLLAFTIFFYVAIY 143

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA VTG VS+ S+V+FLIIFLWTP HFW+LAL  
Sbjct: 144 TMWLKRSTPQNIVIGGAAGAFPPMIGWACVTGGVSVESIVLFLIIFLWTPAHFWALALFK 203

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    +PM+PNV  + TTK  I+IY VLT++ GV PT+LGFAS+ YG     +G  F
Sbjct: 204 MGDYGAVGVPMMPNVCGEATTKRQIVIYAVLTAVSGVCPTLLGFASLGYGAFATAMGLGF 263

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++       E DK +   KKLF  SI YLF +F+ L+VD+ I
Sbjct: 264 VWYSLGVLRMPEGDKRMVPAKKLFAFSIAYLFAIFSALLVDYAI 307


>gi|256379192|ref|YP_003102852.1| protoheme IX farnesyltransferase [Actinosynnema mirum DSM 43827]
 gi|255923495|gb|ACU39006.1| protoheme IX farnesyltransferase [Actinosynnema mirum DSM 43827]
          Length = 307

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 157/291 (53%), Gaps = 3/291 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L + T    ++LA  G   +     ++    + AG++ ALN Y DA
Sbjct: 16  VGAYVALTKPRVIELLLITTIPAMLLAERGLPPLWLIACTLAGGTLAAGSANALNCYIDA 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT SRP+    I P  A + GV L V S   + +  N +SA     +I  Y+ 
Sbjct: 76  DIDSVMKRTGSRPLAKNSIPPRNALIFGVVLGVVSFAFLWITTNLMSAVFAVATILFYIF 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNI+ GG+AG +P +IGW++VTG V + +L MF +IF WTPPH W+LA+
Sbjct: 136 VYTLVLKRRTSQNIIWGGLAGCMPVVIGWSAVTGTVELPALAMFGVIFFWTPPHTWALAM 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY +A +PMLP V T +     I+IY+  T +  +L  +    S  Y  +    G 
Sbjct: 196 KFKEDYARAGVPMLPVVATAQQVTRQIVIYSWATVLCSLL--LAPVTSWIYVGVALASGV 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            F ++A R            T K F  S  YL ++F  L VD ++ +  + 
Sbjct: 254 WFGVFAHRLHGVVRKGGSTNTMKFFHMSNLYLTLVFCGLAVDAVVGLPVLG 304


>gi|114763464|ref|ZP_01442871.1| protoheme IX farnesyltransferase [Pelagibaca bermudensis HTCC2601]
 gi|114544002|gb|EAU47013.1| protoheme IX farnesyltransferase [Roseovarius sp. HTCC2601]
          Length = 316

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 133/287 (46%), Positives = 181/287 (63%), Gaps = 4/287 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   +  LLKPRVM+L ++TA VG++ AP  +       +I  IA+G GASGALNM++DA
Sbjct: 19  QFGDYFALLKPRVMTLVVFTALVGLLAAPVPVHPFIGFCAILFIAVGGGASGALNMWWDA 78

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RTA RPIP G++ P EA  LG++L+  S V +GLA NW++  LL  +IF YVV
Sbjct: 79  DIDQVMKRTAKRPIPAGRVEPGEALGLGLALSAFSCVFLGLATNWLAGGLLAFTIFFYVV 138

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR TPQNIVIGG AGA PPMIGWA+ TG V I +++MF + F+WTPPHFW+LAL
Sbjct: 139 IYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGSVGIEAVLMFCLTFMWTPPHFWALAL 198

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A +PML      R+T++HIL+YTVL + + +           Y  +   L  
Sbjct: 199 FMRSDYDDAGVPMLTVTHGRRSTRVHILVYTVLLAALAIGTGFTSIGGPVYLAVAVVLNG 258

Query: 247 HFTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDH 289
            F   AW  F   ED     + +  K  F  S+ YLF  F  ++++ 
Sbjct: 259 LFLKGAWEIFRRDEDASEADNFKTEKAFFKLSLLYLFAHFGAILLEA 305


>gi|126665619|ref|ZP_01736601.1| protoheme IX farnesyltransferase [Marinobacter sp. ELB17]
 gi|126630247|gb|EBA00863.1| protoheme IX farnesyltransferase [Marinobacter sp. ELB17]
          Length = 322

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 120/284 (42%), Positives = 175/284 (61%), Gaps = 4/284 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+++ I T+ +G++LA  G  S+   V     IA+ AGA+  +N   D 
Sbjct: 39  WRDYLELTKPKVVAMMILTSVIGMLLAVSGLPSLQVLVFGNAGIALLAGAAAVINHVVDQ 98

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            +D +MART  RP+  G+IS  E  +    LA+S + I+ L +N ++A L   S+  Y  
Sbjct: 99  KVDVVMARTHKRPVATGRISAAEGLLFAGVLALSGMAILMLLVNSLTAWLTLASLVGYAG 158

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA+PP++GW +VTG V   +L++ LIIF WTPPHFW+LA+
Sbjct: 159 VYTLFLKRATPQNIVIGGLAGAMPPLLGWTAVTGQVDGHALLLVLIIFAWTPPHFWALAI 218

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  T++HIL+YT++   V +LP + G + + Y +    LG 
Sbjct: 219 HRKEEYAKARIPMLPVTHGNYYTELHILLYTLILLAVSLLPFVTGMSGMIYLVGALVLGS 278

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
            F  +A R      D D RV    F  SITYL  LF +L+VDH 
Sbjct: 279 RFLQYAIRLL---RDDDRRVALDTFKYSITYLMALFVVLLVDHY 319


>gi|302518385|ref|ZP_07270727.1| protoheme IX farnesyltransferase [Streptomyces sp. SPB78]
 gi|302427280|gb|EFK99095.1| protoheme IX farnesyltransferase [Streptomyces sp. SPB78]
          Length = 315

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 170/289 (58%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           RL  F+ L KPR++ L + T    + LA  G   +    ++ F   + AG + ALNM+YD
Sbjct: 26  RLKGFVALTKPRIIELLLITTVPVMFLAEQGVPDLWLVFVTCFGGYLSAGGANALNMWYD 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ISP E  V G+ LAV S V  GL +NW+SA L   +I  YV
Sbjct: 86  RDIDALMDRTSQRPLVTGLISPREGLVFGLGLAVVSTVWFGLLVNWLSAALSLGAILLYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V YT+ LKR T QNIV GG+AG +P +IGW++VT  VS A++++FL+IF WTPPH+W L+
Sbjct: 146 VGYTMILKRRTAQNIVWGGVAGCMPVLIGWSAVTNSVSWAAVILFLVIFFWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY + ++PMLP V  ++     I++Y+ +   V +L T+LG+    Y ++    G
Sbjct: 206 MRVKDDYARVNVPMLPVVAGNKVVARQIVLYSWVMVAVSLLLTVLGYTGWFYTVVALLSG 265

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++   A       + +         +LF  SITY+ +LF  + +D  +
Sbjct: 266 GYWLWEAHGLLHRAKGEITGAKLKEMRLFHWSITYVSILFVAVAIDPFL 314


>gi|86740354|ref|YP_480754.1| protoheme IX farnesyltransferase [Frankia sp. CcI3]
 gi|123751249|sp|Q2JCG7|COXX_FRASC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|86567216|gb|ABD11025.1| protoheme IX farnesyltransferase [Frankia sp. CcI3]
          Length = 289

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 100/289 (34%), Positives = 156/289 (53%), Gaps = 1/289 (0%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNM 62
              +   ++ L+K RV+ L + T    ++LA  G  S+    +++ A  + AG++  +N 
Sbjct: 1   MSAKARGYVALMKLRVVELLLITTVPVMMLAERGVPSLRLIAVTLVAGTLAAGSANTINC 60

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           Y D DID+MM RT  RP+    ++P EA   G+ + + S ++ G  +NW SA L   +I 
Sbjct: 61  YVDRDIDQMMGRTKRRPLVRATVTPTEALTFGIVIGIVSTLLFGFLVNWPSALLADGAIA 120

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            YV +YT+ LKR TP NIVIGG AG  P +IGW++VTG V  A++++F ++F WTPPHFW
Sbjct: 121 FYVFVYTLGLKRRTPSNIVIGGAAGCFPVLIGWSAVTGTVGWAAVLLFAVVFFWTPPHFW 180

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LA+  +DDY  A +PMLP V + +     +L Y        +    +      Y +   
Sbjct: 181 ALAMKFRDDYAAAGVPMLPVVASVQVVTRRMLGYAYAMVAASLAVAPVASTGPVYLVAAV 240

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +G  F + + R        +     +LF  SITYL +LF  + V  L+
Sbjct: 241 AVGAWFLVESHRVARRARHGEDPRPMRLFHMSITYLTLLFVAIAVTALV 289


>gi|163738382|ref|ZP_02145797.1| protoheme IX farnesyltransferase [Phaeobacter gallaeciensis BS107]
 gi|163742201|ref|ZP_02149589.1| protoheme IX farnesyltransferase [Phaeobacter gallaeciensis 2.10]
 gi|161384531|gb|EDQ08912.1| protoheme IX farnesyltransferase [Phaeobacter gallaeciensis 2.10]
 gi|161388303|gb|EDQ12657.1| protoheme IX farnesyltransferase [Phaeobacter gallaeciensis BS107]
          Length = 313

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 127/288 (44%), Positives = 181/288 (62%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTALVGLLAAPVGVHPVIGFSAILFIAIGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT SRPIP G++ P EA  LG++L+  S++++ LA N  +   L  +IF YVVI
Sbjct: 78  IDQVMKRTKSRPIPAGKVEPGEALSLGLALSGLSVIMLALATNVFAGAFLAFTIFFYVVI 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +++   +MF + F+WTPPHFW+LAL 
Sbjct: 138 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGSMAVEPWLMFALTFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R+T+ HILIYT L +++ V     G     Y ++   L   
Sbjct: 198 MRSDYDDAGVPMLTVTHGRRSTRKHILIYTALLALLAVGTAFSGVGGPIYLVVALVLNAL 257

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   AW+     ED     + +V +  F  S+ YLF+ F  ++ + ++
Sbjct: 258 FLHGAWKISRRDEDDSEADNFKVERSFFKLSLLYLFLHFGAILAEAVL 305


>gi|300865039|ref|ZP_07109866.1| Protoheme IX farnesyltransferase [Oscillatoria sp. PCC 6506]
 gi|300336976|emb|CBN55016.1| Protoheme IX farnesyltransferase [Oscillatoria sp. PCC 6506]
          Length = 325

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 169/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T   G+ +A  G +  L  + ++    + +GA+  +N  YD+
Sbjct: 20  VQSYYQLTKPRIILLLLITTAAGMWMAAKGEVDPLLLLATMTGGTLASGAANTINCIYDS 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++   +A +  V LA  S  ++ +  N ++A L    I  YV+
Sbjct: 80  DIDYIMERTRWRPIPSGRVKRRDALIFAVILASLSFTLLTVVANLLAALLAMSGIVFYVL 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIPP++GWA+VTGD+S A+ ++F I+FLWTPPHFW+LA+
Sbjct: 140 IYTHWLKRHSVQNIVIGGAAGAIPPLVGWAAVTGDLSWAAWLLFAIVFLWTPPHFWALAM 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGF-ASVTYGIIVFFLG 245
           + +D+Y +  +PMLP +  D+ T + I IYT++     +L       A   YG++   LG
Sbjct: 200 MIRDEYAEVGVPMLPVIEGDKATAVQIWIYTLILIPATLLLVYPLNAAGAVYGVVATLLG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW      ED+   V + LF  SI Y+ +L   ++VD L
Sbjct: 260 AIFMQKAWLLLQSPEDRG--VARSLFKYSIFYMMLLCAGIVVDSL 302


>gi|296269952|ref|YP_003652584.1| protoheme IX farnesyltransferase [Thermobispora bispora DSM 43833]
 gi|296092739|gb|ADG88691.1| protoheme IX farnesyltransferase [Thermobispora bispora DSM 43833]
          Length = 317

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 157/288 (54%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KPR++ L + T    + LA  G   +  S  ++    + AG++  LN Y D 
Sbjct: 29  LRAYVALTKPRIIELLLITTLPTMFLAARGLPDLWTSCATMVFGTLSAGSANVLNCYVDR 88

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P  ++S   A + GV L + S+  + + +N ++A L   +I  YV 
Sbjct: 89  DIDSAMRRTRRRPLPKHEVSDRAALIYGVVLGIVSVAGLAVTVNALAAALTLSAILFYVF 148

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y+++LKR TPQNIV GGIAG +P +IGWA +TG +S   LV+F ++F WTPPH W+LA+
Sbjct: 149 VYSMYLKRRTPQNIVWGGIAGCMPVLIGWAGITGSLSWEPLVLFGVVFFWTPPHTWTLAM 208

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  AS+PMLP V ++R   + I  YT  T +  +L   +   +  Y ++   LG 
Sbjct: 209 RYREDYATASVPMLPVVASERRVVLEIAAYTWATVLCSLLLWPVAGTTAFYPVVAAVLGA 268

Query: 247 HFTLWAWRTF---LCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
                 +R +      +        + F  S  YL +LF  + +D L+
Sbjct: 269 VCLAEVYRMYAKLKAGKTGIELRPMRFFHWSNVYLALLFLAVAIDSLL 316


>gi|182639251|sp|Q9CCN4|COXX_MYCLE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 308

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 107/292 (36%), Positives = 160/292 (54%), Gaps = 3/292 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            R+  ++ L KPRV+ L + TA   ++LA  G  + L  + ++      A  +   N   
Sbjct: 18  SRVLAYLALTKPRVIELLLVTAIPAMLLADRGSANPLLILNTLLGGISAAAGANTFNCVA 77

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           DADIDK+M RT+ RP+    + P  A VLG++L   S   +    N +S  L   ++  Y
Sbjct: 78  DADIDKLMKRTSRRPLARAAVPPRNALVLGLALTAGSFFWLWWTTNLLSGLLALATVAFY 137

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YT+ LKR T QN+V GG AG +P MIGW+++T  +   +L MF IIF WTPPH W+L
Sbjct: 138 VFVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAITDTIGWPALAMFAIIFFWTPPHTWAL 197

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  KDDY+ AS+PMLP V T+R     ILIYT LT++  ++  +       Y  +    
Sbjct: 198 AMRYKDDYKVASVPMLPAVATERHVTKQILIYTWLTALSTLVLALA--TGWLYMAVAVVA 255

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           G  F   A + ++     +     +LFL+S  YL V+F  L VD ++ + T+
Sbjct: 256 GAWFLTMAHQLYVGVCAGEPVKPLRLFLQSNNYLAVVFCALAVDSVLALPTL 307


>gi|326329993|ref|ZP_08196307.1| protoheme IX farnesyltransferase [Nocardioidaceae bacterium
           Broad-1]
 gi|325952201|gb|EGD44227.1| protoheme IX farnesyltransferase [Nocardioidaceae bacterium
           Broad-1]
          Length = 312

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 102/289 (35%), Positives = 151/289 (52%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIF-AIAMGAGASGALNMYYDA 66
           ++ ++ L KPRV+ L + T    +  A   +  +  V +        AG++   N  YD 
Sbjct: 24  ISAYVSLTKPRVIELLLLTTVPVMFFAAQGVPGVGLVAATVVGGIFSAGSASVFNCVYDR 83

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  R +P   ++P  A + G  LAV S++++G  +NW+SA L   +   YV 
Sbjct: 84  DIDEQMRRTRRRALPRHVVTPRAALIFGSVLAVLSVLVLGFFVNWLSAGLSLAANAFYVF 143

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GGIAG  P +IGW +VT  VS   L++F+++F WTPPH W+LAL
Sbjct: 144 VYTMLLKRRTTQNIVWGGIAGCFPTLIGWTAVTNSVSWEPLILFMVVFFWTPPHTWALAL 203

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY +  +PMLP V + R     I+ Y+ +     +L   +      Y +    LG 
Sbjct: 204 RYREDYAQVDVPMLPVVKSARHVGGQIVAYSWVMVATSLLLWPIASTGWLYPVAAIGLGA 263

Query: 247 HFTLWAWRTF---LCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            F + A +        ED       +LF  S  YL +LF  L VD LI 
Sbjct: 264 VFLVQAHQLHARAKGTEDLTKIRPMQLFHSSNLYLSLLFVALAVDPLIG 312


>gi|222475779|ref|YP_002564300.1| protoheme IX farnesyltransferase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454150|gb|ACM58414.1| protoheme IX farnesyltransferase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 483

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 102/289 (35%), Positives = 157/289 (54%), Gaps = 4/289 (1%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNM 62
           Q+ R+  ++ L KP++M L    A   + LA G  +    +V ++    +  GASG  N 
Sbjct: 197 QMSRVRAYVALTKPKLMWLLCLVALASMGLAAGTSLDPGTAVATLTGGVLSIGASGTFNN 256

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             + D+D+ M RTA RP+  GQISP  A   G+ LA +S+ +  + +N ++A L  ++I 
Sbjct: 257 VLERDVDRHMDRTADRPVVQGQISPRRATAFGLLLAAASVGVFVVFVNALAAALGLLAIL 316

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y V+YT+ LK  T QNIVIGG+ GA P +IGWA+V   V + ++++  +IFLWTP HF+
Sbjct: 317 FYSVVYTLVLKPHTTQNIVIGGVVGAFPALIGWAAVENTVGMPAIILGTVIFLWTPAHFY 376

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LAL  ++DY  A  PMLP V  + TT+ HIL+Y   T +  V           Y + + 
Sbjct: 377 NLALAYREDYAAAGFPMLPVVRGEATTRRHILLYLGATLLGAVALGATTRLDWLYAVTIV 436

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +G  F     R F    ++  +   + F  S  YL  L   ++VD L+
Sbjct: 437 LVGGVFLWATVRLF---RERTEQAAFRTFHASNAYLGGLLIAILVDTLL 482


>gi|182639235|sp|Q829U3|COXX_STRAW RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 305

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 169/289 (58%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G  S+   +++     + AG + ALNMY D
Sbjct: 16  RVKAFVALTKPRIIELLLITTVPVMFLAEQGVPSLRLVLLTCLGGYLSAGGANALNMYID 75

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G++LAV S ++ GL +NW+SA L   ++  YV
Sbjct: 76  RDIDALMERTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGLTVNWLSAWLSLGALLFYV 135

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SVT  +S A +++FL++F WTPPH+W L+
Sbjct: 136 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWSSVTDSMSWAPVILFLVMFFWTPPHYWPLS 195

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V +++     I+IY+ +   V +L T LG+    Y ++    G
Sbjct: 196 MKVKDDYARVGVPMLPVVASNKVVARQIVIYSWVMVGVSLLLTPLGYTGWFYTLVALLAG 255

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 256 GFWLWEAHGLQNRAKAEVTGGKLKEMRLFHWSITYVSILFVAVAVDPFL 304


>gi|91781684|ref|YP_556890.1| protoheme IX farnesyltransferase [Burkholderia xenovorans LB400]
 gi|123359211|sp|Q146A1|COXX_BURXL RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|91685638|gb|ABE28838.1| Protoheme IX farnesyltransferase [Burkholderia xenovorans LB400]
          Length = 301

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 165/286 (57%), Gaps = 4/286 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRVSQYIALTKPRVTQLAVFCAVIGMFLSTPGMVPWTPLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKIDAKMRRTSWRPSARGEITTAQILLFSAVLGGLGMWTLYTFANPLTMWLTLATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFISGMSGVVYLAAAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +AW+ +    D    + +K F  SI YL +LF  L++DH 
Sbjct: 252 GALFLAYAWKIYREYSDD---LARKTFRYSIVYLSLLFAALLIDHY 294


>gi|118595254|ref|ZP_01552601.1| protoheme IX farnesyltransferase [Methylophilales bacterium
           HTCC2181]
 gi|118441032|gb|EAV47659.1| protoheme IX farnesyltransferase [Methylophilales bacterium
           HTCC2181]
          Length = 302

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 113/296 (38%), Positives = 177/296 (59%), Gaps = 4/296 (1%)

Query: 2   YFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGAL 60
           Y  +  L  F  L KPRV +L ++TA +G+ LA PG + +   + S   IA  +GA+ A 
Sbjct: 10  YCSIDSLKNFYALCKPRVTALIVFTAIIGMFLATPGMVPIDILIASSIGIAFVSGAAAAF 69

Query: 61  NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS 120
           N   +  ID +MART  RP+P GQ+S  E  +   +L  + +VI+   +N ++  L  ++
Sbjct: 70  NCLIEEKIDALMARTRGRPLPTGQVSQKETVIFSSALGGAGLVILFYLVNPLTMWLTLIT 129

Query: 121 IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH 180
              Y VIYTI+LK  TP NIVIGG +GA+PP++GWA+V   V+  ++++FLIIF WTPPH
Sbjct: 130 FVAYAVIYTIFLKPATPMNIVIGGASGAMPPILGWAAVNNHVAPEAIILFLIIFCWTPPH 189

Query: 181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII 240
           FW+LAL  +++Y KA +PMLP    ++ T + I++YT++  IV ++P  +G   + Y +I
Sbjct: 190 FWALALYRREEYAKAGMPMLPVTHGEQFTLLQIVLYTIILVIVTMMPFSVGMTGLIYLVI 249

Query: 241 VFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              L   F  +    +    D   +++ K+F  SI YL ++FT L++DH    K +
Sbjct: 250 ATILNAIFLYYVVVLYRNYSD---KLSMKIFRYSILYLGLIFTALLIDHYFKFKFI 302


>gi|113475452|ref|YP_721513.1| protoheme IX farnesyltransferase [Trichodesmium erythraeum IMS101]
 gi|123056800|sp|Q114N4|COXX_TRIEI RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|110166500|gb|ABG51040.1| protoheme IX farnesyltransferase [Trichodesmium erythraeum IMS101]
          Length = 328

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 108/285 (37%), Positives = 173/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVL-APGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KPR++ L + T   G+ L A G +S+    +++   A+ +GA+ A+N  YD+
Sbjct: 20  FKSYYQLTKPRIILLLLITTAAGMWLGAKGEVSLFLLFVTLTGGALASGAANAINCIYDS 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P +A +  ++LA +S  ++ +  N ++A L    I  YV 
Sbjct: 80  DIDYIMERTRWRPIPSGRVKPRDALIFALTLAATSFTLLTVFANLLAALLAMSGIVFYVG 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR + QNIVIGG AGAIPP++GWA+VTG++S A+ ++F II +WTPPHFW+LA+
Sbjct: 140 VYTHWLKRHSVQNIVIGGAAGAIPPLVGWAAVTGELSWAAWLLFAIIVVWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
             +D+YQ+  +PMLP +  +  T   I +YT++   + +L       +   Y ++  +LG
Sbjct: 200 YIRDEYQEVGVPMLPVIEGNEETARQIWVYTLILIPMTLLLVYPLHVSGAIYAVLATYLG 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+      +KD  V + LF  SI Y+ +L  ++++D L
Sbjct: 260 VIFIKKAWQLLKDPSNKD--VARSLFKYSIYYMMLLCLVMVIDSL 302


>gi|27376283|ref|NP_767812.1| protoheme IX farnesyltransferase [Bradyrhizobium japonicum USDA
           110]
 gi|81789243|sp|Q9RM98|COXX_BRAJA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|6006414|emb|CAB56820.1| putative heme O synthase [Bradyrhizobium japonicum]
 gi|8708923|gb|AAF78814.1| CoxE [Bradyrhizobium japonicum]
 gi|27349423|dbj|BAC46437.1| coxE [Bradyrhizobium japonicum USDA 110]
          Length = 314

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 141/282 (50%), Positives = 193/282 (68%), Gaps = 1/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL I+TA VG+ +APGH   + ++ S+  IA+GAGASGALNM  + D
Sbjct: 20  VGDYIALLKPRVMSLVIFTALVGMAMAPGHFHPVLAITSLLCIAVGAGASGALNMALEGD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M+RTA+RPIP G+I+  EA   G++LA  S++ +G+ +NW++  LL  +IF YVVI
Sbjct: 80  IDAKMSRTANRPIPRGRITRPEAMTFGMTLAFFSVMTLGILVNWIAGALLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ WA+VTG V +  L++F IIF WTPPHFW+LAL 
Sbjct: 140 YTMWLKRWTAQNIVIGGAAGALPPVVAWAAVTGTVDVEPLLLFAIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A IPMLPNV     T++ IL+YT++   V   P  LG+    YG++   LG  
Sbjct: 200 RSDDYARAGIPMLPNVAGPDATRLQILLYTIVLIAVAAAPWALGYFDAVYGVVSLILGAG 259

Query: 248 FTLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVD 288
             + A   ++ +E    +R T+KLF  SI YLF LF  L+ +
Sbjct: 260 MLVLAINVYMRRERSQSLRATRKLFAFSILYLFALFATLLAE 301


>gi|254391908|ref|ZP_05007101.1| cytochrome oxidase assembly factor [Streptomyces clavuligerus ATCC
           27064]
 gi|294811968|ref|ZP_06770611.1| Cytochrome oxidase assembly factor [Streptomyces clavuligerus ATCC
           27064]
 gi|197705588|gb|EDY51400.1| cytochrome oxidase assembly factor [Streptomyces clavuligerus ATCC
           27064]
 gi|294324567|gb|EFG06210.1| Cytochrome oxidase assembly factor [Streptomyces clavuligerus ATCC
           27064]
          Length = 326

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 112/289 (38%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   + + F   + AG + ALNMY D
Sbjct: 37  RVMAFVALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLATCFGGYLSAGGANALNMYID 96

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP EA V G++LAV S +  GL +NW+SA L   ++  YV
Sbjct: 97  RDIDALMDRTSGRPLVTGMVSPREALVFGITLAVVSTLWFGLLVNWLSAWLALGALLFYV 156

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SVT  +S A++V+FL+IF WTPPH+W L+
Sbjct: 157 VVYTMILKRRTAQNIVWGGIAGCMPVLIGWSSVTNSLSWAAVVLFLVIFFWTPPHYWPLS 216

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP V +++     I++Y+ +   V +L T +G+    Y  +    G
Sbjct: 217 MKVKEDYARVGVPMLPVVASNKVVARQIVLYSWVMVGVSLLLTPMGYTGWFYTAVALAAG 276

Query: 246 YHFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A                   +LF  SITY+ +LF  + VD  +
Sbjct: 277 GWWLWEAHALQTRARAGVTGGKLKEMRLFHWSITYVSLLFVAVAVDPFL 325


>gi|254475710|ref|ZP_05089096.1| protoheme IX farnesyltransferase [Ruegeria sp. R11]
 gi|214029953|gb|EEB70788.1| protoheme IX farnesyltransferase [Ruegeria sp. R11]
          Length = 313

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 126/288 (43%), Positives = 179/288 (62%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTALVGLLAAPVAVHPVVGFCAILFIAIGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT SRPIP G++ P EA  LG++L+  S++++ LA N  +   L  +IF YVVI
Sbjct: 78  IDQVMKRTKSRPIPAGKVEPGEALSLGLALSGMSVIMLALATNIFAGAFLAFTIFFYVVI 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG ++I   +MF + F+WTPPHFW+LAL 
Sbjct: 138 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGSMAIEPWLMFALTFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML        T+ HILIYT+L +++ V     G     Y  +   L   
Sbjct: 198 MRSDYDDAGVPMLTVTHGRPATRKHILIYTILLALLAVGTAFSGVGGPIYLAVAVVLNAL 257

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   AW+     E+     + +V +  F  S+ YLF+ F  ++ + ++
Sbjct: 258 FLHGAWKISRRDENDSEADNFKVERSFFKLSLLYLFLHFGAILAEAVL 305


>gi|170719317|ref|YP_001747005.1| protoheme IX farnesyltransferase [Pseudomonas putida W619]
 gi|205716302|sp|B1J467|CYOE1_PSEPW RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|169757320|gb|ACA70636.1| protoheme IX farnesyltransferase [Pseudomonas putida W619]
          Length = 297

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 114/287 (39%), Positives = 168/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     +     IA+ AG + A+N   D 
Sbjct: 12  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWSVLLFGNLGIALCAGGAAAVNHVLDR 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+++P  A +  ++LA+  + ++ +  N ++A L   S+  Y V
Sbjct: 72  RIDALMARTHKRPLAEGRVAPLPALLFALALALLGMALLLMFTNALTAWLTLASLLGYAV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA+
Sbjct: 132 LYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALAI 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +R TK+HIL+YT++   V +LP  +  +   Y +    LG 
Sbjct: 192 HRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVTLLPYAIHMSGPLYLVCALALGL 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +              F  SI YLF LF  L+VDH + +
Sbjct: 252 RFLQWAWVLYRGSR---PHAAIGTFKYSIGYLFALFIALLVDHYLLL 295


>gi|298492108|ref|YP_003722285.1| protoheme IX farnesyltransferase ['Nostoc azollae' 0708]
 gi|298234026|gb|ADI65162.1| protoheme IX farnesyltransferase ['Nostoc azollae' 0708]
          Length = 317

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 115/285 (40%), Positives = 171/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +     ++++    + A ++  +N  YD 
Sbjct: 18  IQSYYQLTKPRIIPLLLITTAGSMWIAAKGQVDPWLLIVTLIGGTLAAASAQTINCIYDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P G++ P +A +  ++LAV+S  ++ +  N ++A L F  I  YV+
Sbjct: 78  DIDHDMERTRHRPMPSGRVQPRDALIFAIALAVASFTLLTVFANLLAAVLAFSGIVFYVL 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR + QNIVIGG AGAIP ++GWA+VT  +S A+ ++F I+FLWTPPHFW+LAL
Sbjct: 138 VYTHWLKRHSTQNIVIGGAAGAIPALVGWAAVTDTLSWAAWLIFAIVFLWTPPHFWALAL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + +DDY K  IPMLP V  D+ T   I  YT+LT I  VL       + V Y +I   LG
Sbjct: 198 MIRDDYAKVGIPMLPVVAGDQATVRQIWYYTMLTVITTVLLFYPLHASGVVYAVIALSLG 257

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AWR     ED+   V ++LFL SI+Y+ +L   +++D L
Sbjct: 258 GFFIHKAWRLLQSPEDRT--VARELFLYSISYMMLLCLGMVIDSL 300


>gi|84496541|ref|ZP_00995395.1| putative cytochrome oxidase assembly factor [Janibacter sp.
           HTCC2649]
 gi|84383309|gb|EAP99190.1| putative cytochrome oxidase assembly factor [Janibacter sp.
           HTCC2649]
          Length = 293

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 151/288 (52%), Gaps = 4/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPR++ L + T    + LA  G  ++   V ++    + AGA+   N  YD DI
Sbjct: 3   NYVALTKPRIIELLLVTTVPVMFLAERGVPNLWLVVATLIGGTLSAGAANTFNCVYDRDI 62

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RP+  G+I+P    V G +L V S     + +N  SA L   +I  Y V+Y
Sbjct: 63  DALMDRTKKRPMVTGEITPRAGLVFGAALTVLSTAWFVVFVNVASALLSLAAIVLYAVLY 122

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR TPQNIV GG+AG +P +IGW++VTG V   ++++FL+IF WTPPH+W L++  
Sbjct: 123 TMILKRRTPQNIVWGGVAGCMPTLIGWSAVTGSVGWPAVILFLVIFFWTPPHYWPLSMAF 182

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY  A +PMLP           I+ Y+ +   V +    +      Y +     G  F
Sbjct: 183 KDDYANAHVPMLPVERGAIAVARQIVAYSWVMVAVSLALVPVADMGWIYLVAAVVSGAVF 242

Query: 249 TLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
              A R     +      +    +LF  SITY+ +LF  + +D L+ +
Sbjct: 243 IGEAHRLLRLAKTGAATKVLKPMRLFHFSITYVTLLFLAVAIDPLVHL 290


>gi|326386651|ref|ZP_08208273.1| protoheme IX farnesyltransferase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208966|gb|EGD59761.1| protoheme IX farnesyltransferase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 328

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 130/286 (45%), Positives = 180/286 (62%), Gaps = 3/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  L KPRV++L I+T   G++ APGHI  + +  +I  IA+GAG S ALN +++AD
Sbjct: 33  WRDFFALTKPRVITLVIFTGLCGLLAAPGHIHPVLAFTAILCIAVGAGGSAALNQWWEAD 92

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RT  RP+P G++    A   G++L+  +++ MGLAI W+ A +L +SI  Y  +
Sbjct: 93  IDAGMKRTRKRPLPDGRMDRTSARDFGIALSAGAVITMGLAIGWLDAAILAISIVYYSWV 152

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLK  TPQNIVIGG AGA PPMIGW +VTG +++  +++FLIIF+WTPPHFW+LAL 
Sbjct: 153 YTIWLKPRTPQNIVIGGGAGAFPPMIGWIAVTGHITLMPVLLFLIIFMWTPPHFWALALF 212

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K  IPM+P V  +R+T+  ILIY  L   + ++P  LG     YG+    LG  
Sbjct: 213 VQTDYAKVGIPMMPVVAGERSTRRQILIYAALLLPLTLVPWWLGKTGPVYGLSALVLGLI 272

Query: 248 FTLWAWRTFL---CKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F   +    L     E   ++  K+LF  SI YLF+LF +L+VD  
Sbjct: 273 FLGLSAVVGLRTSLPEGDRMKPEKQLFGYSILYLFILFAMLVVDRF 318


>gi|297561915|ref|YP_003680889.1| protoheme IX farnesyltransferase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846363|gb|ADH68383.1| protoheme IX farnesyltransferase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 321

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 158/288 (54%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L + T    + +A G    +  +V ++    M A ++ A+N Y D 
Sbjct: 29  VRAYVALSKPRVIELLLITTIPVMFVAAGGVPPLWTAVATLVFGTMSAASANAMNCYIDR 88

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP  +  ++P  A V G+ LAV S V   L +N +SA L   +I  Y+ 
Sbjct: 89  DIDREMRRTRQRPGAMDLVTPRGALVYGLVLAVGSTVGFALLVNVLSAVLSVFAILFYIF 148

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QN+V GGIAG +P +IGWA+VT  +  A  V+FL++F WTPPH W+LA+
Sbjct: 149 VYTLLLKRRTAQNVVWGGIAGCMPVLIGWAAVTNSLDWAPFVLFLVVFFWTPPHTWTLAM 208

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY +A +PMLP V TDR   +  ++Y+  T+IV VL   +   +  YG +   LG 
Sbjct: 209 RYKEDYAQAKVPMLPVVATDRRVLLECVLYSWATAIVSVLFWPVAGTTWFYGAVAVALGA 268

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              + A R               T   F  S  YL +LF  + VD LI
Sbjct: 269 LLVVQAHRLLNRSRAGVTGAQLKTMGFFHLSNAYLALLFVAVTVDPLI 316


>gi|302561283|ref|ZP_07313625.1| protoheme IX farnesyltransferase [Streptomyces griseoflavus Tu4000]
 gi|302478901|gb|EFL41994.1| protoheme IX farnesyltransferase [Streptomyces griseoflavus Tu4000]
          Length = 317

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D
Sbjct: 28  RVMAFVALTKPRIIELLLITTVPVMFLAQRGVPDLKLVLLTCVGGYLSAGGANALNMYID 87

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G + P E    G+SLAV S ++ GLA+NW+SA L   ++  YV
Sbjct: 88  RDIDALMDRTSQRPLVTGMVGPRECLAFGISLAVVSTLLFGLAVNWLSAWLSLGALLFYV 147

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  +S A +++FL+IF WTPPH+W L+
Sbjct: 148 VVYTMILKRRTAQNIVWGGIAGCMPVLIGWSAVTNSMSWAPVILFLVIFFWTPPHYWPLS 207

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V  ++T    I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 208 MKVKDDYARVGVPMLPVVAGNKTVAKQIVLYSWVMVGVSLLLTPLGYTGWFYTAVALAAG 267

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 268 GWWLWEAHALLNRAKAEVTGGKLKEMRLFHWSITYVSLLFVAVAVDPFL 316


>gi|254293393|ref|YP_003059416.1| protoheme IX farnesyltransferase [Hirschia baltica ATCC 49814]
 gi|254041924|gb|ACT58719.1| protoheme IX farnesyltransferase [Hirschia baltica ATCC 49814]
          Length = 321

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 130/307 (42%), Positives = 187/307 (60%), Gaps = 7/307 (2%)

Query: 3   FQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNM 62
            ++     ++ L+KPRVM L ++TAF G++ APG ++ + +  ++ ++A+ +GA+G+LNM
Sbjct: 12  IRMASFGDYVQLMKPRVMMLVVFTAFAGLIAAPGSMNWVTASAAVLSVALASGAAGSLNM 71

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           +YD DID +M RT  RPIP G I   EA  LG+ ++  S+ IM LA N ++A +L  SIF
Sbjct: 72  WYDHDIDAIMKRTVVRPIPSGLIPRDEALGLGLIMSFVSVTIMALAANPLAAGILAFSIF 131

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y V+YTIWLKR T QNIVIGG AGA PPMIGWA+ TG+  + + ++F IIF WTPPHFW
Sbjct: 132 FYAVVYTIWLKRSTSQNIVIGGAAGAFPPMIGWAAATGEAPLNAWLLFAIIFFWTPPHFW 191

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +L+L    +Y KA +PMLP     + T++ IL+Y++L   +G+ P + G     Y I  F
Sbjct: 192 ALSLWTSKEYGKAGVPMLPVTHGSKNTRLQILLYSILLLPIGMSPVVTGLGGYVYMIASF 251

Query: 243 FLGYHFTLWAWRTFLCKEDKDIR-------VTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            LG  F   A R +L K   D           KKLF  SI YLF LF +L ++  + +  
Sbjct: 252 GLGAWFLWAAIRVYLSKAGDDDAVGESDLVHAKKLFGISIVYLFALFAVLAIEQGLGLHF 311

Query: 296 VERYFFS 302
              +   
Sbjct: 312 ATPFVLE 318


>gi|317122426|ref|YP_004102429.1| protoheme IX farnesyltransferase [Thermaerobacter marianensis DSM
           12885]
 gi|315592406|gb|ADU51702.1| protoheme IX farnesyltransferase [Thermaerobacter marianensis DSM
           12885]
          Length = 339

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 119/291 (40%), Positives = 170/291 (58%), Gaps = 5/291 (1%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISV--LKSVISIFAIAMGAGASGALN 61
            + RL  ++ L KPR++ L + T F G  L  G +       V  +  +A+ +G++ ALN
Sbjct: 47  FLVRLRDYVALCKPRIVLLLLVTGFAGWWLGAGAVEAEATSLVAVLLGLALASGSANALN 106

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
            Y D DID +M RTA+RP+P G+++P +A + GV L  +S+ I+    N ++A L    I
Sbjct: 107 CYVDRDIDAVMRRTANRPLPAGRLTPRQALLFGVMLGAASMAILLWGTNPLTAGLALAGI 166

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             YV +YT+WLKR +  N VIGGIAGA+PP+IGWA+ TG ++  +LV+FL+IF W PPHF
Sbjct: 167 LFYVFVYTVWLKRRSVHNTVIGGIAGALPPLIGWAAATGGLAWPALVLFLLIFFWQPPHF 226

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W LA   +DDY++A IPMLP V     T   +L Y+  T  V +L    G A   Y +  
Sbjct: 227 WVLATFRQDDYRRAGIPMLPVVRGPSVTGRQVLGYSAATVAVSLLVYATGVAGPVYLVAA 286

Query: 242 FFLGYHFTLWAWRTF---LCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
             LG +F   AWR +       D   R  + LF  SI YLF LF ++++DH
Sbjct: 287 LLLGGYFLYLAWRAYGTWRAFRDGGERNARWLFGYSILYLFALFVLVVLDH 337


>gi|114332346|ref|YP_748568.1| protoheme IX farnesyltransferase [Nitrosomonas eutropha C91]
 gi|122313006|sp|Q0ADH9|COXX_NITEC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|114309360|gb|ABI60603.1| protoheme IX farnesyltransferase [Nitrosomonas eutropha C91]
          Length = 298

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 117/285 (41%), Positives = 176/285 (61%), Gaps = 4/285 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F  L KPRV+SL ++TA +G+ L+ PG + + K ++    I++ AGA+ ALN   +
Sbjct: 14  RIQQFYRLTKPRVVSLIVFTAVIGMFLSVPGAVPLDKLLLGTIGISLVAGAAAALNCLVE 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
              D +MART  RP+P G++S  E     V +    + I+   IN ++  L   +   Y 
Sbjct: 74  YKFDAIMARTKGRPLPQGKVSVPETLFFLVMVGGLGLFILHQWINPLTMWLTLGTFVGYA 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT+ LK  TPQNIVIGG +GA+PP++GWA++TG++S  +L++FLIIF WTPPHFW+LA
Sbjct: 134 IIYTVILKPLTPQNIVIGGASGAMPPVLGWAAITGEISADALLLFLIIFAWTPPHFWALA 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  K DY K  +PMLP    +  T++H+L+YT++  I  VLP +   + + Y + V  L 
Sbjct: 194 LYRKSDYAKIGMPMLPVTHGEEFTRLHVLLYTIILCIATVLPYLTQMSGLIYLVSVLILD 253

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F  +A R +L   D   ++ ++ F  SI YL +LFT L+VDH 
Sbjct: 254 AIFLYYAIRIYLHYTD---QIAREAFRYSIIYLALLFTALLVDHY 295


>gi|192359423|ref|YP_001981381.1| protoheme IX farnesyltransferase [Cellvibrio japonicus Ueda107]
 gi|190685588|gb|ACE83266.1| protoheme IX farnesyltransferase [Cellvibrio japonicus Ueda107]
          Length = 316

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 115/291 (39%), Positives = 172/291 (59%), Gaps = 4/291 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KP+V++L + TA+VG++LA PG   +   V +   I + A  + A N   D 
Sbjct: 25  WRDYYQLTKPKVVALLVLTAWVGMMLAVPGLPDLGLVVAASLGIGLVAAGAAAFNHVLDQ 84

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART  RP+P G+++  +A     SLAV    ++ +A+N ++A L   S+  Y V
Sbjct: 85  KIDAQMARTYMRPLPKGKLTQAQALGFASSLAVLGFTLLIVAVNPLTALLTLFSLLGYAV 144

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR TPQNIVIGG+AGA+PP++GW ++TG++   +L++ +IIF WTPPHFW+LA+
Sbjct: 145 VYTLLLKRATPQNIVIGGLAGAMPPLLGWTAITGEIHSHALLLVMIIFTWTPPHFWALAI 204

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY K +IPMLP       TK  IL+Y  L  +V +LP ++G + + Y +   +L  
Sbjct: 205 HRYKDYAKVNIPMLPVTHGIEFTKWVILLYAFLLLVVCLLPYLVGMSGIIYLLGSLYLNL 264

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            F  +AWR    K      V  + F  SI +L VLF IL+VDH +  + + 
Sbjct: 265 RFVAYAWRL---KYRPTPEVAMETFRFSIVHLMVLFLILLVDHYVQWQFLT 312


>gi|90420114|ref|ZP_01228022.1| protoheme IX farnesyltransferase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335448|gb|EAS49198.1| protoheme IX farnesyltransferase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 313

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 151/279 (54%), Positives = 196/279 (70%), Gaps = 1/279 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +I LLKPRVMSL + TA  G+ LAPG I    +VISI +IA+GAGASGALNM+YD+DI
Sbjct: 21  RDYIALLKPRVMSLVVLTAITGMALAPGAIHPTLAVISILSIAIGAGASGALNMWYDSDI 80

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA+RPIP G+I    A   G+ L++ ++ ++GLA NW +A LL  +IF Y VIY
Sbjct: 81  DAVMTRTANRPIPAGRIDREAALAFGLILSLLAVSMLGLASNWFAAGLLAFTIFFYAVIY 140

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR TPQNIVIGG AGA PPM+GWA+VTG V+I S+V+FLIIFLWTPPHFW+LA+  
Sbjct: 141 TMGLKRSTPQNIVIGGAAGAFPPMVGWAAVTGGVAIESIVLFLIIFLWTPPHFWALAMFK 200

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY    +PMLPNV  +R T++ I +Y+++   VG+ P +LGFA   YG+    LG +F
Sbjct: 201 LKDYGSVGVPMLPNVAGERATRLQIFLYSLVLVPVGIAPWLLGFAGPVYGVASVLLGANF 260

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILM 286
              A+ TF   + D+ +   KKLF  SI YLF LF IL+
Sbjct: 261 LRHAYATFRMPDGDEKMLPAKKLFAFSIVYLFALFVILL 299


>gi|254488007|ref|ZP_05101212.1| protoheme IX farnesyltransferase [Roseobacter sp. GAI101]
 gi|214044876|gb|EEB85514.1| protoheme IX farnesyltransferase [Roseobacter sp. GAI101]
          Length = 329

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 127/289 (43%), Positives = 181/289 (62%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +L  +  LLKPRVM L ++TA VG++ AP  +  + +  SI  +A+GAGASGALNM++DA
Sbjct: 32  QLGDYFALLKPRVMQLVVFTALVGMLAAPTSVHPVVAFASILFVAIGAGASGALNMWWDA 91

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RTA+RPIP G++ P EA  +GV+L+  S++++GLA N ++A +L  +I  Y V
Sbjct: 92  DIDAIMRRTANRPIPSGRVQPGEALAIGVALSGLSVMMLGLAANLLAAGMLLFTILFYAV 151

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            Y++WLKR TPQNIVIGG AGA PP+IGW   TG  S+ + +MF +IF+WTPPHFW+LAL
Sbjct: 152 FYSMWLKRLTPQNIVIGGAAGAFPPVIGWIIATGSFSVEAWLMFALIFMWTPPHFWALAL 211

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PML      R+T+ HIL YTVL  I+ +           Y      L  
Sbjct: 212 FMRNDYDDAKVPMLTVTHGRRSTRRHILAYTVLLVILAIGTGFTSIGGPIYLTAAVVLNV 271

Query: 247 HFTLWAWRTFLCKEDKDIR----VTKKLFLESITYLFVLFTILMVDHLI 291
            F + A R +   ED        + +K F  S+ YLF+ F  ++ +  +
Sbjct: 272 LFLIGAIRIWKRDEDDSEADNFLIERKFFRLSLWYLFLHFGAILAEATL 320


>gi|289753533|ref|ZP_06512911.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis
           EAS054]
 gi|289694120|gb|EFD61549.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis
           EAS054]
          Length = 297

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 163/294 (55%), Gaps = 3/294 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           +  L  ++ L KPRV+ L + TA   ++LA  G I  L  + ++    M A  +  LN  
Sbjct: 6   MSTLLAYLALTKPRVIELLLVTAIPAMLLADRGAIHPLLMLNTLVGGMMAAAGANTLNCV 65

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            DADIDK+M RTA RP+    +    A  LG++L V S   +  A N ++  L  +++  
Sbjct: 66  ADADIDKVMKRTARRPLAREAVPTRNALALGLTLTVISFFWLWCATNLLAGVLALVTVAF 125

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+WLKR T QN+V GG AG +P MIGW+++TG ++  +L MF IIF WTPPH W+
Sbjct: 126 YVFVYTLWLKRRTSQNVVWGGAAGCMPVMIGWSAITGTIAWPALAMFAIIFFWTPPHTWA 185

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K DYQ A +PMLP V T+R     ILIYT LT    ++  +    S  YG +   
Sbjct: 186 LAMRYKQDYQVAGVPMLPAVATERQVTKQILIYTWLTVAATLVLALA--TSWLYGAVALV 243

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            G  F   A + +      +     +LFL+S  YL V+F  L VD +I + T+ 
Sbjct: 244 AGGWFLTMAHQLYAGVRAGEPVRPLRLFLQSNNYLAVVFCALAVDSVIALPTLH 297


>gi|163842750|ref|YP_001627154.1| protoheme IX farnesyltransferase [Brucella suis ATCC 23445]
 gi|205693147|sp|B0CKF4|COXX_BRUSI RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|163673473|gb|ABY37584.1| protoheme IX farnesyltransferase [Brucella suis ATCC 23445]
          Length = 315

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 149/283 (52%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGASGALNM+YDADI
Sbjct: 22  RDYLVLLKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RPIP G I+P +    G++L+  S++ +GL +NW++A LL  +IF Y VIY
Sbjct: 82  DAVMKRTRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  SLV+F+IIFLWTPPHFW+L+L  
Sbjct: 142 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFT 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F
Sbjct: 202 TNDYEAARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAF 261

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 262 VYYAWRLWAADSQLQMLAAARKLFRFSLLYLAGIFAVLLFEAL 304


>gi|229820648|ref|YP_002882174.1| protoheme IX farnesyltransferase [Beutenbergia cavernae DSM 12333]
 gi|229566561|gb|ACQ80412.1| protoheme IX farnesyltransferase [Beutenbergia cavernae DSM 12333]
          Length = 293

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 152/293 (51%), Gaps = 3/293 (1%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNM 62
              ++  ++ L KPR++ L + T    ++LA G       ++ ++   A  AG++  LN 
Sbjct: 1   MRAKVGAYVALTKPRIIELLLVTTLPTMILAAGGWPGWWLAIATLVGGAFAAGSANTLNC 60

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           Y D DID++MART  RP+  G ++P EA V G+ L V +I    + +N V+A L   +I 
Sbjct: 61  YIDRDIDQVMARTRKRPLVTGAVTPREALVFGLVLGVVAIAWFAVFVNVVAAALTLTAIL 120

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            YVV YT+ LKR T QNIV GG AG +P +IGW++VTG +  A+LV+F +IF WTPPH+W
Sbjct: 121 LYVVGYTLILKRRTSQNIVWGGSAGCMPVLIGWSAVTGGLDWAALVLFGVIFFWTPPHYW 180

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
            L++  K DY  A++PMLP V  D      ++ Y V      ++   +      Y     
Sbjct: 181 PLSMKFKRDYASANVPMLPVVAADTKVAREMVAYGVAMVACTLVLIPVAGMGWLYTATAV 240

Query: 243 FLGYHFTLWAWRTFLCK--EDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             G  F       +              K+F  SITYL ++F  + VD  +  
Sbjct: 241 AAGAWFMWACIGLYRRAVGRAPGKLHAMKVFHASITYLTLVFVAIAVDPFLPF 293


>gi|104779377|ref|YP_605875.1| protoheme IX farnesyltransferase [Pseudomonas entomophila L48]
 gi|182639283|sp|Q1IGZ4|CYOE1_PSEE4 RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|95108364|emb|CAK13058.1| putative protoheme IX farnesyltransferase [Pseudomonas entomophila
           L48]
          Length = 299

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 112/287 (39%), Positives = 162/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    ++    +     I + AG +  +N   D 
Sbjct: 14  WRDYMELTKPKVVVLMLITSLVGMFLATRAGVAWSVLLFGNLGIGLCAGGAAVVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+++P  A    + LAV  + ++    N ++A L   S+  Y V
Sbjct: 74  RIDALMARTHKRPLAQGRVAPLPALAFALLLAVMGLALLLAFTNTLTAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA+
Sbjct: 134 LYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K +Y+KA IPMLP    +  T +HIL+YT++   V +LP  +  +   Y      LG 
Sbjct: 194 HRKAEYEKADIPMLPVTHGEHYTALHILLYTLILLAVSLLPYAIHMSGPLYLACALALGL 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +            K F  SI YLF LF  L+VDH + +
Sbjct: 254 RFLHWAWVLYRGTR---PHAAIKTFKYSIGYLFALFIALLVDHYLLL 297


>gi|58040294|ref|YP_192258.1| protoheme IX farnesyltransferase [Gluconobacter oxydans 621H]
 gi|81351587|sp|Q5FPU4|COXX_GLUOX RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|58002708|gb|AAW61602.1| Probable protoheme IX farnesyltransferase (heme O synthase)
           [Gluconobacter oxydans 621H]
          Length = 316

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 134/290 (46%), Positives = 188/290 (64%), Gaps = 6/290 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L  ++ LLKPRV+SL ++T   G+ +AP   S+   +I+I  I +GAGA+GA+NM+YD D
Sbjct: 25  LREWLALLKPRVISLVVFTGAAGMAVAPRWPSIPIGLITILCICIGAGAAGAINMWYDRD 84

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP G++    A V GV L+V S++++ LA N ++A +L  SIF Y VI
Sbjct: 85  IDAIMKRTVVRPIPDGRMPEQAALVYGVVLSVLSVIVLWLATNALAADILAFSIFFYSVI 144

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PPMIGWA+    +++  + MF I+FLWTPPHFWSL+L 
Sbjct: 145 YTMWLKRSTPQNIVIGGAAGAFPPMIGWAATMNSMAVLPVAMFAIVFLWTPPHFWSLSLY 204

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY KA IPMLP V   R T+  ILIYT + + V ++P+ +    +TY ++   L   
Sbjct: 205 ACKDYGKAGIPMLPVVKGARHTRWQILIYTFILTAVSLVPSFVHEVGLTYTVVTSLLDLG 264

Query: 248 FTLWAWRTFLCKEDKD------IRVTKKLFLESITYLFVLFTILMVDHLI 291
           F L A+R  + K+D +       +  +  F  S+ YLF+LF  L+VD ++
Sbjct: 265 FILCAFRVLMDKQDAEGVSLTKDKPARFAFRYSLVYLFLLFCGLLVDRVL 314


>gi|333027945|ref|ZP_08456009.1| putative protoheme IX farnesyltransferase [Streptomyces sp. Tu6071]
 gi|332747797|gb|EGJ78238.1| putative protoheme IX farnesyltransferase [Streptomyces sp. Tu6071]
          Length = 313

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 112/289 (38%), Positives = 170/289 (58%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           RL  F+ L KPR++ L + T    + LA  G   +    ++ F   + AG + ALNM+YD
Sbjct: 24  RLKGFVALTKPRIIELLLITTVPVMFLAEQGVPDLWLVFVTCFGGYLSAGGANALNMWYD 83

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ISP E  V G+ LAV S +  GL +NW+SA L   +I  YV
Sbjct: 84  RDIDALMDRTSQRPLVTGLISPREGLVFGLGLAVVSTLWFGLLVNWLSAALSLGAILLYV 143

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V YT+ LKR T QNIV GG+AG +P +IGW++VT  VS A++++FL+IF WTPPH+W L+
Sbjct: 144 VGYTMILKRRTAQNIVWGGVAGCMPVLIGWSAVTNSVSWAAVILFLVIFFWTPPHYWPLS 203

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY + ++PMLP +  ++     I++Y+ +   V +L T+LG+    Y ++    G
Sbjct: 204 MRVKDDYARVNVPMLPVIAGNKVVARQIVLYSWVMVAVSLLLTVLGYTGWFYTVVALLSG 263

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++   A       + +         +LF  SITY+ +LF  + +D  +
Sbjct: 264 GYWLWEAHGLLHRAKGEITGAKLKEMRLFHWSITYVSILFVAVAIDPFL 312


>gi|326780038|ref|ZP_08239303.1| Protoheme IX farnesyltransferase [Streptomyces cf. griseus
           XylebKG-1]
 gi|205696354|sp|B1W108|COXX_STRGG RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|326660371|gb|EGE45217.1| Protoheme IX farnesyltransferase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 315

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 165/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   + +     + AG + ALNMY D
Sbjct: 26  RVKAFVALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLTTTIGGYLSAGGANALNMYID 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ++P E    G++LAV S V  GL +NW+SA L   ++  YV
Sbjct: 86  RDIDALMDRTSQRPLVTGMVTPRECLAFGIALAVISTVWFGLLVNWLSAALALGALLFYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT ++S A++++F +IF WTPPH+W L+
Sbjct: 146 VVYTMLLKRRTSQNIVWGGIAGCMPVLIGWSAVTNELSWAAVILFAVIFFWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V T+R     I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 206 MKVKDDYARVGVPMLPVVATNRVVAKQIVLYSWVMVAVSLLLTPLGYTGWFYTAVALLSG 265

Query: 246 YHFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 266 GAWLWEAHGLQNRAKAGVTGAKLKEMRLFHWSITYVSLLFLAVAVDPFL 314


>gi|85710805|ref|ZP_01041866.1| protoheme IX farnesyltransferase [Idiomarina baltica OS145]
 gi|85695209|gb|EAQ33146.1| protoheme IX farnesyltransferase [Idiomarina baltica OS145]
          Length = 298

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 106/288 (36%), Positives = 169/288 (58%), Gaps = 4/288 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           + +   ++ L KPRV+++ + TA VG+ L+    + V   + ++  I + + A+ A+N  
Sbjct: 14  IIKWREYLELTKPRVVAMLLLTAVVGMCLSTQNALPVWTLIPALAGIGLMSAAAAAINHL 73

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D  ID  MART  RP+P G +SP         L +   V++   +N ++A L F S+  
Sbjct: 74  VDRHIDAKMARTLRRPLPQGSLSPTRVLTFATILGLVGFVMLYAWVNPLTAWLTFASMVG 133

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT++LKR TPQNIVIGG+AGA PP++GW ++T ++   ++++ +I+F WTPPHFW+
Sbjct: 134 YAVVYTMFLKRATPQNIVIGGLAGAAPPLLGWTAMTNEIHGFAILLVMIVFTWTPPHFWA 193

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  + DY +A +PMLP       TK  I +YT+L S+V +LP ++G + V Y I    
Sbjct: 194 LAVHREKDYARAKVPMLPVTHGVEFTKTCIFLYTILLSVVCLLPYLVGMSGVLYLIGSTA 253

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F  +AW+     E         +F  SI +L ++F IL+VDH +
Sbjct: 254 LNMIFLGYAWKLKYAPEKNT---AYSMFTFSIWHLMLMFVILLVDHYL 298


>gi|254419290|ref|ZP_05033014.1| protoheme IX farnesyltransferase [Brevundimonas sp. BAL3]
 gi|196185467|gb|EDX80443.1| protoheme IX farnesyltransferase [Brevundimonas sp. BAL3]
          Length = 327

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 121/303 (39%), Positives = 179/303 (59%), Gaps = 19/303 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVMS+ ++TA  G+V+APG ++ L + I+I  IA+GAGA+G+LNM  + + D
Sbjct: 23  DFFQLLKPRVMSVVVFTAATGLVMAPGSMNPLVAAIAILCIAVGAGAAGSLNMALEGETD 82

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RP+  G++   +A   GV L++ S++++G+  NW +A LL ++I  Y   YT
Sbjct: 83  ALMRRTRGRPVAAGRVRKNDAMAYGVILSLFSVMLLGMNTNWFAAGLLALTIVYYAGFYT 142

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           + LKR TPQNIVIGG AGA PP+IGWA+ TG     + ++FLIIFLWTPPH W+LAL   
Sbjct: 143 LLLKRRTPQNIVIGGAAGAFPPVIGWAAATGQAPWQAWLLFLIIFLWTPPHSWALALYSA 202

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY KA IPM+P     R+T++ ILIY+++     V P ++G   + Y ++    G  F 
Sbjct: 203 GDYAKAGIPMMPVARGARSTRLQILIYSLVFVASAVAPALVGMGGMIYAVVSVAGGLGFL 262

Query: 250 LWAWRTFLCKEDKDI-------------------RVTKKLFLESITYLFVLFTILMVDHL 290
             AWR +  +   +                    +  + LF  SI YL  LF+  +V+ +
Sbjct: 263 GLAWRLYRSRAGDEPDKADTVGREAALYDVKVQAKPARDLFAFSILYLVALFSAFLVEAV 322

Query: 291 IDM 293
             +
Sbjct: 323 AGL 325


>gi|157963817|ref|YP_001503851.1| protoheme IX farnesyltransferase [Shewanella pealeana ATCC 700345]
 gi|205716431|sp|A8H9S9|CYOE_SHEPA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|157848817|gb|ABV89316.1| protoheme IX farnesyltransferase [Shewanella pealeana ATCC 700345]
          Length = 301

 Score =  159 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 112/288 (38%), Positives = 169/288 (58%), Gaps = 4/288 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           +F+   +  + KP+V++L + T  VG+ LA PG + ++  +  +  I M AG++ A N  
Sbjct: 15  LFQWRAYYEMTKPKVVALMLLTVLVGMCLAVPGTVPLVPLIAGMAGIGMMAGSAAAFNHL 74

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D  ID +MART +RP+P G+IS  +A      L     +I+   +N ++A L F S+  
Sbjct: 75  IDRRIDGLMARTYNRPLPKGRISIIKAISFASILGTLGFIILYALVNPLTAWLTFASLIG 134

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT +LKR TPQNIV+GG+AGA+PP++GW +VTG+    +L++ +IIF WTPPHFW+
Sbjct: 135 YAVVYTAYLKRATPQNIVVGGLAGAMPPLLGWTAVTGEFHGNALLLVIIIFAWTPPHFWA 194

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K +Y K  IPMLP       TK  I +YTVL +I  +LP ++G     Y +    
Sbjct: 195 LAIHRKAEYAKVDIPMLPVTHGVEFTKTCIFLYTVLLAIACLLPVLVGMCGPVYLVSSTL 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F   AW+    K  +   +   +F  SI +L +LF  L+VDH +
Sbjct: 255 LSAGFIYKAWQL---KFHETPGLAMNVFKFSIYHLMLLFIALLVDHYL 299


>gi|300024412|ref|YP_003757023.1| protoheme IX farnesyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526233|gb|ADJ24702.1| protoheme IX farnesyltransferase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 307

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 139/286 (48%), Positives = 194/286 (67%), Gaps = 1/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  FI L+KPRVM+L ++TA   ++ APGHI+ +  +I I  IA+GAGASGALNM+YDAD
Sbjct: 18  VGDFIQLMKPRVMALVVFTALAAMLAAPGHINPVLGMIGIICIAVGAGASGALNMWYDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MARTA+RP+P G+++  EA   G  L+V S+V +G+ +NW +  LL ++I  Y+ +
Sbjct: 78  IDARMARTAARPLPRGRVTADEALSFGGVLSVGSVVTLGVLVNWTAGALLALTIAYYIFV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PPMIGWA VTG + + SL++FLIIF+WTPPHFW+LAL 
Sbjct: 138 YTMWLKRRTPQNIVIGGAAGAFPPMIGWAVVTGGIGLPSLLLFLIIFMWTPPHFWALALY 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY++  +PMLP V     T+  ILIY++L   + V+P  +G   + Y  +   LG  
Sbjct: 198 RCRDYERVGVPMLPVVAGPDATRRQILIYSILLVPLAVVPYFVGLGGLAYLGVSVVLGVV 257

Query: 248 FTLWAWRTFLCKEDKDIR-VTKKLFLESITYLFVLFTILMVDHLID 292
           F   A+R ++ +E ++     ++LFL SI YL+ LF  L V+ L  
Sbjct: 258 FLALAFRVYVTREGREADTAARRLFLFSILYLYALFATLFVEALFH 303


>gi|119716768|ref|YP_923733.1| protoheme IX farnesyltransferase [Nocardioides sp. JS614]
 gi|182639212|sp|A1SJR1|COXX_NOCSJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|119537429|gb|ABL82046.1| protoheme IX farnesyltransferase [Nocardioides sp. JS614]
          Length = 314

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 151/288 (52%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KPRV+ L + T    +  A   I  +   V ++   A  AG++   N  YD 
Sbjct: 25  LAAYVGLTKPRVIELLLLTTVPVMFFADRGIPELWLVVATVVGGAFSAGSASVFNCVYDR 84

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  R +P   +SP  A V G  L + S VI+ + +N +SA L   +   YV+
Sbjct: 85  DIDEQMRRTRRRALPRHIVSPAAALVFGFVLGILSTVILYVWVNPLSAALSVAANAFYVL 144

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GG+AG  P +IGW +VTG +S   +V+F ++F WTPPH W+LAL
Sbjct: 145 VYTMLLKRRTTQNIVWGGLAGCFPALIGWTAVTGSLSWVPVVLFAVVFFWTPPHTWALAL 204

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY    +PMLP V   R     ++IY+ +     +L   +    + Y I    LG 
Sbjct: 205 RYREDYANVDVPMLPVVAPAREVGRQVVIYSWVMVATSLLLWPVAGTGIFYPIAAGVLGA 264

Query: 247 HFTLWAWRTFLCKEDKDIRV---TKKLFLESITYLFVLFTILMVDHLI 291
            F L A R +    D +        +LF  S  YL +LF  + +D L+
Sbjct: 265 VFLLEAHRMWARSRDTESLSVIQPMRLFHSSNLYLSLLFVAVALDPLL 312


>gi|330720446|gb|EGG98757.1| Heme O synthase2C protoheme IX farnesyltransferase COX10-CtaB
           [gamma proteobacterium IMCC2047]
          Length = 296

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 165/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
            + ++ + KP+V++L + T+ +G+ L+    + +   V     IA+ AG++  +N   D 
Sbjct: 15  WHDYLEMCKPKVVALMLLTSVIGMFLSTSAMVPLEILVFGNLGIALAAGSAATVNHIVDR 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID MMART  RP+  G++   +A      + V  I ++ L +N ++A L   S+  Y  
Sbjct: 75  QIDLMMARTHKRPMAQGRVKLPQAVAFAFVVGVLGISVLALLVNPLTAWLTLASLIGYAF 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNI IGG++GA+PP++GW SVTG +   +L++ LIIF WTPPHFW+LA+
Sbjct: 135 IYTGFLKRATPQNITIGGLSGAVPPLLGWTSVTGSLDPHALLLVLIIFAWTPPHFWALAI 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KD+Y K  IPMLP     + T +HIL+YT++   V +LP + G + + Y +    LG 
Sbjct: 195 HRKDEYAKVKIPMLPVTHGKQFTALHILLYTLIMIAVSLLPFVTGMSGLLYLVSALVLGG 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  WA          +     K F  SITYL ++F  ++VDH +
Sbjct: 255 RFLYWAIVLV---RGNNAHAPLKTFRYSITYLMLMFLAMLVDHYL 296


>gi|170691527|ref|ZP_02882692.1| protoheme IX farnesyltransferase [Burkholderia graminis C4D1M]
 gi|170143732|gb|EDT11895.1| protoheme IX farnesyltransferase [Burkholderia graminis C4D1M]
          Length = 301

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 4/289 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R++ +I L KPRV  LA++ A +G+ L+ PG +     +     I + AGA+ A+N   
Sbjct: 12  SRMSQYIALTKPRVTQLAVFCAVIGMFLSTPGMVPWPVLIGGTVGIWLLAGAAFAINCLV 71

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID  M RT+ RP   G+I+  +  +    L    +  +    N ++  L   +   Y
Sbjct: 72  EQKIDAKMRRTSWRPSARGEITTSQILLFSAVLGGLGMWTLYTFANPLTMWLTVATFVGY 131

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW+L
Sbjct: 132 AVIYTLLLKPATPQNIVIGGASGAMPPALGWAAVTGHVPGDAWILVLIIFVWTPPHFWAL 191

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLPN   ++ T++HIL+YTV+   V ++P + G + V Y      L
Sbjct: 192 ALYRRKDYENAGLPMLPNTHGEKYTRLHILLYTVILFAVTMMPFISGMSGVVYLAAAVLL 251

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           G  F  +AW+ +L   D    + ++ F  SI YL +LF  L+VDH + +
Sbjct: 252 GALFLAYAWKIYLEYSDD---LARRTFRYSIVYLSLLFAALLVDHYVRV 297


>gi|290961344|ref|YP_003492526.1| cytochrome oxidase assembly factor [Streptomyces scabiei 87.22]
 gi|260650870|emb|CBG73987.1| putative cytochrome oxidase assembly factor [Streptomyces scabiei
           87.22]
          Length = 308

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 108/289 (37%), Positives = 165/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   + +     + AG + ALNMY D
Sbjct: 19  RVMAFVALTKPRIIELLLITTVPVMFLAEQGVPDLWLVLATCVGGYLSAGGANALNMYID 78

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ++P E  V G++LA  S    GL +NW+SA L   ++  YV
Sbjct: 79  RDIDALMERTSQRPLVTGMVTPREGLVFGLTLAAVSTAWFGLLVNWLSAWLSLGALLFYV 138

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  +S A++++FL+IF WTPPH+W L+
Sbjct: 139 VVYTMILKRRTSQNIVWGGIAGCMPVLIGWSAVTNSMSWAAVILFLVIFFWTPPHYWPLS 198

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V +++     I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 199 MKVKDDYARVGVPMLPVVASNKVVARQIVLYSWVMVAVSLLLTPLGYTGWFYTSVALVTG 258

Query: 246 YHFTLWAWRTFLCKEDKD---IRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       ++          +LF  SITY+ +LF  + VD  +
Sbjct: 259 GWWLWEAHALQNRAKNGSTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 307


>gi|183982268|ref|YP_001850559.1| cytochrome C oxidase assembly factor CtaB [Mycobacterium marinum M]
 gi|183175594|gb|ACC40704.1| cytochrome C oxidase assembly factor CtaB [Mycobacterium marinum M]
          Length = 324

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 111/288 (38%), Positives = 159/288 (55%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G +  L    ++    M A  +  LN   DADI
Sbjct: 37  AYLALTKPRVIELLLVTAIPAMLLADRGAVHPLIIANTLIGGMMAAAGANTLNCVADADI 96

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A + G++L V S   + L+ N +S  L   ++  YV IY
Sbjct: 97  DKVMKRTARRPLARAAVPTRSALIFGLALTVISFFWLWLSANLLSGLLALATVAFYVFIY 156

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG ++  +L MF IIF WTPPH W+LA+  
Sbjct: 157 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTLAWPALAMFAIIFFWTPPHTWALAMRY 216

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY++A +PMLP V T+R     ILIYT LT +  +   +   A   Y  +    G  F
Sbjct: 217 KDDYKEAGVPMLPAVATERQVTKQILIYTWLTVLATLA--LTPAAGWLYAAVAAVAGAWF 274

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL ++F  L VD  I + T+
Sbjct: 275 LTMAHQLYAGVRAGEAVKPLRLFLQSNNYLALVFCALAVDSAIGLPTL 322


>gi|83746849|ref|ZP_00943896.1| Protoheme IX farnesyltransferase [Ralstonia solanacearum UW551]
 gi|207727814|ref|YP_002256208.1| protoheme ix farnesyltransferase (heme o synthase) protein
           [Ralstonia solanacearum MolK2]
 gi|207742218|ref|YP_002258610.1| protoheme ix farnesyltransferase (heme o synthase) protein
           [Ralstonia solanacearum IPO1609]
 gi|83726434|gb|EAP73565.1| Protoheme IX farnesyltransferase [Ralstonia solanacearum UW551]
 gi|206591055|emb|CAQ56667.1| protoheme ix farnesyltransferase (heme o synthase) protein
           [Ralstonia solanacearum MolK2]
 gi|206593606|emb|CAQ60533.1| protoheme ix farnesyltransferase (heme o synthase) protein
           [Ralstonia solanacearum IPO1609]
          Length = 310

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 108/286 (37%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGAIGIGLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  V  + L  + +  + +  N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGTRQILVFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y  +   LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKYTLLHILLYTLIMVAATILPFVHGMSGYLYLAVALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AWR +    D    + +K F  SI YL VLF  L++DH +  
Sbjct: 261 FIAHAWRMYRSYSD---ALAQKTFRYSIVYLSVLFAALLIDHYVKF 303


>gi|114708030|ref|ZP_01440920.1| protoheme IX farnesyltransferase [Fulvimarina pelagi HTCC2506]
 gi|114536518|gb|EAU39652.1| protoheme IX farnesyltransferase [Fulvimarina pelagi HTCC2506]
          Length = 310

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 146/281 (51%), Positives = 191/281 (67%), Gaps = 1/281 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVM L + TA  G+  APG I+   ++ISI AIA+GAGASGALNM+YDADI
Sbjct: 19  RDYFALLKPRVMQLVVLTAVCGMASAPGSINPFLAIISILAIAVGAGASGALNMWYDADI 78

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M+RT  RPIP G+++P  A+  G+ L++ S++ +GLA NW +A  L  +IF YVV+Y
Sbjct: 79  DGNMSRTRLRPIPSGRVAPDAAFGFGIILSILSVMTLGLAANWFAAGFLAFTIFFYVVVY 138

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           ++ LKR TPQNIVIGG AGA PPMIGWA+VTGDVSI   V+FLIIFLWTPPHFW+LAL  
Sbjct: 139 SMGLKRSTPQNIVIGGAAGAFPPMIGWAAVTGDVSIEGFVLFLIIFLWTPPHFWALALFK 198

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             +Y    +PMLPNV  ++TT+  I  Y++L + VGV P ++GFA   YG +   +G  F
Sbjct: 199 MREYGNVGVPMLPNVAGEKTTRRQIFAYSLLLAPVGVAPFLMGFAGPVYGAVSLVMGGFF 258

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVD 288
              A+      + D+ +   KKLF  SI YLF LF  L+ +
Sbjct: 259 LKKAYAVLQMDDGDQLMIPAKKLFGFSILYLFGLFVTLLAE 299


>gi|126725952|ref|ZP_01741794.1| protoheme IX farnesyltransferase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705156|gb|EBA04247.1| protoheme IX farnesyltransferase [Rhodobacterales bacterium
           HTCC2150]
          Length = 324

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 133/286 (46%), Positives = 185/286 (64%), Gaps = 4/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              ++ L KPRVMSL ++TAFVG+V+AP  +  + +  SI  IA+GAGASGALNM++DAD
Sbjct: 28  FGDYVALFKPRVMSLVVFTAFVGLVVAPVSVHPMVAFSSILFIAIGAGASGALNMWWDAD 87

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT +RPIP G++ P EA  LG+ L+V S++++GLA N  +A LL  +IF Y V+
Sbjct: 88  IDNVMKRTQTRPIPSGRVQPGEALQLGMWLSVISVIMLGLAANIAAAALLAFTIFFYAVV 147

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+TPQNIVIGG AGA PPM+GW + TG VS+ +++MF +IF WTPPHFW+LAL 
Sbjct: 148 YTMWLKRWTPQNIVIGGAAGAFPPMVGWVAATGSVSLEAVLMFALIFFWTPPHFWALALF 207

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY KA +PML      + T+  ILIY+++ + + V           Y      +   
Sbjct: 208 VKTDYAKAGVPMLTVTHGRKETRKQILIYSLVLAPIAVGLGFTSIGGPFYLAAAVIMNAI 267

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDH 289
           F L  W+ F   E+     +    +K F  +I YLF+ FT L+V+ 
Sbjct: 268 FILGGWKIFRRNEEVTEADEHAAERKFFKFTIFYLFLHFTALLVEK 313


>gi|258652473|ref|YP_003201629.1| protoheme IX farnesyltransferase [Nakamurella multipartita DSM
           44233]
 gi|258555698|gb|ACV78640.1| protoheme IX farnesyltransferase [Nakamurella multipartita DSM
           44233]
          Length = 317

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 149/292 (51%), Gaps = 3/292 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYD 65
           RL  ++ L KPR++ L + T    +  A   +  +   + ++    + AG++ ALN   D
Sbjct: 25  RLGAYVALTKPRIIELLLITTIPAMFAAQRQVPGIGLLIATLVGGTLAAGSANALNCVVD 84

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADID +M RT +RP+    ++P  A V GV L + +  ++ +   W +A L  ++I  YV
Sbjct: 85  ADIDAVMRRTRARPLARHAVTPRAALVFGVILGILAAAVLLVFTTWQAAVLAVVAILFYV 144

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +Y++WLKR T QNIV GG+AG +P +IGW++VTG +   + V F +IF WTPPH W+LA
Sbjct: 145 FVYSMWLKRRTSQNIVWGGLAGCMPVIIGWSAVTGSIGWPAWVFFGVIFFWTPPHTWALA 204

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  + DY  A +PMLP V +DR     I++Y+       +L  ++  +S  Y  +    G
Sbjct: 205 MRYRADYAAAGVPMLPVVASDREVVRQIVLYSWAMVACSML--LIPASSWIYAAVAVPAG 262

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             F   A                 LF  S  YL  +     VD  I +  V 
Sbjct: 263 LWFLALAHLLHTRVLKGAAAKPMTLFHLSNLYLTAVSVAWAVDAAIGLPVVG 314


>gi|134097899|ref|YP_001103560.1| protoheme IX farnesyltransferase [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007383|ref|ZP_06565356.1| protoheme IX farnesyltransferase [Saccharopolyspora erythraea NRRL
           2338]
 gi|133910522|emb|CAM00635.1| protoheme IX farnesyltransferase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 291

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 111/290 (38%), Positives = 158/290 (54%), Gaps = 3/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KPRV+ L + T    + LA  G  S    ++++   AM AG++ ALN   D+
Sbjct: 2   LAAYLALTKPRVIELLLVTTVPAMFLAQRGIPSPWLVLVTLAGGAMSAGSANALNCVADS 61

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RP+   ++    A V G+ L V S  ++ L  N ++A L   +I  YV 
Sbjct: 62  DIDAVMDRTKKRPLVSYEVPRRSALVFGIVLGVVSFAVLALGANLLAAVLSLAAILFYVF 121

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GG AG +P +IGWA+VTG V   +LVMF ++FLWTPPHFWSLA+
Sbjct: 122 VYTLVLKRRTSQNIVWGGAAGCMPVVIGWAAVTGSVEWPALVMFGVVFLWTPPHFWSLAM 181

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY +A +PMLP V T R     IL+Y+  T    +L  ++   S  Y       G 
Sbjct: 182 KYREDYARAGVPMLPVVATPRQVSARILVYSWATVACTLL--LVPATSWVYVAFAVLAGA 239

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
            F + A R              KLF  S +YL +LF  + VD  + + + 
Sbjct: 240 AFLIVAQRLHNSIRRGHAYNPMKLFHLSNSYLALLFVAIAVDSAVGLPSF 289


>gi|170746481|ref|YP_001752741.1| protoheme IX farnesyltransferase [Methylobacterium radiotolerans
           JCM 2831]
 gi|205693534|sp|B1M595|COXX_METRJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|170653003|gb|ACB22058.1| protoheme IX farnesyltransferase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 316

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 136/282 (48%), Positives = 194/282 (68%), Gaps = 1/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVM L I+TA VG+V++ GH+      IS+ AIA+GAGASG LNM++DAD
Sbjct: 24  VPDYFALLKPRVMVLVIFTALVGMVVSQGHVQPAIGAISLLAIAVGAGASGCLNMWWDAD 83

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G+ L+V+S+V++GLA N ++A LL  +I  Y V+
Sbjct: 84  IDAVMSRTATRPIPSGRITSEEALGFGLFLSVASVVVLGLAANLLAAALLAFTIVFYAVV 143

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR T QNIVIGG AGA+PP+IG A VTG + I SL++F IIF+WTPPHFW+LAL+
Sbjct: 144 YSMWLKRATAQNIVIGGAAGALPPVIGQAVVTGSIGIESLILFAIIFIWTPPHFWALALI 203

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             D+Y +A IPM+PNV    +T+  I+ Y++L + +G++P  LGF  + Y ++    G  
Sbjct: 204 KADEYARAGIPMMPNVAGPASTRRQIVWYSLLLAPLGLVPVALGFGGLVYAVVGLVGGLG 263

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVD 288
              ++ R     E D + R    +F  SI YLF LF+ L+ +
Sbjct: 264 MVAFSIRVLRNPEGDAERRAAMGMFGFSILYLFALFSALLAE 305


>gi|215430342|ref|ZP_03428261.1| protoheme IX farnesyltransferase [Mycobacterium tuberculosis
           EAS054]
          Length = 292

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 114/294 (38%), Positives = 163/294 (55%), Gaps = 3/294 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           +  L  ++ L KPRV+ L + TA   ++LA  G I  L  + ++    M A  +  LN  
Sbjct: 1   MSTLLAYLALTKPRVIELLLVTAIPAMLLADRGAIHPLLMLNTLVGGMMAAAGANTLNCV 60

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            DADIDK+M RTA RP+    +    A  LG++L V S   +  A N ++  L  +++  
Sbjct: 61  ADADIDKVMKRTARRPLAREAVPTRNALALGLTLTVISFFWLWCATNLLAGVLALVTVAF 120

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YT+WLKR T QN+V GG AG +P MIGW+++TG ++  +L MF IIF WTPPH W+
Sbjct: 121 YVFVYTLWLKRRTSQNVVWGGAAGCMPVMIGWSAITGTIAWPALAMFAIIFFWTPPHTWA 180

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K DYQ A +PMLP V T+R     ILIYT LT    ++  +    S  YG +   
Sbjct: 181 LAMRYKQDYQVAGVPMLPAVATERQVTKQILIYTWLTVAATLVLALA--TSWLYGAVALV 238

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
            G  F   A + +      +     +LFL+S  YL V+F  L VD +I + T+ 
Sbjct: 239 AGGWFLTMAHQLYAGVRAGEPVRPLRLFLQSNNYLAVVFCALAVDSVIALPTLH 292


>gi|300115554|ref|YP_003762129.1| protoheme IX farnesyltransferase [Nitrosococcus watsonii C-113]
 gi|299541491|gb|ADJ29808.1| protoheme IX farnesyltransferase [Nitrosococcus watsonii C-113]
          Length = 299

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 106/289 (36%), Positives = 168/289 (58%), Gaps = 4/289 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           +     ++VL KPR++SL ++TA VG+ L+ P        +     I +GA ++ A+N  
Sbjct: 11  LTNWREYLVLCKPRIVSLIVFTAIVGMFLSVPDLAPWRVFLFGTLGIGLGAASAAAINHL 70

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D   D +M RT  RP+P G++S  +A    ++L +SS++I+   +N ++A L   S+  
Sbjct: 71  IDEKADAVMNRTQGRPLPTGKLSREQALAFAITLGLSSMIILYFLVNPLTAWLTLASMIG 130

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y +IYT +LK  TPQNIV+GG +GA+PP++GWA+VTG++ + + ++FLIIF+WTPPHFW+
Sbjct: 131 YGIIYTAFLKPATPQNIVLGGASGAMPPVLGWAAVTGELHVHAFLLFLIIFVWTPPHFWA 190

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL  +++Y +   PMLP       TK  I++YT+L   V +LP +   + + Y +    
Sbjct: 191 LALARREEYSRTKYPMLPVTHGVDFTKQQIVLYTLLLFAVSLLPFVSHMSGLLYLVGAVG 250

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           LG  F       +    +    +  K F  SI YL  LF  L+VDH + 
Sbjct: 251 LGGRFVYLTLALY---RNTSNELAMKTFGYSIVYLAALFAFLLVDHYLP 296


>gi|56697907|ref|YP_168278.1| protoheme IX farnesyltransferase [Ruegeria pomeroyi DSS-3]
 gi|81349165|sp|Q5LNX8|COXX_SILPO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|56679644|gb|AAV96310.1| protoheme IX farnesyltransferase [Ruegeria pomeroyi DSS-3]
          Length = 318

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 126/288 (43%), Positives = 178/288 (61%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG+V AP  +       +I  IA+G GASGALNM++DAD
Sbjct: 22  FGDYFALLKPRVMSLVVFTALVGLVAAPVSVHPFIGFCAILFIAIGGGASGALNMWWDAD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT  RPIP G++ P EA  LG+ L+  S++++ LA N ++   L  +IF YVV+
Sbjct: 82  IDQVMKRTKKRPIPAGKVEPGEALALGLGLSGLSVMMLALATNVLAGAFLAFTIFFYVVV 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TGD+S+   +MF + F+WTPPHFW+LAL 
Sbjct: 142 YTMWLKRTTPQNIVIGGAAGAFPPVIGWIAATGDMSVEPWLMFALTFMWTPPHFWALALF 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R T++HILIYT+L +++ +           Y  +   L   
Sbjct: 202 MRSDYDDAGVPMLTVTHGRRATRVHILIYTILLALLALGTAFSNIGGPIYLAVALVLNAL 261

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F L A R +       E  + +  +  F  S+ YLF+ F  ++ + L+
Sbjct: 262 FLLGAIRIWRRDEADSEADNFKTERGFFKLSLLYLFLHFGAILAEALL 309


>gi|326538216|gb|ADZ86431.1| protoheme IX farnesyltransferase [Brucella melitensis M5-90]
          Length = 319

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 149/283 (52%), Positives = 203/283 (71%), Gaps = 1/283 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++VLLKPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGASGALNM+YDADI
Sbjct: 26  RDYLVLLKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGASGALNMWYDADI 85

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT  RPIP G I+P +    G++L+  S++ +GL +NW++A LL  +IF Y VIY
Sbjct: 86  DAVMKRTRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIY 145

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPMIGWA+ TG+++  SLV+F+IIFLWTPPHFW+L+L  
Sbjct: 146 TMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFT 205

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F
Sbjct: 206 TNDYEAARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAF 265

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
             +AWR +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 266 VYYAWRLWAADSQPQMLAAARKLFRFSLLYLAGIFAVLLFEAL 308


>gi|77166485|ref|YP_345010.1| Protoheme IX farnesyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|254435535|ref|ZP_05049042.1| protoheme IX farnesyltransferase [Nitrosococcus oceani AFC27]
 gi|123593218|sp|Q3J6R6|CYOE_NITOC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|76884799|gb|ABA59480.1| Protoheme IX farnesyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|207088646|gb|EDZ65918.1| protoheme IX farnesyltransferase [Nitrosococcus oceani AFC27]
          Length = 299

 Score =  159 bits (401), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 106/289 (36%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           +     ++VL KPR++SL ++TA VG+ L+ P        +     I +GA ++ A+N  
Sbjct: 11  LTNWREYLVLCKPRIVSLIVFTAIVGMFLSVPDLAPWRVFLFGTLGIGLGAASAAAINHL 70

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D   D +M RT  RP+P G++S  +A    ++L +SS++I+   +N ++A L   S+  
Sbjct: 71  IDEKADAVMNRTQGRPLPTGKLSREQALAFAITLGLSSMIILYFLVNPLTAWLTLASMIG 130

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y +IYT +LK  TPQNIV+GG +GA+PP++GWA+VTG++ + + ++FLIIF+WTPPHFW+
Sbjct: 131 YGIIYTAFLKPATPQNIVLGGASGAMPPVLGWAAVTGELHVHAFLLFLIIFVWTPPHFWA 190

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL  +++Y +   PMLP       TK  I++YT L   V +LP +   + + Y +    
Sbjct: 191 LALARREEYSRTKYPMLPVTHGVDFTKQQIVLYTFLLFAVSLLPFVSHMSGLLYLVGAIG 250

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           LG  F       +    +    +  K F  SI YL  LF  L+VDH + 
Sbjct: 251 LGGRFVYLTIVLY---RNTSNELAMKTFGYSIVYLAALFAFLLVDHYLP 296


>gi|182639259|sp|A0QHX0|COXX_MYCA1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 308

 Score =  159 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 111/288 (38%), Positives = 157/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G ++ L  V ++    + AG + ALN   DADI
Sbjct: 22  AYLALTKPRVIELLLVTAIPAMLLAQRGTVNPLLIVNTLIGGMLAAGGANALNCVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A V G+ L   S + +    N +S  L   +I  YV IY
Sbjct: 82  DKVMKRTARRPLARAAVPTRNALVFGLVLTAGSFLWLWWTTNLLSGLLALATIAFYVFIY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMF IIF WTPPH W+LA+  
Sbjct: 142 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFAIIFFWTPPHTWALAMRY 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     IL+YT LT +  +   +       Y  +    G  F
Sbjct: 202 KDDYKAAGVPMLPAVATERQVTKQILVYTWLTVLATLALAL--ATGWLYAAVAVVAGVWF 259

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL V+F  L +D  I +  +
Sbjct: 260 LAMAHQLYAGVRAGEPVKPLRLFLQSNNYLAVVFCALAIDSAIGLPHL 307


>gi|89093448|ref|ZP_01166396.1| protoheme IX farnesyltransferase [Oceanospirillum sp. MED92]
 gi|89082138|gb|EAR61362.1| protoheme IX farnesyltransferase [Oceanospirillum sp. MED92]
          Length = 303

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 173/285 (60%), Gaps = 5/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ + + TA VG++LA  G   + K    +  IA+ +G++ A+N   D 
Sbjct: 16  WQDYLALCKPKVVLVMLITAAVGMLLAVEGAPPLDKVFYGLVGIALASGSAAAINHVMDR 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID+ MART  RP+P G++SP +A      + ++ I I+ + +N ++A L   ++  Y V
Sbjct: 76  KIDERMARTKGRPLPQGKLSPQQALTFAALIGIAGISILTILVNPLTAWLTVAALMGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR TPQNIVIGGIAGA PP++GW +VTG +   +L++ LIIF WTPPHFW+L +
Sbjct: 136 IYTVWLKRATPQNIVIGGIAGAAPPLLGWTAVTGTIEPNALLLVLIIFAWTPPHFWALCI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              DDY+KA +PMLP       T++ I +Y++L  +  + P M G + + Y  +V  +  
Sbjct: 196 ARIDDYRKADVPMLPVTHGIAYTRIQIALYSLLMVVTTLFPFMTGMSGIIYLCLVALINI 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  W ++ +         +  KLFL SI Y+ +LF IL+VDH +
Sbjct: 256 RFMYWVYKLWSGI----AEIPMKLFLCSINYIMLLFMILLVDHYL 296


>gi|291450719|ref|ZP_06590109.1| cytochrome oxidase assembly factor [Streptomyces albus J1074]
 gi|291353668|gb|EFE80570.1| cytochrome oxidase assembly factor [Streptomyces albus J1074]
          Length = 320

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 165/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   F+ + KPR++ L + T    + LA  G  S+   +++     + AG + ALNMY D
Sbjct: 31  RAKAFVAMTKPRIIELLLITTVPVMFLAEQGVPSLSLVLVTCLGGYLSAGGANALNMYID 90

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ISP E  V G++LAV S +  GL +NW+SA L   ++  YV
Sbjct: 91  RDIDALMERTSQRPLVTGMISPREGLVFGLALAVISTLWFGLLVNWLSAWLSLGALLFYV 150

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++VT  VS A++++FL+IF WTPPH+W L+
Sbjct: 151 VVYTMILKRRTAQNIVWGGIAGCMPVLIGWSAVTNTVSWAAVILFLVIFFWTPPHYWPLS 210

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP + ++R     I+IY+ +   V +L   LG+    Y  +    G
Sbjct: 211 MKVKEDYARVGVPMLPVIASNRVVARQIVIYSWVMVGVSLLLQPLGYTGWFYTAVALVTG 270

Query: 246 YHFTLWAWRTFLCKEDKD---IRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A                   +LF  SITY+ +LF  + VD  +
Sbjct: 271 GWWLWEAHGLQNRARQGTTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 319


>gi|50843036|ref|YP_056263.1| membrane protein, putative heme O synthase [Propionibacterium acnes
           KPA171202]
 gi|50840638|gb|AAT83305.1| conserved membrane protein, putative heme O synthase
           [Propionibacterium acnes KPA171202]
          Length = 369

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +   + ++      A ++   N   D 
Sbjct: 80  VHAYVALTKPRIIELLLVTTLPVMFLASHGVPKLGLVIATMVGGLFAAASANVFNCVIDV 139

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 140 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILWIIATIILGFGANWLSAALALIANLFYVF 199

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 200 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVGWEPLVLFFIVFWWTPPHTWALSF 259

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T  + ++   +      Y ++    G 
Sbjct: 260 RYREDYEAAGVPMLPVVRDAPEVAIQILIYTVMTVAISLVLWPVAHMGWIYVVVAVVSGA 319

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 320 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 369


>gi|320011443|gb|ADW06293.1| protoheme IX farnesyltransferase [Streptomyces flavogriseus ATCC
           33331]
          Length = 315

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 165/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   V +     + AG + ALNMY D
Sbjct: 26  RIKAFVALTKPRIIELLLITTVPVMFLAAQGVPDLWLVVTTTIGGYLSAGGANALNMYID 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G++LAV S V  GL +NW+SA L   ++  YV
Sbjct: 86  RDIDALMDRTSQRPLVTGMVSPRECLAFGIALAVISTVWFGLLVNWLSAALALGALLFYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LKR T QNIV GGIAG +P +IGW++VT  +S A++++F +IF WTPPH+W L+
Sbjct: 146 VIYTMLLKRRTSQNIVWGGIAGCMPVLIGWSAVTNSMSWAAVILFAVIFFWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V +++     I++Y+ +   V +L T LG+    Y ++    G
Sbjct: 206 MKVKDDYARVGVPMLPVVASNQVVARQIVVYSWVMVGVSLLLTPLGYTGWFYTLVAVLTG 265

Query: 246 YHFTLWAWRTFLCKED---KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 266 GFWLWEAHGLQNRAKSGVTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 314


>gi|260903767|ref|ZP_05912089.1| protoheme IX farnesyltransferase [Brevibacterium linens BL2]
          Length = 325

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 98/288 (34%), Positives = 148/288 (51%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ +I L KPRV+ L + T    + LA  G  ++   + ++   A  A ++   N Y D 
Sbjct: 33  ISAYIALTKPRVIELLLVTTAPVMFLAAQGMPNIWLVINTLIGGAAAAASASVFNCYVDR 92

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+  G+I+P  A +   +L + SI  +G   NWV+A L   +I  Y V
Sbjct: 93  DIDAKMERTKHRPLVTGEITPRAALIFAFALGLGSIFWLGGTTNWVTAGLTACAILLYAV 152

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT+ LKR T QNIV GG AG +P +IGW++VTG ++  +L++FL++F WTPPH+W LA+
Sbjct: 153 FYTLILKRRTTQNIVWGGAAGCMPVLIGWSAVTGGLAWEALLLFLVVFFWTPPHYWPLAI 212

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY  A +PMLP+ V        ++ YT    +  +    L      Y  +    G 
Sbjct: 213 KYKADYDAADVPMLPSKVPPTNVGRQMIAYTWAMVLCSLALIPLAPMGPVYTAVAVLAGA 272

Query: 247 HFTLWAWRTFLCKED---KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F    +      +           K+F  SITYL +LF  + +D  +
Sbjct: 273 WFLFSCYALVSRAKKGKSGTSLKAMKVFHGSITYLSLLFLAVAIDPFV 320


>gi|220912595|ref|YP_002487904.1| protoheme IX farnesyltransferase [Arthrobacter chlorophenolicus A6]
 gi|254765931|sp|B8H7N5|COXX_ARTCA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|219859473|gb|ACL39815.1| protoheme IX farnesyltransferase [Arthrobacter chlorophenolicus A6]
          Length = 319

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 104/289 (35%), Positives = 160/289 (55%), Gaps = 3/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   ++ L KPRV+ L + +    ++ A  G  S+   + ++   A  AG++GA N Y D
Sbjct: 25  KAKAYLALTKPRVIELLLVSTLPTMIYAERGFPSIGLILATLVGGAFAAGSAGAFNCYID 84

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+MART +RP+  G+++P EA V    L  ++I I+    N +SA L   +IF YV
Sbjct: 85  RDIDKLMARTENRPLVTGEVTPREALVFSWLLGAAAIAILWFGANPLSAWLGLGAIFFYV 144

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYTI LKR T QNIV GG AG  P +I WA+VT  V   ++++F++IFLWTPPH+W L+
Sbjct: 145 VIYTIILKRRTAQNIVWGGAAGCFPVLIAWAAVTNSVEWPAIILFMVIFLWTPPHYWPLS 204

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PML  +   +   + +++Y        +L    G A   Y +     G
Sbjct: 205 MRYGEDYRNAKVPMLGAIAGAKVVSVQVVLYAWAMVACSLLMVPAGGAGWVYTVTAVLAG 264

Query: 246 YHFTLWAWRTFLCKEDKDI--RVTKKLFLESITYLFVLFTILMVDHLID 292
             F   +   +   + +DI  +   K+F  SI+YL +LF  L VD  + 
Sbjct: 265 AWFLYESHALYNRAQREDIPDKRAMKVFHGSISYLTLLFIALAVDPFVG 313


>gi|118617455|ref|YP_905787.1| protoheme IX farnesyltransferase [Mycobacterium ulcerans Agy99]
 gi|182639208|sp|A0PPP7|COXX_MYCUA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|118569565|gb|ABL04316.1| cytochrome C oxidase assembly factor CtaB [Mycobacterium ulcerans
           Agy99]
          Length = 324

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 111/288 (38%), Positives = 159/288 (55%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G +  L    ++    M A  +  LN   DADI
Sbjct: 37  AYLALTKPRVIELLLVTAIPAMLLADRGAVHPLIIANTLIGGMMAAAGANTLNCVADADI 96

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A + G++L V S   + L+ N +S  L   ++  YV IY
Sbjct: 97  DKVMNRTARRPLARAAVPTRSALIFGLALTVISFFWLWLSANLLSGLLALATVAFYVFIY 156

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG ++  +L MF IIF WTPPH W+LA+  
Sbjct: 157 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTLAWPALAMFAIIFFWTPPHTWALAMRY 216

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY++A +PMLP V T+R     ILIYT LT +  +   +   A   Y  +    G  F
Sbjct: 217 KDDYKEAGVPMLPAVATERQVTKQILIYTWLTVLATLA--LTPAAGWLYAAVAAVAGAWF 274

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL ++F  L VD  I + T+
Sbjct: 275 LTMAHQLYAGVRAGEAVKPLRLFLQSNNYLALVFCALAVDSAIGLPTL 322


>gi|226942263|ref|YP_002797336.1| protoheme IX farnesyltransferase [Azotobacter vinelandii DJ]
 gi|259586079|sp|C1DG34|CYOE_AZOVD RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|226717190|gb|ACO76361.1| protoheme IX farnesyltransferase protein [Azotobacter vinelandii
           DJ]
          Length = 299

 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 113/287 (39%), Positives = 166/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     +     I + AGA+ A+N   D 
Sbjct: 14  WRDYLELTKPKVVVLMLITSLVGMFLASRAGVPWTVLLFGNLGIGLCAGAAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+++P  A    ++LAV+ + ++    N ++A L   S+  Y V
Sbjct: 74  RIDALMARTRRRPLAEGRVAPLAALGFALALAVAGMALLLTFTNPLAAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW +V+G +S   L++ LI+F WTPPHFW+LA+
Sbjct: 134 LYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGQLSAEPLLLVLIVFTWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K +Y KA IPMLP    +  TK+HIL+YT+    V +LP  +  +   Y +    LG 
Sbjct: 194 HRKAEYAKAEIPMLPVTHGEAYTKLHILLYTLALLAVTLLPYAIHMSGPLYLLCALLLGG 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +    D         F  SI YLF+LF  L+VDH + +
Sbjct: 254 RFLHWAWALYK---DSKPHAAIGTFKYSIRYLFLLFIALLVDHYLPL 297


>gi|284031202|ref|YP_003381133.1| protoheme IX farnesyltransferase [Kribbella flavida DSM 17836]
 gi|283810495|gb|ADB32334.1| protoheme IX farnesyltransferase [Kribbella flavida DSM 17836]
          Length = 324

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 151/288 (52%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSV-ISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    + LA G +  L  V  ++    + +G++  +N   D 
Sbjct: 36  IKAYVGLTKPRIIELLLVTTVPVMFLAAGGVPGLGVVVATLIGGILASGSANTINCVLDR 95

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P   +SP  A V G+ L V + + +GL +NW+S+ L   +   YV 
Sbjct: 96  DIDEQMRRTRRRPLPRHAVSPRSAMVFGIVLGVLATLELGLFVNWLSSGLALTANLFYVF 155

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GGIAG  P +IGW SVT +++   LV+F ++F WTPPH W+LA+
Sbjct: 156 VYTMVLKRRTVQNIVWGGIAGCFPTLIGWTSVTNELAWTPLVLFGVVFFWTPPHTWALAM 215

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY    +PMLP V T   T   IL Y+++  I  V    +      Y +    LG 
Sbjct: 216 RYREDYASVDVPMLPVVATPVATARQILAYSIVMVITSVALWPVAGTGFVYPLAAVVLGA 275

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   A+          D       +LF  S  YL +LF    +D L+
Sbjct: 276 VFLREAFALLARANTGADGPALRPMRLFHFSNIYLALLFIAAAIDPLL 323


>gi|110633100|ref|YP_673308.1| protoheme IX farnesyltransferase [Mesorhizobium sp. BNC1]
 gi|123058170|sp|Q11KD2|COXX_MESSB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|110284084|gb|ABG62143.1| protoheme IX farnesyltransferase [Chelativorans sp. BNC1]
          Length = 310

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 159/283 (56%), Positives = 210/283 (74%), Gaps = 1/283 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            FI LLKPRVMSL ++TAFVG+VLAP +     ++ISI AIA+GAGASGALNM+YDADID
Sbjct: 23  DFIALLKPRVMSLVVFTAFVGMVLAPANPHPFLALISILAIAVGAGASGALNMWYDADID 82

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +MARTA RP+P G+I+P EA   G+ L+  S+  +GL  NW++A+LL  +IF YVVIYT
Sbjct: 83  AVMARTAGRPVPAGRIAPGEALGFGLFLSAFSVGTLGLMANWLAASLLAFTIFFYVVIYT 142

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR T QNIVIGG AGA+PP++GWA++TG VS+ SLV+FLIIFLWTPPHFW+LAL  +
Sbjct: 143 MWLKRSTAQNIVIGGAAGALPPVVGWAAMTGSVSLESLVLFLIIFLWTPPHFWALALFKE 202

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY++A +PM+PNV    +T+  I  Y+VL ++ GVLPT +GFAS++YG +   LG  F 
Sbjct: 203 GDYERAGVPMMPNVAGAASTRRQIFAYSVLVAVSGVLPTAMGFASLSYGAVAAALGVAFV 262

Query: 250 LWAWRTFLCK-EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++WR    K +D  +R  K LF  S+ YLF +F  L+ D L+
Sbjct: 263 WYSWRVLAAKGQDPALRPEKALFGYSVLYLFAIFAALLCDGLV 305


>gi|154248565|ref|YP_001419523.1| protoheme IX farnesyltransferase [Xanthobacter autotrophicus Py2]
 gi|154162650|gb|ABS69866.1| protoheme IX farnesyltransferase [Xanthobacter autotrophicus Py2]
          Length = 315

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 132/285 (46%), Positives = 188/285 (65%), Gaps = 1/285 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  LLKPRVMSL I+TA VG+V APG +  + +  ++  IA+GAGA+GALNM++DADI
Sbjct: 27  RDYFELLKPRVMSLVIFTALVGLVRAPGDVHPIIAFTALLCIAVGAGAAGALNMWWDADI 86

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RT  RP+P G+++  EA   G++L+  S+V++GL +N ++  LL  +IF YVVIY
Sbjct: 87  DAIMSRTRKRPVPSGRVTAHEALAFGLTLSAFSVVVLGLLVNALAGALLAFTIFFYVVIY 146

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PP++ WA+ +G VS+  +++F IIF WTPPHFW+LAL  
Sbjct: 147 TMWLKRSTPQNIVIGGAAGAFPPLVAWAAASGTVSLEPVLLFAIIFFWTPPHFWALALYR 206

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            DDY +A +PMLP       T++ IL+YT+    +   P +LG+    YG +    G   
Sbjct: 207 ADDYARAGVPMLPVTAGPDETRLQILLYTLFLVPLAASPAVLGYVGYAYGAVAVLAGAWM 266

Query: 249 TLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
              AWR +  +E +  ++  K LF  SI YLF LF  L+ + +I 
Sbjct: 267 IALAWRVYRRREGEAAVKAAKGLFGFSIVYLFALFATLLGEAVIG 311


>gi|238028695|ref|YP_002912926.1| protoheme IX farnesyltransferase [Burkholderia glumae BGR1]
 gi|237877889|gb|ACR30222.1| Protoheme IX farnesyltransferase [Burkholderia glumae BGR1]
          Length = 300

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 106/282 (37%), Positives = 160/282 (56%), Gaps = 4/282 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
           +  L KPRV  LA++ A +G+ LA PG + +   +     I + AGA+ A+N   +  ID
Sbjct: 16  YFALTKPRVTQLAVFCAVIGMFLATPGMVPLRPLIGGTIGIWLLAGAAFAINCLVEQKID 75

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
             M RTA RP   G+I+  +       L       +    N ++  L   +   Y V+YT
Sbjct: 76  AKMRRTAWRPSARGEITTPQILAFSTVLGGVGAWTLYTFTNPLTMWLTIATFVGYAVVYT 135

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           + LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW LAL   
Sbjct: 136 LLLKPATPQNIVIGGASGAMPPALGWAAVTGTVPGDAWILVLIIFVWTPPHFWVLALYRI 195

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY+ + +PMLP    ++ T++HIL+YT++  +V ++P + G + V Y      LG  F 
Sbjct: 196 KDYENSGLPMLPVTHGEKFTRLHILLYTLILFVVTMMPFISGMSGVVYLASAVLLGAVFI 255

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +AW+ ++   D    + ++ F  SI YL +LF  L+VDH +
Sbjct: 256 AYAWKVYV---DYSDALARRAFRYSIVYLSLLFMALLVDHYL 294


>gi|289426370|ref|ZP_06428113.1| protoheme IX farnesyltransferase [Propionibacterium acnes SK187]
 gi|289153098|gb|EFD01816.1| protoheme IX farnesyltransferase [Propionibacterium acnes SK187]
          Length = 369

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 80  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 139

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 140 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGANWLSAGLALIANLFYVF 199

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 200 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 259

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 260 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 319

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 320 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 369


>gi|466878|gb|AAA17123.1| cyoE [Mycobacterium leprae]
          Length = 300

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 107/292 (36%), Positives = 160/292 (54%), Gaps = 3/292 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYY 64
            R+  ++ L KPRV+ L + TA   ++LA  G  + L  + ++      A  +   N   
Sbjct: 10  SRVLAYLALTKPRVIELLLVTAIPAMLLADRGSANPLLILNTLLGGISAAAGANTFNCVA 69

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           DADIDK+M RT+ RP+    + P  A VLG++L   S   +    N +S  L   ++  Y
Sbjct: 70  DADIDKLMKRTSRRPLARAAVPPRNALVLGLALTAGSFFWLWWTTNLLSGLLALATVAFY 129

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YT+ LKR T QN+V GG AG +P MIGW+++T  +   +L MF IIF WTPPH W+L
Sbjct: 130 VFVYTLLLKRRTSQNVVWGGAAGCMPVMIGWSAITDTIGWPALAMFAIIFFWTPPHTWAL 189

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  KDDY+ AS+PMLP V T+R     ILIYT LT++  ++  +       Y  +    
Sbjct: 190 AMRYKDDYKVASVPMLPAVATERHVTKQILIYTWLTALSTLVLALA--TGWLYMAVAVVA 247

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           G  F   A + ++     +     +LFL+S  YL V+F  L VD ++ + T+
Sbjct: 248 GAWFLTMAHQLYVGVCAGEPVKPLRLFLQSNNYLAVVFCALAVDSVLALPTL 299


>gi|325963201|ref|YP_004241107.1| protoheme IX farnesyltransferase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469288|gb|ADX72973.1| protoheme IX farnesyltransferase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 319

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 104/289 (35%), Positives = 159/289 (55%), Gaps = 3/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   ++ L KPRV+ L + +    ++ A  G  S+   + ++   A  AG++GA N Y D
Sbjct: 25  KAKAYLALTKPRVIELLLVSTLPTMIYAERGFPSIGLILATLVGGAFAAGSAGAFNCYID 84

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+M RT +RP+  G+++P EA V    L  ++I I+    N +SA L   +IF YV
Sbjct: 85  RDIDKLMHRTENRPLVTGEVTPREALVFSWLLGAAAIAILWFGANPLSAWLGLGAIFFYV 144

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYTI LKR T QNIV GG AG  P +I WA+VT  V   ++++F++IFLWTPPH+W L+
Sbjct: 145 VIYTIILKRRTAQNIVWGGAAGCFPVLIAWAAVTNSVEWPAVILFMVIFLWTPPHYWPLS 204

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PML  +   +   + +++Y        +L    G A   Y +     G
Sbjct: 205 MRYGEDYRNAKVPMLGAIAGAKVVSVQVVLYAWAMVACSLLMVPAGGAGWVYTVTAVLAG 264

Query: 246 YHFTLWAWRTFLCKEDKDI--RVTKKLFLESITYLFVLFTILMVDHLID 292
             F   +   +   + +DI  +   K+F  SI+YL +LF  L VD  I 
Sbjct: 265 AWFLYESHALYNRAQREDISDKRAMKVFHGSISYLTLLFIALAVDPFIG 313


>gi|313902145|ref|ZP_07835555.1| protoheme IX farnesyltransferase [Thermaerobacter subterraneus DSM
           13965]
 gi|313467608|gb|EFR63112.1| protoheme IX farnesyltransferase [Thermaerobacter subterraneus DSM
           13965]
          Length = 313

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 106/286 (37%), Positives = 156/286 (54%), Gaps = 4/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L+KP VM L + T    + +A G         +++    +  G++  LN   D 
Sbjct: 21  LRDYLTLMKPGVMLLVLVTTAASMWVALGEAPHPWTLFLTLVGTLLAGGSAATLNHVLDR 80

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           D+D  M RT+ RPI  G+I P +A V  V L V S  ++   +N ++A L    I  YV+
Sbjct: 81  DMDAAMPRTSRRPIAAGRIRPGQATVFAVVLGVVSFALLYTQVNPLAAYLAVGGIAFYVL 140

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR TPQNIVIGG AGA+ P+IGWA+ TG + +A+LV+FLI+F WTPPHFW+LA+
Sbjct: 141 IYTAWLKRRTPQNIVIGGAAGAVGPLIGWAAATGRLEVAALVLFLIVFFWTPPHFWALAV 200

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +D+Y +A +PMLP V     T   +  YT +T  V +    LG    TY ++   LG 
Sbjct: 201 ALRDEYARARVPMLPVVAGVEATLRQVYFYTWVTVAVTLAMLPLGQLGWTYAVVAVVLGA 260

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            +            +      + L+  SI YLF +F  +++D  + 
Sbjct: 261 RYLRLTRGLLRQTTEG---RARALYGYSIVYLFGVFGAMVLDVTLH 303


>gi|298290599|ref|YP_003692538.1| protoheme IX farnesyltransferase [Starkeya novella DSM 506]
 gi|296927110|gb|ADH87919.1| protoheme IX farnesyltransferase [Starkeya novella DSM 506]
          Length = 311

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 134/269 (49%), Positives = 189/269 (70%), Gaps = 1/269 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ ++ LLKPRVMSL I+TA VGIV APG +  + +  ++  IA+GAGASGALNM++DAD
Sbjct: 21  VSDYVALLKPRVMSLVIFTALVGIVRAPGEVHPVIAFTALLCIAIGAGASGALNMWWDAD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RT  RPIP G+++P EA   G++LAV S++++GL +N +SA LL  +IF YVVI
Sbjct: 81  IDAVMSRTKRRPIPAGRVTPGEALAFGMTLAVGSVLVLGLLVNELSAALLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+TPQNIVIGG AGA PPM+GWA+ +G + + S+++FLIIF WTPPHFW+LAL 
Sbjct: 141 YTMWLKRWTPQNIVIGGAAGAFPPMVGWAAASGGIGLESVLLFLIIFFWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY++A +PMLP V     T+  IL+YT++   + + P  LG A + YG++    G  
Sbjct: 201 KSGDYERAGVPMLPVVAGTAETRRQILLYTLILVPLAMSPFFLGMAGIGYGLVSGITGAF 260

Query: 248 FTLWAWRTFLCKED-KDIRVTKKLFLESI 275
             L A + +  +E     +  K+LF  SI
Sbjct: 261 MLLLAVQVYRRREGAPAEQAAKRLFAFSI 289


>gi|269956357|ref|YP_003326146.1| protoheme IX farnesyltransferase [Xylanimonas cellulosilytica DSM
           15894]
 gi|269305038|gb|ACZ30588.1| protoheme IX farnesyltransferase [Xylanimonas cellulosilytica DSM
           15894]
          Length = 304

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 156/291 (53%), Gaps = 4/291 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  ++ L KPR++ L + T    + LA  G   +   + ++   A+ AG++ A N YYD
Sbjct: 14  RIGAYVALTKPRIIELLLVTTIPTMFLAERGLPDLWLVLATLIGGALAAGSANAYNCYYD 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT  RP+  G+I+P  A +    L V S+V     +N  +A L F +I  YV
Sbjct: 74  RDIDAIMNRTKRRPLVTGEITPRNALIFATVLGVVSLVWFAFLVNPFAAWLTFAAIALYV 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V YT+ LKR TPQNIV GGIAG +P  IGWA+VT  +S A++ +F IIF WTPPH+W L+
Sbjct: 134 VFYTMILKRRTPQNIVWGGIAGCMPVFIGWAAVTESLSWAAVALFGIIFFWTPPHYWPLS 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K DY  A +PMLP V +DR   + +++YT    +       L   +  Y +I   L 
Sbjct: 194 VKFKRDYANAGVPMLPVVASDRRVAVEMIVYTAAMFVCSFALIPLAGMTWVYTVIAVVLA 253

Query: 246 YHFTLWAWRTF---LCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F    W           K  +V   +F  SITYL VLF  + VD  +  
Sbjct: 254 AWFGWQTWLMLDNTRRGRAKTGKVAMNVFHASITYLTVLFVAVAVDVFLPF 304


>gi|254465236|ref|ZP_05078647.1| protoheme IX farnesyltransferase [Rhodobacterales bacterium Y4I]
 gi|206686144|gb|EDZ46626.1| protoheme IX farnesyltransferase [Rhodobacterales bacterium Y4I]
          Length = 313

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 129/288 (44%), Positives = 179/288 (62%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTALVGLLAAPVSVHPVVGFCAILFIAIGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           IDK+M RT SRPIP G++ P EA  LG++L+  S++++ LA N  +   L  +IF YVV+
Sbjct: 78  IDKVMKRTKSRPIPAGKVEPGEALALGLALSGLSVIMLALAANVFAGAFLAFTIFFYVVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +S+   +MFL+ F+WTPPHFW+LAL 
Sbjct: 138 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGTMSVEPWLMFLLTFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R T++HIL+YTVL +++ V     G     Y      +   
Sbjct: 198 MRSDYDDAGVPMLTVTHGRRATRVHILVYTVLLALLAVGTAFSGIGGPIYLAAALVMNAL 257

Query: 248 FTLWAWRTFLCKEDKDIR----VTKKLFLESITYLFVLFTILMVDHLI 291
           F   AW+     ED        V +  F  S+ YLF+ F  ++ + L+
Sbjct: 258 FLHGAWKITRRDEDDSEADNFTVERSFFKLSLLYLFLHFGAILAEALL 305


>gi|261251730|ref|ZP_05944304.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           orientalis CIP 102891]
 gi|260938603|gb|EEX94591.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           orientalis CIP 102891]
          Length = 298

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 116/285 (40%), Positives = 173/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA PG + +  +V+ +  I + AG++ A N   D 
Sbjct: 16  WRSYLSLTKPKVVALMLLTALVGMCLAVPGALPIQGTVLGLLGIGLMAGSAAAFNHLIDQ 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+P G+I     +   +++ V   V++   +N ++A L F S+  Y V
Sbjct: 76  RIDAIMARTYKRPLPSGEIKSSHVFGFALAIGVVGFVVLYAGVNALTAWLTFASLLGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 136 VYTLYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWALAI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY KA IPMLP       TK  IL+YTVL  ++ +LP ++G   + Y      L  
Sbjct: 196 HRKDDYAKADIPMLPVTHGVEYTKTSILLYTVLLYLICLLPALVGMTGIFYLTASTVLCS 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW+    K   D     K F+ SI +L +LF  L++DH I
Sbjct: 256 LFVWHAWKL---KYTNDESRAIKTFVFSIYHLMLLFVALLIDHYI 297


>gi|300705273|ref|YP_003746876.1| protoheme ix farnesyltransferase [Ralstonia solanacearum CFBP2957]
 gi|299072937|emb|CBJ44293.1| protoheme IX farnesyltransferase [Ralstonia solanacearum CFBP2957]
          Length = 310

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 108/286 (37%), Positives = 163/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGAVGIWLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  V  + L  + +  + +  N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGARQILVFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFAWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y ++   LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKYTLLHILLYTLIMVAATILPFVHGMSGYLYLVVALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AWR +    D    + +K F  SI YL VLF  L++DH +  
Sbjct: 261 FIAHAWRMYRSYSD---ALAQKTFRYSIVYLSVLFAALLIDHYVKF 303


>gi|94309215|ref|YP_582425.1| protoheme IX farnesyltransferase [Cupriavidus metallidurans CH34]
 gi|93353067|gb|ABF07156.1| Protoheme IX farnesyltransferase (heme O synthase) [Cupriavidus
           metallidurans CH34]
          Length = 312

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 107/286 (37%), Positives = 163/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 26  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWSVLIGGAAGIWLLAGAAFAINCLVEQK 85

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  +    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 86  IDALMRRTAWRPSATGEITTTQTLIFSAVLGGAGMWLLHVFANDLTMWLTFATFLGYAVV 145

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GW++V+G V   +  + LIIF WTPPHFW+LAL 
Sbjct: 146 YTILLKPATPQNIVIGGLSGAMPPALGWSAVSGTVPAEAWFLVLIIFTWTPPHFWALALY 205

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    +R T +HIL+YT++     +LP + G +   Y +    LG  
Sbjct: 206 RRADYAKSGLPMLPITHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLVAALGLGLV 265

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AW+ +    D    + ++ F  SI YL +LF +L+VDH    
Sbjct: 266 FLGYAWKLYRNYSDG---LAQRTFRYSILYLSLLFAVLLVDHYFKF 308


>gi|289642762|ref|ZP_06474900.1| protoheme IX farnesyltransferase [Frankia symbiont of Datisca
           glomerata]
 gi|289507415|gb|EFD28376.1| protoheme IX farnesyltransferase [Frankia symbiont of Datisca
           glomerata]
          Length = 356

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 99/272 (36%), Positives = 147/272 (54%), Gaps = 1/272 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             ++ L KPR++   + T    ++LA  G  S    + ++      AG++   N Y D D
Sbjct: 71  RSYVALTKPRIIEQLLITTIPVMLLAEHGLPSPWLILATLVGGTFAAGSANTFNCYIDRD 130

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++MART +RP+    ++P EA   G  L V++ ++ G A+NW SA L   +I  YV +
Sbjct: 131 IDQVMARTRTRPLVRANVTPAEALRFGFLLGVAATLLFGFAVNWPSALLADAAIAFYVFV 190

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR +P NIVIGG AG  P +IGW++VTG +   ++++F +IF WTPPHFW+LA+ 
Sbjct: 191 YTLGLKRRSPSNIVIGGAAGCFPVLIGWSAVTGTIGWPAVLLFAVIFFWTPPHFWALAIK 250

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +DDY  A IPMLP V +       IL Y+ +     +L   +      Y ++   LG  
Sbjct: 251 YRDDYAAAGIPMLPVVASPTVVARRILGYSYVMVATSLLLVPVADTGWPYLVVAALLGGW 310

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLF 279
           F + A R              +LF  SITYL 
Sbjct: 311 FLVEAHRLVHSVRRGGQIRPMRLFHLSITYLT 342


>gi|221635801|ref|YP_002523677.1| protoheme IX farnesyltransferase (Heme O synthase) (HemeB
           farnesyltransferase) [Thermomicrobium roseum DSM 5159]
 gi|221157821|gb|ACM06939.1| protoheme IX farnesyltransferase (Heme O synthase) (HemeB
           farnesyltransferase) [Thermomicrobium roseum DSM 5159]
          Length = 603

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 116/285 (40%), Positives = 175/285 (61%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++VL KP VM L + T    +++A  G  S+     ++   A+ +G +GA+N Y D 
Sbjct: 321 VRDYLVLTKPGVMVLLLVTTLCAMLVAAQGVPSLWTLFWTLVGGALASGGAGAINHYVDR 380

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RP+P G+++P  A + G+ L+V ++ ++   +N V+A L       YV 
Sbjct: 381 DIDAIMTRTRRRPLPAGRVAPEYALLFGIVLSVLAVYVLTAFVNPVAAVLSLSGNLFYVF 440

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YTIWLKR TPQNIVIGG AGA+PP++GWA+VTG VS+ +L+MFL++F WTPPHFW+LAL
Sbjct: 441 VYTIWLKRTTPQNIVIGGAAGAVPPLVGWAAVTGQVSVPALLMFLLVFAWTPPHFWALAL 500

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A +PMLP V  +  T+  IL YTV   +  +L   LG   V Y +    LG 
Sbjct: 501 YKRGDYAAAGVPMLPAVRGEEETRRQILAYTVAMVLASLLFYPLGVLGVPYLVAAMVLGA 560

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F     R +  + D   ++ K++FL S+ YL +LF  +++D ++
Sbjct: 561 RFLWLVARLYRERSD---QLAKRVFLYSMQYLGLLFAAMVIDAVV 602


>gi|30249013|ref|NP_841083.1| protoheme IX farnesyltransferase [Nitrosomonas europaea ATCC 19718]
 gi|75540753|sp|Q82VQ6|COXX_NITEU RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|30138630|emb|CAD84921.1| UbiA prenyltransferase [Nitrosomonas europaea ATCC 19718]
          Length = 298

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 117/285 (41%), Positives = 175/285 (61%), Gaps = 4/285 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F  L KPRV+SL ++TA +G+ L+ PG + + K +     I++ AGA+ ALN   +
Sbjct: 14  RVQQFYRLTKPRVVSLIVFTAVIGMFLSVPGAVPLDKLIFGTVGISLVAGAAAALNCLVE 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
              D +MART  RP+P G++S  E     V +    + ++   +N ++  L   +   Y 
Sbjct: 74  YKFDAIMARTKGRPLPQGKVSVPETLFFLVLIGGFGLFMLHQWVNPLTMWLTLGTFVGYA 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT+ LK  TPQNIVIGG +GA+PP++GWA+VTG++S  +L++FLIIF WTPPHFW+LA
Sbjct: 134 IIYTVILKPLTPQNIVIGGASGAMPPVLGWAAVTGEISADALLLFLIIFAWTPPHFWALA 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  K DY K  +PMLP    D  T++H+L+YT++  +V VLP +   + + Y   V  L 
Sbjct: 194 LYRKTDYAKIGMPMLPVTHGDEFTRLHVLLYTIILCVVTVLPYLTQMSGLIYLGSVLILD 253

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F  +A R +L   D   ++ ++ F  SI YL +LFT L+VDH 
Sbjct: 254 AIFFYYAIRIYLHYTD---QIAREAFRYSIAYLALLFTALLVDHY 295


>gi|315122179|ref|YP_004062668.1| protoheme IX farnesyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495581|gb|ADR52180.1| protoheme IX farnesyltransferase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 309

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 233/302 (77%), Positives = 267/302 (88%), Gaps = 1/302 (0%)

Query: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGAL 60
           M+F+  R+NFFI LLKPRVMSLA+YTA VGIVLA GHIS LK +ISIFAIAMGAGASGAL
Sbjct: 8   MHFEGLRINFFITLLKPRVMSLAVYTALVGIVLASGHISFLKGIISIFAIAMGAGASGAL 67

Query: 61  NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS 120
           NMYYD+DIDK+M RTASRPIP+G+I+PWEA V G+ LA+ SI IMGLAINW+SATLLF+S
Sbjct: 68  NMYYDSDIDKVMMRTASRPIPIGKIAPWEALVFGIFLAILSITIMGLAINWMSATLLFLS 127

Query: 121 IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH 180
           IF Y++IYT+WLKR TPQNIVIGGIAGAIPPMIGW+SVTGD+SI  LVMFLIIFLWTPPH
Sbjct: 128 IFFYIIIYTVWLKRRTPQNIVIGGIAGAIPPMIGWSSVTGDISIEGLVMFLIIFLWTPPH 187

Query: 181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII 240
           FWSLALL K+DY+ A +PMLPNV TDRTTK+HIL+YTVLTSIVG LPT+LGFAS+ YGII
Sbjct: 188 FWSLALLYKNDYEMAGVPMLPNVSTDRTTKIHILVYTVLTSIVGFLPTILGFASILYGII 247

Query: 241 VFFLGYHFTLWAWR-TFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERY 299
           VFFLG +F LWA R TFLC E++ I V KKLFL SI+YLF+LF+ILMVDHLI +KT+E Y
Sbjct: 248 VFFLGCNFVLWALRATFLCTEEQSIIVIKKLFLTSISYLFILFSILMVDHLIGIKTIEYY 307

Query: 300 FF 301
           F 
Sbjct: 308 FL 309


>gi|302550621|ref|ZP_07302963.1| protoheme IX farnesyltransferase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302468239|gb|EFL31332.1| protoheme IX farnesyltransferase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 307

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 109/289 (37%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D
Sbjct: 18  RVMAFVALTKPRIIELLLITTVPVMFLAQQGVPDLTLVLLTCVGGYLSAGGANALNMYID 77

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G++LAV S ++ GL +NW+SA L   ++  YV
Sbjct: 78  RDIDALMDRTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGLTVNWLSAWLSLGALLFYV 137

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW SVT  +S A +++FL++F WTPPH+W L+
Sbjct: 138 VVYTMILKRRTSQNIVWGGIAGCLPVLIGWTSVTNSMSWAPVILFLVMFFWTPPHYWPLS 197

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY +  +PMLP V +++     I+IY+ +   V +L T LG+    Y  +    G
Sbjct: 198 MKVKEDYARVGVPMLPVVASNKVVAKQIVIYSWVMVAVSLLLTPLGYTGWFYTAVALLAG 257

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 258 GFWLWEAHGLQNRAKAEVTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 306


>gi|89055645|ref|YP_511096.1| protoheme IX farnesyltransferase [Jannaschia sp. CCS1]
 gi|122498010|sp|Q28MJ1|COXX_JANSC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|88865194|gb|ABD56071.1| protoheme IX farnesyltransferase [Jannaschia sp. CCS1]
          Length = 309

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 141/290 (48%), Positives = 186/290 (64%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VGI++APG +S +    +I  IA+GAGASGALNM+YDAD
Sbjct: 19  FGDYFALLKPRVMSLVVFTALVGILVAPGGVSPMIGFTAILFIALGAGASGALNMWYDAD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP+P G++   EA  LG+ L+  S+ ++GLA NWV+A LL  +IF Y V+
Sbjct: 79  IDAVMKRTAKRPVPAGKVPAGEALTLGLWLSAISVAMLGLATNWVAAGLLAFTIFFYAVV 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TP NIVIGG AG+ PPMIGWA+VTGDVS+AS++MF IIF+WTPPHFW+LAL 
Sbjct: 139 YSMWLKRATPWNIVIGGAAGSFPPMIGWAAVTGDVSLASVLMFGIIFMWTPPHFWALALF 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML        T+  ILIYT+L   V +   +   A   Y I        
Sbjct: 199 LKKDYNNAGVPMLTVTHGRTETRRQILIYTILLVPVALGLVLTEVAGPVYLITALVCNAI 258

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   A+  +       E     V KK+F  S+ YLF+ F  L++D +  +
Sbjct: 259 FLKGAYDIWKRDEAMAEADGYAVEKKVFKFSLLYLFLHFGALLLDAIWRL 308


>gi|295839556|ref|ZP_06826489.1| protoheme IX farnesyltransferase [Streptomyces sp. SPB74]
 gi|295827539|gb|EDY43796.2| protoheme IX farnesyltransferase [Streptomyces sp. SPB74]
          Length = 318

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 170/289 (58%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           RL  F+ L KPR++ L + T    + LA  G   +   +++ F   + AG + ALNM+YD
Sbjct: 29  RLMGFVALTKPRIIELLLITTVPVMFLAEQGFPDLWLVLVTCFGGYLSAGGANALNMWYD 88

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G ISP E  V G+ L+  S +  GL +NW+SA L   +I  YV
Sbjct: 89  RDIDALMDRTSQRPLVTGLISPREGLVFGLGLSAVSTLWFGLLVNWLSAALSLGAILLYV 148

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V YT+ LKR T QNIV GG+AG +P +IGW++VT  VS A++++FL+IF WTPPH+W L+
Sbjct: 149 VGYTMILKRRTAQNIVWGGVAGCMPVLIGWSAVTDSVSWAAVILFLVIFFWTPPHYWPLS 208

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY + ++PMLP V  ++     I++Y+ +   V +L T+LG+    Y ++    G
Sbjct: 209 MRVKDDYARVNVPMLPVVAGNKAVAKQIVLYSWIMVAVSLLLTVLGYTGWFYTLVALLSG 268

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++   A       + +         +LF  SITY+ +LF  + +D  +
Sbjct: 269 GYWLWEAHALLHRAKGEITGARLKEMRLFHWSITYVSILFVAVAIDPFL 317


>gi|77462372|ref|YP_351876.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|126461249|ref|YP_001042363.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332560256|ref|ZP_08414578.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides WS8N]
 gi|123592854|sp|Q3J5F9|COXX_RHOS4 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639223|sp|A3PGX5|COXX_RHOS1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|51511181|gb|AAU04882.1| heme O synthase [Rhodobacter sphaeroides]
 gi|77386790|gb|ABA77975.1| Heme O synthase [Rhodobacter sphaeroides 2.4.1]
 gi|126102913|gb|ABN75591.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332277968|gb|EGJ23283.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 310

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 130/288 (45%), Positives = 182/288 (63%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              ++ LLKPRVMSL ++TA VG+++AP  +  + ++  I  IA+GAGASGALNM++D D
Sbjct: 15  FGDYVALLKPRVMSLVVFTALVGLLVAPVTVHPMIALTGILFIALGAGASGALNMWWDED 74

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT +RP+P G ++P EA  +G++L+  ++V++GLA N  +A LL  +IF Y V+
Sbjct: 75  IDRVMKRTRNRPVPSGTVAPGEALGIGLALSGIAVVMLGLATNLFAAGLLAFTIFFYAVV 134

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TPQNIVIGG AGA PPMIGWA  TG VS+ SL MF +IF+WTPPHFWSLAL 
Sbjct: 135 YSMWLKRTTPQNIVIGGAAGAFPPMIGWAVATGGVSVESLFMFALIFMWTPPHFWSLALF 194

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML      R T+ H+L+Y++L + + V     G     Y      L   
Sbjct: 195 MKSDYSDAGVPMLTVTHGRRVTRAHVLVYSLLLAPLAVAGAFTGIGGPLYLATALALNGW 254

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             + A R +       E    RV K  F  S+ YLF+ F  ++ +  +
Sbjct: 255 LLVGAVRIWRRDEAQAEADRYRVEKGFFRFSLYYLFLHFGAILAEAAL 302


>gi|84685601|ref|ZP_01013498.1| protoheme IX farnesyltransferase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666267|gb|EAQ12740.1| protoheme IX farnesyltransferase [Rhodobacterales bacterium
           HTCC2654]
          Length = 310

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 137/285 (48%), Positives = 182/285 (63%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG+++APG I+    + +I  IA+G GASGALNM++DAD
Sbjct: 15  FGDYFALLKPRVMSLVVFTALVGLLVAPGQINPFVGLCAILFIAVGGGASGALNMWWDAD 74

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RT  RPIP G++ P EA  LGV+L   S++++ LA NWV+  LL  +IF YVVI
Sbjct: 75  IDARMKRTIKRPIPAGKVEPGEALGLGVALTGFSVILLFLATNWVAGALLAFTIFFYVVI 134

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+TPQNIVIGG AGA PPMIGWA+VTGD++I S++MF + F WTPPHFWSLAL 
Sbjct: 135 YTMWLKRWTPQNIVIGGAAGAFPPMIGWAAVTGDITIESILMFALTFAWTPPHFWSLALF 194

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY+ A +PML      R T+ HIL YT + + V +   +       Y  +   L   
Sbjct: 195 VKSDYKDAGVPMLTVTHGRRVTRNHILGYTFVLAAVALGLGLTSIGGPAYMAVAVILNGW 254

Query: 248 FTLWAWRTFLCKEDKDIR----VTKKLFLESITYLFVLFTILMVD 288
           F   A   +   +         V +K F  S+ YLF+ F +L+V+
Sbjct: 255 FIKGAIDIWRRTDADSEADSHLVERKFFKFSLFYLFIHFGMLLVE 299


>gi|260460303|ref|ZP_05808555.1| protoheme IX farnesyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033948|gb|EEW35207.1| protoheme IX farnesyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 314

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 152/283 (53%), Positives = 206/283 (72%), Gaps = 1/283 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVMSL ++TAFVG+V AP  I+ L +VI+I AIA+GAGASGALNM+YDADID
Sbjct: 23  DFFALLKPRVMSLVVFTAFVGLVAAPVTINPLLAVIAILAIAIGAGASGALNMWYDADID 82

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RTASRP+P G+I P EA   G+ L+  S++ +G+  NW++ATLL  +IF Y V+YT
Sbjct: 83  AVMTRTASRPVPSGRIQPHEALTFGLVLSALSVMTLGVLANWLAATLLAFTIFFYAVVYT 142

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR+TPQNIVIGG AGAIPP+IGWA+VTG VS+ S+V+FLIIFLWTPPHFW+LAL   
Sbjct: 143 MWLKRWTPQNIVIGGAAGAIPPVIGWAAVTGSVSVESIVLFLIIFLWTPPHFWALALFKS 202

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY++A IPM+PNV    +T+  I  Y ++ + VGV P +LG+ +  YG+    LG  F 
Sbjct: 203 EDYERAGIPMMPNVAGHASTRRQIFAYALVLAPVGVSPWLLGYTTPIYGVAAALLGAGFV 262

Query: 250 LWAWRTF-LCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +AW+   +  +D+ ++  K LF  S+ YLF +F   + D ++
Sbjct: 263 WYAWKVLGMADDDRAMKPAKALFAYSLLYLFAIFAAYLADSVV 305


>gi|254384178|ref|ZP_04999522.1| cytochrome oxidase assembly factor [Streptomyces sp. Mg1]
 gi|194343067|gb|EDX24033.1| cytochrome oxidase assembly factor [Streptomyces sp. Mg1]
          Length = 315

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G  S+   +++ F   + AG + ALNMY D
Sbjct: 26  RVMAFVALTKPRIIELLLITTVPVMFLAEQGVPSLWLVLVTCFGGYLSAGGANALNMYID 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RTA RP+  G +SP E  V G++L V S +  GL +NW+SA L   ++  YV
Sbjct: 86  RDIDALMDRTAQRPLVTGMVSPRECLVFGITLGVVSTLFFGLLVNWLSAALSLGALLFYV 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SV  +VS A++++FL+IF WTPPH+W L+
Sbjct: 146 VVYTMLLKRRTTQNIVWGGIAGCMPVLIGWSSVKNEVSWAAVILFLVIFFWTPPHYWPLS 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V  +R     I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 206 MKVKDDYARVGVPMLPVVAGNRAVARQIVVYSWVMVAVSLLLTPLGYTGWFYTAVALVSG 265

Query: 246 YHFTLWAWRTFLCKED---KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 266 GWWLWEAHALNARAKSGVTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 314


>gi|296129777|ref|YP_003637027.1| protoheme IX farnesyltransferase [Cellulomonas flavigena DSM 20109]
 gi|296021592|gb|ADG74828.1| protoheme IX farnesyltransferase [Cellulomonas flavigena DSM 20109]
          Length = 342

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 149/289 (51%), Gaps = 3/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L + T    + LA  G  S+     ++   A  AGA+  LN Y + 
Sbjct: 54  VGAYVALTKPRVIELLLITTVPTMFLAARGMPSLGLVAATLLGGAGAAGAANTLNQYLEH 113

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPI  G+++   A V G+ L   S+  M  A+N  SA     ++  YVV
Sbjct: 114 DIDAVMNRTRRRPIVTGRVTARAALVFGLVLGAVSLTWMWFAVNPASALWTASAVLIYVV 173

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT+ LKR T QNIV GG AG +P +IGW++VTG +S  + ++F ++F WTPPH+W L++
Sbjct: 174 GYTMILKRRTSQNIVWGGAAGCMPVVIGWSAVTGGISWEACLLFGVVFFWTPPHYWPLSM 233

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A +PMLP V  D      ++ YTV      +L   +G  +  YG++   LG 
Sbjct: 234 KFRRDYAAAGVPMLPVVAADTRVAREMIAYTVAMIACSLLLWPVGGMTWVYGLVATALGL 293

Query: 247 HFTLWAWRTFLCKEDK--DIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F            D          +F  SITYL +L   + VD  + +
Sbjct: 294 WFLWLCVGLLRRARDPQHPPLRAMTVFHGSITYLTLLSVAVTVDVFLPL 342


>gi|254512048|ref|ZP_05124115.1| protoheme IX farnesyltransferase [Rhodobacteraceae bacterium KLH11]
 gi|221535759|gb|EEE38747.1| protoheme IX farnesyltransferase [Rhodobacteraceae bacterium KLH11]
          Length = 334

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 126/288 (43%), Positives = 178/288 (61%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG++ AP  +       +I  IA+G GASGALNM++DAD
Sbjct: 38  FGDYFALLKPRVMSLVVFTALVGLIAAPVPVHPFVGFCAILFIAIGGGASGALNMWWDAD 97

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT  RPIP G++   EA  LG++L+  S++++GLA NW +   L  +IF YVV+
Sbjct: 98  IDRVMKRTKGRPIPSGKVEAGEALALGLALSGLSVIMLGLATNWFAGAFLAFTIFFYVVV 157

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +++   +MF + F+WTPPHFW+LAL 
Sbjct: 158 YTMWLKRSTPQNIVIGGAAGAFPPVIGWVAATGSMTLEPWLMFALTFMWTPPHFWALALF 217

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      RTT+ HIL+YT L +++ V           Y ++   L   
Sbjct: 218 MRSDYDDAGVPMLTVTHGRRTTRWHILVYTALLALLAVGTAFSDIGGPIYLVVALVLNAL 277

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   AW      ED     + +V +  F  S+ YLF+ F  ++ + L+
Sbjct: 278 FLRGAWVISRRTEDDAEMDNFKVERSFFKLSLLYLFLHFGAILAEALL 325


>gi|254821677|ref|ZP_05226678.1| protoheme IX farnesyltransferase [Mycobacterium intracellulare ATCC
           13950]
          Length = 308

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 111/288 (38%), Positives = 156/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G ++ L  V ++    + AG +  LN   DADI
Sbjct: 22  AYLALTKPRVIELLLVTAIPAMLLAQRGTVNPLLIVNTLIGGMLAAGGANTLNCVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A VLG+ L V S   +    N +S  L   +I  YV +Y
Sbjct: 82  DKVMKRTARRPLARAAVPTRNALVLGLVLTVGSFFWLWWTTNLLSGLLALATIAFYVFVY 141

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VT  +   +LVMF IIF WTPPH W+LA+  
Sbjct: 142 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTNTIGWPALVMFAIIFFWTPPHTWALAMRY 201

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     ILIYT LT +  +   +       Y  +    G  F
Sbjct: 202 KDDYKAAGVPMLPAVATERQVTKQILIYTWLTVLSTLALALA--TGWLYAAVAVVAGVWF 259

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL V+F  L +D  I +  +
Sbjct: 260 LAMAHQLYAGVRVGEPVKPLRLFLQSNNYLAVVFCALAIDSAIGLPHL 307


>gi|255262600|ref|ZP_05341942.1| protoheme IX farnesyltransferase [Thalassiobium sp. R2A62]
 gi|255104935|gb|EET47609.1| protoheme IX farnesyltransferase [Thalassiobium sp. R2A62]
          Length = 313

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 130/287 (45%), Positives = 183/287 (63%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TAFVG+++AP  +      I I  IA+GAGASGALNM++DAD
Sbjct: 17  FGDYFALLKPRVMSLVVFTAFVGLLVAPVPVHPFIGFIGILCIAVGAGASGALNMWWDAD 76

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RPIP G++ P EA  +G++L+V S++++ LA N ++A LL  +IF Y V+
Sbjct: 77  IDAVMKRTARRPIPAGKVQPGEALGIGLTLSVFSVILLWLATNAMAAFLLAFTIFFYAVV 136

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TPQNIVIGG AGA PP++GWA  TG +S+ S++MF++IF+WTPPHFW+LAL 
Sbjct: 137 YSMWLKRATPQNIVIGGAAGAFPPIVGWAVATGGISVESVLMFVVIFMWTPPHFWALALF 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML      ++T+ HIL+Y  L + V V           Y +    +   
Sbjct: 197 MKSDYDDAGVPMLTVTHGRKSTRKHILVYAALLAPVAVALAFTSVGGPVYLVTALAMNVW 256

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F   ++  +   E      +    KK+F  S+ YLF  F  L+VD +
Sbjct: 257 FVKGSYDIWRRDETQAEADNYLTEKKVFKFSLLYLFGHFGALVVDAV 303


>gi|296170687|ref|ZP_06852262.1| protoheme IX farnesyltransferase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894676|gb|EFG74410.1| protoheme IX farnesyltransferase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 293

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 159/288 (55%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + T    ++LA  G +  L  + ++    + AG +  LN   DADI
Sbjct: 7   AYLALTKPRVIELLLVTTIPAMLLAHRGTVDPLLILNTLIGGMLAAGGANTLNCVADADI 66

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A V G++L+V+S   +    N +SA L   +I  YV +Y
Sbjct: 67  DKVMKRTARRPLARAAVPRSHALVFGLALSVASFFWLWWTTNMLSAHLAGATIAFYVFVY 126

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG ++  +LVMF IIF WTPPH W+LA+  
Sbjct: 127 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIAWPALVMFAIIFFWTPPHTWALAMRY 186

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP + T+R     ILIYT LT    +   +       Y  +    G  F
Sbjct: 187 KDDYKAAGVPMLPAIATERQVTKQILIYTWLTVAATLALAL--ATGWLYAAVALVAGVWF 244

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL V+F  L VD +I +  +
Sbjct: 245 LAMAHQLYAGVRAGEPVKPLRLFLQSNNYLAVVFCALAVDSVIALPHL 292


>gi|297161449|gb|ADI11161.1| protoheme IX farnesyltransferase [Streptomyces bingchenggensis
           BCW-1]
          Length = 313

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 162/289 (56%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPRV+ L + T    + LA  G   +   + +     + AG + A NMYYD
Sbjct: 24  RVKAFVALTKPRVIELLLMTTVPVMFLAAKGVPDLWLVLATCVGGYLSAGGAAAFNMYYD 83

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +MART+ RP+  G +SP E  V   +L + S       +N +SA L   ++  YV
Sbjct: 84  RDIDALMARTSQRPLVTGMVSPRECLVFAFALTIGSTAWFWFLVNPLSAVLSLGALVFYV 143

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+WLKR T QNIV GGIAG +P  IGW++VT  VS A+ ++FL+IF WTPPH+W L+
Sbjct: 144 VVYTMWLKRRTAQNIVWGGIAGCMPVFIGWSAVTNSVSWAAAILFLVIFFWTPPHYWPLS 203

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY++  +PMLP V  ++     I++Y+ +  IV +L   LG+ S  Y ++   LG
Sbjct: 204 MKVKDDYERVGVPMLPVVAGNKAVARQIVLYSWVMVIVSLLLWPLGYTSWFYPVVAAALG 263

Query: 246 YHFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 264 AFWLKEAHGLQARAKAGITGSGLKEMRLFHWSITYVSLLFIAIAVDPFL 312


>gi|159043690|ref|YP_001532484.1| protoheme IX farnesyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157911450|gb|ABV92883.1| protoheme IX farnesyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 328

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 131/296 (44%), Positives = 183/296 (61%), Gaps = 4/296 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG+++AP  +  +    +I  IA+GAGASGALNM++DAD
Sbjct: 31  FGDYFALLKPRVMSLVVFTALVGLLVAPVSLHPMVGFCAILFIAVGAGASGALNMWWDAD 90

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP+P G++ P EA  LG+ L+  S+V++ LA N ++A LL  +IF Y V+
Sbjct: 91  IDVIMKRTAGRPVPAGKVQPGEALALGLGLSGLSVVMLALATNLLAAGLLAFTIFFYAVV 150

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TPQNIVIGG AGA PPMIGW + TG VS+ +++MF +IF+WTPPHFW+LAL 
Sbjct: 151 YSMWLKRSTPQNIVIGGAAGAFPPMIGWVAATGSVSLEAVLMFALIFMWTPPHFWALALF 210

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML      ++T+ HIL+YTVL   V +   +   A   Y      L   
Sbjct: 211 MKSDYHDAGVPMLTVTHGRKSTRTHILVYTVLLVPVALGLALTPVAGPLYLATALVLNAI 270

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERY 299
           F   AW  +       E       K+ F  S+ YL + FT L+ + ++    +  +
Sbjct: 271 FLKGAWDIWRRDEAQAEADKYATEKRFFKFSLLYLALHFTALLAEAILTRSGLWTF 326


>gi|296447869|ref|ZP_06889780.1| protoheme IX farnesyltransferase [Methylosinus trichosporium OB3b]
 gi|296254610|gb|EFH01726.1| protoheme IX farnesyltransferase [Methylosinus trichosporium OB3b]
          Length = 311

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 139/288 (48%), Positives = 200/288 (69%), Gaps = 1/288 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  LLKPRVMSL ++TA  G++LAP       +  S+ AIA+GAGASGALNM++DADID
Sbjct: 22  DYFALLKPRVMSLVVFTALAGLLLAPTPPHPFLAFASLLAIAVGAGASGALNMWFDADID 81

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RPIP G++S  EA   G+ L+V +++ +GL  NW++A LL  +IF YVV+YT
Sbjct: 82  ALMTRTRLRPIPAGRLSREEALAFGLVLSVLAVLTLGLVANWLAAALLAFTIFFYVVVYT 141

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TP NIVIGG AGA+PP++G+A+ TG V ++S+V+F IIF+WTPPHFW+LAL+ +
Sbjct: 142 MWLKRSTPMNIVIGGAAGALPPIVGFAAATGAVDLSSIVLFSIIFVWTPPHFWALALVKR 201

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           ++Y +A IPMLPNV  +  T++ IL Y++  + +GV P +LGFAS  YG     LG    
Sbjct: 202 EEYGRAGIPMLPNVAGEDRTRLEILAYSLALAPIGVAPYLLGFASPIYGAASLLLGAALV 261

Query: 250 LWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           + A + F  +  +   R   +LF  SI YLF+LF +L+++ L+ +  +
Sbjct: 262 VGAIQVFRLRSGEAARRAAMRLFFFSILYLFLLFMVLVIERLVHLSPL 309


>gi|221638232|ref|YP_002524494.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides KD131]
 gi|254765945|sp|B9KLZ5|COXX_RHOSK RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|221159013|gb|ACL99992.1| Protoheme IX farnesyltransferase [Rhodobacter sphaeroides KD131]
          Length = 310

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 130/288 (45%), Positives = 182/288 (63%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              ++ LLKPRVMSL ++TA VG+++AP  +  + ++  I  IA+GAGASGALNM++D D
Sbjct: 15  FGDYVALLKPRVMSLVVFTALVGLLVAPVTVHPMIALTGILFIALGAGASGALNMWWDED 74

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT +RP+P G ++P EA  +G++L+  ++V++GLA N  +A LL  +IF Y V+
Sbjct: 75  IDRVMKRTRNRPVPSGIVAPGEALGIGLALSGIAVVMLGLATNLFAAGLLAFTIFFYAVV 134

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TPQNIVIGG AGA PPMIGWA  TG VS+ SL MF +IF+WTPPHFWSLAL 
Sbjct: 135 YSMWLKRTTPQNIVIGGAAGAFPPMIGWAVATGGVSVESLFMFALIFMWTPPHFWSLALF 194

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML      R T+ H+L+Y++L + + V     G     Y      L   
Sbjct: 195 MKSDYSDAGVPMLTVTHGRRVTRAHVLVYSLLLAPLAVAGAFTGIGGPLYLATALALNGW 254

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             + A R +       E    RV K  F  S+ YLF+ F  ++ +  +
Sbjct: 255 LLVGAVRIWRRDEAQAEADRYRVEKGFFRFSLYYLFLHFGAILAEAAL 302


>gi|293602907|ref|ZP_06685346.1| protoheme IX farnesyltransferase [Achromobacter piechaudii ATCC
           43553]
 gi|292818701|gb|EFF77743.1| protoheme IX farnesyltransferase [Achromobacter piechaudii ATCC
           43553]
          Length = 297

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 109/287 (37%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++VL KPRV  LA++ A +G+ LA PG   + + +     I + A A+ A+N   + 
Sbjct: 12  LRQYLVLTKPRVTQLAVFCAVIGMFLAVPGVPDMRRVLFGTIGIWLLAAAAFAINCLIEQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  M RTA R    G IS ++   L   L    + ++   +N ++  L F +   Y V
Sbjct: 72  EVDARMLRTARRATARGTISAFQVLSLSGLLGGVGMFVLYTLVNPLTMWLTFATFVGYAV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + V+ LIIF+WTPPHFW+LAL
Sbjct: 132 IYTVILKPRTPQNIVIGGLSGAMPPALGWAAVADSVPAEAWVLVLIIFIWTPPHFWALAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA +PMLP    ++ T++HIL+Y+V      +LP  +  +   Y +    LG 
Sbjct: 192 YRNHDYAKAGLPMLPVTHGNQFTRLHILLYSVALVATTLLPYAIRMSGELYLLSALVLGG 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +AWR +    D+   + + +F  SI YL +LF  L+VDH + +
Sbjct: 252 MFVSYAWRLYRAYSDE---LARSMFRFSILYLALLFGALLVDHWVAL 295


>gi|260428067|ref|ZP_05782046.1| protoheme IX farnesyltransferase [Citreicella sp. SE45]
 gi|260422559|gb|EEX15810.1| protoheme IX farnesyltransferase [Citreicella sp. SE45]
          Length = 315

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 131/287 (45%), Positives = 178/287 (62%), Gaps = 4/287 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   +  LLKPRVM+L ++TA VG++ AP  +       +I  IA+G GASGALNM++DA
Sbjct: 19  QFGDYFALLKPRVMTLVVFTALVGLLAAPVPVHPFIGFCAILFIAVGGGASGALNMWWDA 78

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RTA RPIP G++ P EA  LG++L+  S V + LA N ++  LL  +IF YVV
Sbjct: 79  DIDLVMKRTAKRPIPAGRVEPGEALALGLALSAFSCVFLALATNVLAGGLLAFTIFFYVV 138

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR TPQNIVIGG AGA PPMIGWA+ TG V + +++MF + F+WTPPHFW+LAL
Sbjct: 139 IYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGSVGVEAVLMFCLTFMWTPPHFWALAL 198

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A +PML      R+T++HIL+YTVL + + +           Y  +   L  
Sbjct: 199 FMRSDYDDAGVPMLTVTHGRRSTRIHILVYTVLLAALAIGTGFTAIGGPVYLAVAVVLNL 258

Query: 247 HFTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDH 289
            F   AW  F       E  + R  K+ F  S+ YLF  F  ++V+ 
Sbjct: 259 LFLKGAWEIFRRDEVASEADNFRTEKRFFKLSLLYLFAHFGAILVEA 305


>gi|319785801|ref|YP_004145276.1| protoheme IX farnesyltransferase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464313|gb|ADV26045.1| protoheme IX farnesyltransferase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 298

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 121/291 (41%), Positives = 172/291 (59%), Gaps = 8/291 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV++L ++TA VG+ LA PG   + +SV+ +  I + + ++ A+N   D 
Sbjct: 8   WREYLELTKPRVVALLVFTALVGMFLAVPGLPPLRESVLGLVGIWLASSSAAAINHLIDQ 67

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            IDK+MARTA RP+  G + P +  V  ++L   S++++ L +N V+A L F S+  Y V
Sbjct: 68  RIDKVMARTAHRPLATGALRPVQVLVFALALGALSMLVLVLWVNTVTAVLTFASLIGYAV 127

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVM----FLIIFLWTPPHFW 182
           IYT +LKR TPQNIVIGG+AGA PP++GWA+VT               LIIF+WTPPHFW
Sbjct: 128 IYTGYLKRATPQNIVIGGVAGAAPPLLGWAAVTNMQGSWDWQHALLLVLIIFVWTPPHFW 187

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LA+  ++DY +A IPMLP       T+  IL YTVL   V VLP + G + + Y     
Sbjct: 188 ALAIFRREDYARALIPMLPVTHGVTYTRWQILFYTVLLVEVTVLPVLFGMSGLFYLGGAL 247

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            LG  F  +AWR     +  D     ++F  SI YL  LF  L+VDH + +
Sbjct: 248 VLGSVFLWYAWRLL---DPPDEFYAMRVFNYSIVYLMALFAFLLVDHWLPL 295


>gi|271967293|ref|YP_003341489.1| protoheme IX farnesyltransferase [Streptosporangium roseum DSM
           43021]
 gi|270510468|gb|ACZ88746.1| protoheme IX farnesyltransferase [Streptosporangium roseum DSM
           43021]
          Length = 317

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 154/288 (53%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    + LA  G   +  +V ++    + AG++ ALN Y D 
Sbjct: 29  VKAYVALTKPRIIELLLITTLPVMFLAARGLPPLWIAVSTLVFGTLSAGSANALNCYIDR 88

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+   Q+ P  A + GV L V S + +GL +NW++A L   +   YV+
Sbjct: 89  DIDAAMRRTRRRPLARDQVPPANALIFGVVLGVLSTLGLGLTVNWLAAGLSLAANLFYVL 148

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN+V GG+AG +P +IGWA +TG +  A LV+F ++F WTPPH W+LA+
Sbjct: 149 VYSMILKRRTSQNVVWGGLAGCMPVLIGWAGITGSLDWAPLVLFGVVFFWTPPHTWTLAM 208

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY  A +PMLP V T+R   +  + YT  T    +L   +   ++ Y  +   LG 
Sbjct: 209 RYKEDYAAAKVPMLPVVATERRVVLESIAYTWATVACSLLLWPIAGTTLLYPAVAVVLGA 268

Query: 247 HFTLWAWRTFLCKEDKD---IRVTKKLFLESITYLFVLFTILMVDHLI 291
                 +R                 + F  S  YL +LF  + VD ++
Sbjct: 269 ACLWEVYRLLGRVNAGKTGVDLRPMRFFHWSNAYLALLFLAVAVDSML 316


>gi|311898917|dbj|BAJ31325.1| putative protoheme IX farnesyltransferase [Kitasatospora setae
           KM-6054]
          Length = 314

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 104/290 (35%), Positives = 164/290 (56%), Gaps = 4/290 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + +    + LA G +  + + +  +    + AG + ALNMY D
Sbjct: 25  RVGAFVALTKPRIIELLLISTVPVMFLAQGGVPNLWRVLAVVVGGYLSAGGANALNMYID 84

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M+RT  RPI  G +SP EA V G++LAV S + +G+ +NW+S+ L   ++  YV
Sbjct: 85  RDIDAVMSRTERRPIVTGMVSPREALVFGITLAVVSTLWLGVLVNWLSSALALGALLFYV 144

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +YT+ LKR T QN+V GGIAG +P ++GW+SVT  +S A++V+FL++F WTPPH W L 
Sbjct: 145 FVYTLGLKRRTSQNVVWGGIAGCMPVLVGWSSVTNSLSWAAVVLFLVVFFWTPPHTWVLM 204

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  +DDY KA +PMLP +  +      ++ Y+ +     +L       S  Y  +   LG
Sbjct: 205 MKVRDDYAKAGVPMLPVIRGNIGVAKQVVAYSWVMVATSLLLWPAAHTSWLYPTVAAVLG 264

Query: 246 YHFTLWAWRTFLCKED---KDIRVTKKLFLESITYLFVLFTILMVDHLID 292
             +   A+      +           +LF  SITYL +LF ++ +D  + 
Sbjct: 265 ALWMKEAYALQSRAKAGIVGAKLKEMRLFHWSITYLTLLFLVVAIDPFVG 314


>gi|149375586|ref|ZP_01893355.1| protoheme IX farnesyltransferase [Marinobacter algicola DG893]
 gi|149359988|gb|EDM48443.1| protoheme IX farnesyltransferase [Marinobacter algicola DG893]
          Length = 307

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 121/287 (42%), Positives = 175/287 (60%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              F+ L KP V+++ I T+ +G++LA PG       +     IA+ AGA+  +N   D 
Sbjct: 24  WRDFLELTKPTVVAMMILTSVIGMLLATPGVPGWEVMLYGNLGIALLAGAAAVVNHVVDQ 83

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G+ISP +A +    LAV+ +VI+   +N ++A L   S+  Y  
Sbjct: 84  KIDTVMARTRKRPVATGKISPLDALLFATVLAVAGMVILVWQVNTLTAWLTLASLVGYAG 143

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA+PP++GW +VTG V   +L++ LIIF WTPPHFW+LA+
Sbjct: 144 VYTLFLKRMTPQNIVIGGLAGAMPPLLGWTAVTGQVEGHALLLVLIIFAWTPPHFWALAI 203

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    ++ T++HIL+YT++   V +LP + G + + Y      LG 
Sbjct: 204 HRKEEYAKAGIPMLPVTHGNKYTELHILLYTLMLLAVSLLPFVTGMSGIIYLAGALALGL 263

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +A R        D RV    F  SITYL  LF +L+VDH +  
Sbjct: 264 RFLQYAVRLL---RGDDRRVALNTFKYSITYLMALFVVLLVDHFVFF 307


>gi|146343475|ref|YP_001208523.1| protoheme IX farnesyltransferase [Bradyrhizobium sp. ORS278]
 gi|182639190|sp|A4Z2D2|COXX_BRASO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|146196281|emb|CAL80308.1| protoheme IX farnesyltransferase (heme O biosynthesis)
           [Bradyrhizobium sp. ORS278]
          Length = 312

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 133/284 (46%), Positives = 191/284 (67%), Gaps = 1/284 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL I+TA +G+++APGH   + ++ S+  IA+GAGASGALNM  + D
Sbjct: 20  VGDYIALLKPRVMSLVIFTALIGLLIAPGHFHPVLAITSLLCIAVGAGASGALNMALEGD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+++  EA   G++L+  S++ +G+ +NW +  LL  +IF YVVI
Sbjct: 80  IDSLMSRTANRPIPRGRVTRQEALAFGITLSFFSVLTLGILVNWFAGALLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ WA+VTG ++   + +FLIIF WTPPHFW+LAL 
Sbjct: 140 YTLWLKRWTAQNIVIGGAAGALPPVVAWAAVTGSIAPEPVWLFLIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG++   LG  
Sbjct: 200 RTDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDAVYGVVSLALGAG 259

Query: 248 FTLWAWRTFLCKED-KDIRVTKKLFLESITYLFVLFTILMVDHL 290
               A   F  ++    +R  +KLF  SI YLF LF  L ++ +
Sbjct: 260 MLWLAIEVFRKRDRIPSLRANRKLFGFSILYLFALFATLGLEAI 303


>gi|84501690|ref|ZP_00999862.1| protoheme IX farnesyltransferase [Oceanicola batsensis HTCC2597]
 gi|84390311|gb|EAQ02870.1| protoheme IX farnesyltransferase [Oceanicola batsensis HTCC2597]
          Length = 312

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 132/289 (45%), Positives = 185/289 (64%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   ++ LLKPRVMSL ++TA VG++ APG I    +  ++  IA+G GASGALNM+YDA
Sbjct: 16  QFGDYVALLKPRVMSLVVFTAAVGLLAAPGAIHPFVAFFAVLCIAIGGGASGALNMWYDA 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT+ RPIP G+++P EA  +G++L+  S++++GLA NW +A LL  +IF Y V
Sbjct: 76  DIDRVMKRTSRRPIPSGRVAPEEALAVGLTLSGFSVIMLGLATNWAAAALLAFTIFFYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR+TPQNIVIGG AGA PPMIGWA+VTG +S+ S++MF + FLWTPPHFW+LAL
Sbjct: 136 VYTMWLKRWTPQNIVIGGAAGAFPPMIGWAAVTGGISLESVLMFGLTFLWTPPHFWALAL 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY++A +PML      R T+ HI  YT   + + +           Y  +   +  
Sbjct: 196 FMKSDYEEAGVPMLTVTHGRRATRRHIFAYTFPLAALAIGTAFTSIGGPLYLAVAVLMNA 255

Query: 247 HFTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW      E        RV K+ F  S+ YLF+ F  L+ +  +
Sbjct: 256 LFVKGAWDILRRDEPLAEADAYRVEKRYFTFSLLYLFLHFGALLAEAAL 304


>gi|86137980|ref|ZP_01056556.1| protoheme IX farnesyltransferase [Roseobacter sp. MED193]
 gi|85825572|gb|EAQ45771.1| protoheme IX farnesyltransferase [Roseobacter sp. MED193]
          Length = 313

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 128/286 (44%), Positives = 181/286 (63%), Gaps = 4/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TAFVG++ AP  +  +    ++  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTAFVGLMAAPVGVHPVIGFCAVLFIAIGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT +RPIP G++   EA  LG++L+  S++++ LA N  +   L  +IF YVV+
Sbjct: 78  IDQVMKRTKARPIPAGKVEAGEALSLGLALSGLSVIMLALATNVFAGAFLAFTIFFYVVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +S+   +MF + F+WTPPHFW+LAL 
Sbjct: 138 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGTMSVEPWLMFALTFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R T++HIL+YTVL +I+ V     G     Y  +   +   
Sbjct: 198 MRSDYDDAGVPMLTVTHGRRATRVHILVYTVLLAILAVGTAFSGIGGPIYLAVASVMNGL 257

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDH 289
           F L AW+ F   ED     D +  +  F  S+ YLF+ F  ++V+ 
Sbjct: 258 FLLGAWKIFRRNEDDSEVDDFKAERSFFKLSLLYLFLHFGAILVEA 303


>gi|152966865|ref|YP_001362649.1| protoheme IX farnesyltransferase [Kineococcus radiotolerans
           SRS30216]
 gi|205693420|sp|A6WC46|COXX_KINRD RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|151361382|gb|ABS04385.1| protoheme IX farnesyltransferase [Kineococcus radiotolerans
           SRS30216]
          Length = 339

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 152/300 (50%), Gaps = 16/300 (5%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISV-LKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPR++ L + T    ++ A G +      + +    A+ AG +  LN Y+D DI
Sbjct: 36  AYVALTKPRIVELLLITTIPVMLFAAGGLPSGWLILTTFVGGALAAGCANTLNCYFDRDI 95

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT +RP+  G++SP +A V    L ++S  I    +N +SA L   +I  YVV Y
Sbjct: 96  DALMKRTENRPLVTGEVSPRQALVFATVLGIASTAIFVAFVNVLSAALALGAILLYVVGY 155

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QNIV GG+AG +  +IGW +V   +  A  V+F +IFLWTPPH+W L++  
Sbjct: 156 TLLLKRRTSQNIVWGGVAGCMQVLIGWTAVRDSLDWAPFVLFGVIFLWTPPHYWPLSVRY 215

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           ++DY  A +PMLP V    T    I++YT+   +  +L   LG A V YG     LG  F
Sbjct: 216 REDYANAGVPMLPVVAKPTTVSRQIVLYTIAMVLCSLLLVPLGGAGVVYGAAALVLGIGF 275

Query: 249 TLWAWRTFLCKEDKDIR---------------VTKKLFLESITYLFVLFTILMVDHLIDM 293
            +            ++                    +F  SITYL +L   + VD  + +
Sbjct: 276 LVQTIGLHRRATRFEVETGGRDAGTLEQLKRISPMGVFHGSITYLTLLSAAVAVDPFVRV 335


>gi|240171360|ref|ZP_04750019.1| protoheme IX farnesyltransferase [Mycobacterium kansasii ATCC
           12478]
          Length = 288

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 107/288 (37%), Positives = 158/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G +  L  + ++    M AG +  LN   DADI
Sbjct: 2   AYLALTKPRVIELLLVTAIPAMLLADRGSVHPLVILNTLIGGMMAAGGANTLNCVADADI 61

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A   G++L V S++ +    N +S  L   ++  YV +Y
Sbjct: 62  DKVMKRTARRPLARAAVPTRSALAFGLALTVVSVLWLWWTTNLLSGLLALATVAFYVFVY 121

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG ++  +L MF I+F WTPPH W+LA+  
Sbjct: 122 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTLAWPALAMFAIVFFWTPPHTWALAMRY 181

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           K+DYQ+A +PMLP V T+R     ILIYT LT +  +   +       Y  +    G  F
Sbjct: 182 KEDYQEAGVPMLPAVATERQVTRQILIYTWLTVLATLA--LTPATGWLYAAVAVVAGAWF 239

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A +        +     +LFL+S  YL ++F  L VD  + + T+
Sbjct: 240 LAMAHQLDAGVRAGEPVKPLRLFLQSNNYLALVFCALAVDSALGLPTL 287


>gi|67920186|ref|ZP_00513706.1| Protoheme IX farnesyltransferase [Crocosphaera watsonii WH 8501]
 gi|67857670|gb|EAM52909.1| Protoheme IX farnesyltransferase [Crocosphaera watsonii WH 8501]
          Length = 314

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 115/285 (40%), Positives = 163/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +   K  I++    + A ++  +N  YD 
Sbjct: 17  VRSYYQLTKPRIIPLLLITTAASMWMASKGEVDSFKLFITLLGGTLAAASAQVMNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++    A +  V L V S  +    IN +S  L    I  Y++
Sbjct: 77  DIDYEMLRTRTRPIPSGRVQSSHALIFAVVLGVMSFSLFLAYINLLSGLLAMSGIVFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG AG+IPP++GWA+VTGD+S A  ++F IIFLWTPPHFW+LAL
Sbjct: 137 VYTHFLKRNTPQNIVIGGAAGSIPPLVGWAAVTGDLSWAPWILFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLT-SIVGVLPTMLGFASVTYGIIVFFLG 245
           + KDDY + ++PM+P +  + +T   I  YT+L      +L   +G +   YG I   LG
Sbjct: 197 MIKDDYAQVNVPMMPVIEGEESTVRQIWWYTLLVIPCTLLLVYPVGASGWLYGAIAILLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F    W       DKD+   K LF  SI YL +L T ++VD L
Sbjct: 257 AIFIKKTWLLKQNPFDKDM--AKSLFKFSILYLMLLCTAMVVDSL 299


>gi|329890631|ref|ZP_08268974.1| protoheme IX farnesyltransferase [Brevundimonas diminuta ATCC
           11568]
 gi|328845932|gb|EGF95496.1| protoheme IX farnesyltransferase [Brevundimonas diminuta ATCC
           11568]
          Length = 325

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 120/300 (40%), Positives = 181/300 (60%), Gaps = 19/300 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVMSL ++TA  G+V+APG +S + +VI++  IA+GAGA+GALNM  + + D
Sbjct: 21  DFFQLLKPRVMSLVVFTAVTGLVVAPGQLSWVNAVIAVLCIAIGAGAAGALNMAVEGETD 80

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RP+  G++   +A   G+ L++ S++++G+  NW++  LL ++I  Y  +YT
Sbjct: 81  ALMRRTRGRPVAAGRVRKNDAIAFGMVLSIFSVMLLGMTTNWLAGGLLALTIVYYAWLYT 140

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           + LKR TPQNIVIGG AGA+PP+IGWA+VTGD    + ++FLIIF+WTPPH W+L L   
Sbjct: 141 LVLKRRTPQNIVIGGAAGALPPVIGWAAVTGDAPWQAWLLFLIIFMWTPPHTWALTLYSA 200

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY KA IPM+P     ++T++ I++Y++    V + P   G     Y ++    G  F 
Sbjct: 201 GDYAKAGIPMMPVARGAKSTRLQIMLYSLAFVPVAIAPAFTGLGGPIYLVVSVAGGLGFL 260

Query: 250 LWAWRTFLCKEDK-------------------DIRVTKKLFLESITYLFVLFTILMVDHL 290
             A+R +  +                      + +  + LF  SI YL  LF+ L+V+HL
Sbjct: 261 ALAFRLWRSRAGDQPDKAEAVGREAALYDVRAEAKPARNLFAFSILYLMALFSALLVEHL 320


>gi|91787151|ref|YP_548103.1| protoheme IX farnesyltransferase [Polaromonas sp. JS666]
 gi|123355956|sp|Q12E37|COXX_POLSJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|91696376|gb|ABE43205.1| protoheme IX farnesyltransferase [Polaromonas sp. JS666]
          Length = 304

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 108/290 (37%), Positives = 167/290 (57%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALN 61
            R   F  L KPRV+ L ++ A +G+VLA    P    V  ++I+   I + AGA+ A N
Sbjct: 17  SRFAQFYALTKPRVVQLIVFCALIGMVLAVPHVPTWPEVKLALIACAGIWLVAGAAAAFN 76

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S         +L  +  VI+ + +N ++  L F + 
Sbjct: 77  CIVEQRIDARMRRTAWRPTAKGELSNPLTLAFSAALCAAGSVILYVWVNPLTMWLTFATF 136

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y V+YT+ LK  TPQNIVIGG +GA+PP++GWA++TG V   +L++FLIIFLWTPPHF
Sbjct: 137 VGYAVVYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGTVGPEALILFLIIFLWTPPHF 196

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+K+ +PMLP    +  T++ + +YT++     ++P +   +   Y ++ 
Sbjct: 197 WALALYRVEDYRKSGLPMLPVTHGNEFTRLQVFLYTLVLFAACLMPFVFKMSGWLYLVVA 256

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             L   F+  AWR +    D    + +K F  S+ +L VLF  L++DH +
Sbjct: 257 VVLSVGFSWHAWRLWRSYSD---ALARKTFRFSLIHLSVLFAALLLDHYL 303


>gi|296137015|ref|YP_003644257.1| protoheme IX farnesyltransferase [Thiomonas intermedia K12]
 gi|294341192|emb|CAZ89593.1| putative protoheme IX farnesyltransferase, coxE [Thiomonas sp. 3As]
 gi|295797137|gb|ADG31927.1| protoheme IX farnesyltransferase [Thiomonas intermedia K12]
          Length = 302

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 110/289 (38%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDAD 67
           +    L KPRV+ L ++ A +G+ LA   +      +     I + A A+ A N   +  
Sbjct: 17  SQLYALTKPRVVQLIVFCAVIGMFLAEPTLPAWQPVLFGTLGIWLVASAAAAFNCLVEQK 76

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G++S          L  + + ++   +N ++  L F +   Y V+
Sbjct: 77  IDAVMRRTAWRPSANGELSAPVIITFSGVLCAAGMWLLYTQVNPLTMWLTFGTFVGYAVV 136

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI+LK  TPQNIVIGG +GA+PP++GWA+V+G+VS+ ++++FLIIFLWTPPHFW+LAL 
Sbjct: 137 YTIFLKPATPQNIVIGGASGAMPPVLGWAAVSGNVSVDAMLLFLIIFLWTPPHFWALALY 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K+ +PMLP       T+  IL+YT+L S V +LP +LG + + Y      L   
Sbjct: 197 RVEDYKKSGLPMLPVTHGSEFTRTQILLYTLLLSAVTLLPYVLGMSGLIYLASAVVLDGI 256

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           F  +AW     K +    +++K F  SI YL +LF  L+VDH +    V
Sbjct: 257 FIAYAWAL---KREYSDLLSRKTFRYSILYLSLLFAALLVDHYLHFHFV 302


>gi|116670645|ref|YP_831578.1| protoheme IX farnesyltransferase [Arthrobacter sp. FB24]
 gi|182637565|sp|A0JWQ8|COXX_ARTS2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|116610754|gb|ABK03478.1| protoheme IX farnesyltransferase [Arthrobacter sp. FB24]
          Length = 315

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 156/289 (53%), Gaps = 3/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   ++ L KPRV+ L + +    ++ A  G  S    + ++   A  AG++GA N Y D
Sbjct: 22  KAKAYLALTKPRVIELLLVSTLPTMIYAERGFPSFGLILATLVGGAFAAGSAGAFNCYID 81

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+M RT +RP+  G+++P EA V    L  ++I I+    N +SA L   +I  YV
Sbjct: 82  RDIDKLMHRTENRPLVTGEVTPREALVFSWLLGAAAIAILWFGANPLSAWLGLGAIVFYV 141

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LKR T QNIV GG AG  P +I WA+VT  V   ++V+F++IFLWTPPH+W L+
Sbjct: 142 VIYTMILKRRTAQNIVWGGAAGCFPVLIAWAAVTDTVEWPAIVLFMVIFLWTPPHYWPLS 201

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A++PML  +   +   + +++Y        +L    G A   Y +     G
Sbjct: 202 MRYGEDYRNANVPMLGAIAGAKVVSVQVVLYAWAMVACSLLLIPAGGAGWVYTVTAVVAG 261

Query: 246 YHFTLWAWRTFLCKEDKD--IRVTKKLFLESITYLFVLFTILMVDHLID 292
             F   +   +   +  D   +   K+F  SI+YL +LF  L VD  + 
Sbjct: 262 AWFLYESHALYNRAQGGDVSNKGAMKVFHGSISYLTLLFIALAVDPFVG 310


>gi|291440343|ref|ZP_06579733.1| cytochrome oxidase assembly factor [Streptomyces ghanaensis ATCC
           14672]
 gi|291343238|gb|EFE70194.1| cytochrome oxidase assembly factor [Streptomyces ghanaensis ATCC
           14672]
          Length = 305

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D
Sbjct: 16  RVMAFVALTKPRIIELLLITTVPVMFLAQQGVPDLKLVLLTCVGGYLSAGGANALNMYID 75

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G++LAV S ++ GL +NW+SA L   ++  YV
Sbjct: 76  RDIDALMDRTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGLTVNWLSAWLALGALLFYV 135

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW+SVT  +S A LV+F++IF WTPPH+W L+
Sbjct: 136 VVYTMILKRRTAQNIVWGGIAGCMPVLIGWSSVTNSLSWAPLVLFMVIFFWTPPHYWPLS 195

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP +  ++     I+IY+ +   V +L T LG+    Y  +    G
Sbjct: 196 MKVKDDYARVGVPMLPVIAGNKAVAKQIVIYSWVMVGVSLLLTPLGYTGWFYTAVALAAG 255

Query: 246 YHFTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 256 GWWLWEAHALLNRAKAEVTGAKLKEMRLFHWSITYVSLLFVAIAVDPFL 304


>gi|289739955|gb|ADD18725.1| heme A farnesyltransferase [Glossina morsitans morsitans]
          Length = 421

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 71/280 (25%), Positives = 138/280 (49%), Gaps = 5/280 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L  +  L K R+ SL + T   G  +AP    +   ++      + + A+ A+N Y++  
Sbjct: 87  LGHYKKLSKFRLTSLVVITTMAGYAMAPAPFELSTFIMCSLGTGLVSAAANAINQYHEVP 146

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  G+++P  +    V+ A   I ++   +N ++A L   ++F Y  I
Sbjct: 147 FDSQMSRTKNRVLVTGKLTPLHSIGFAVTSAACGIGLLHFGVNDLAALLSAANLFLYTSI 206

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR T  N  +G + GAIPP+IGWA  +G + I + ++  +++ W  PHF +L+  
Sbjct: 207 YTP-MKRMTILNTWVGSVVGAIPPLIGWAGCSGSLDIGAYILCGLLYAWQFPHFNALSWN 265

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+     D   +   L YT    ++  +  +    ++ + +    L  +
Sbjct: 266 LRPDYSRAGYRMMAVTNPD-LCRRTALRYTFAIGLLSFMAPVFDITNIWFALGSLPLNGY 324

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
           F   A++ +   +  D   ++KLF  S+ +L +L  + ++
Sbjct: 325 FCYLAYKFY---QHSDSGSSRKLFRYSLIHLPLLMAMFLL 361


>gi|126729112|ref|ZP_01744926.1| protoheme IX farnesyltransferase [Sagittula stellata E-37]
 gi|126710102|gb|EBA09154.1| protoheme IX farnesyltransferase [Sagittula stellata E-37]
          Length = 319

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 134/287 (46%), Positives = 184/287 (64%), Gaps = 4/287 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   +  LLKPRVM+L ++TAFVG++ AP  I       ++  IA+G GASGALNM+YD+
Sbjct: 24  QFGDYFALLKPRVMTLVVFTAFVGLLAAPVAIHPFLGFCAVLFIAIGGGASGALNMWYDS 83

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RTA RPIP G+++  EA  +G++L+V ++V +GLA NW++A+LL  +IF YVV
Sbjct: 84  DIDALMKRTAKRPIPSGKVTRDEALAIGLTLSVFAVVFLGLATNWLAASLLAFTIFFYVV 143

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR TPQNIVIGG AGA PPMIGWA+ TG++S AS++MF + FLWTPPHFW+LAL
Sbjct: 144 IYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGEISTASVLMFCLTFLWTPPHFWALAL 203

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A++PML      ++T+ HIL+YTVL +   +           Y      L  
Sbjct: 204 FVRMDYDNATVPMLTVTHGRKSTRTHILVYTVLLAAFAIGLGFTQVGGPVYLATALVLNA 263

Query: 247 HFTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDH 289
            F   AW  +       E  + +  K  F  S+ YLF  F  ++VD 
Sbjct: 264 LFLKGAWTIWRRDEAASEADNFKAEKAFFKLSLLYLFAHFGAILVDA 310


>gi|75674959|ref|YP_317380.1| protoheme IX farnesyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|74419829|gb|ABA04028.1| protoheme IX farnesyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 353

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 128/271 (47%), Positives = 177/271 (65%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVMSL I+TA VG+++APGHI  +   I+I  IA+GAGASGALNM  + D
Sbjct: 61  VADYFALLKPRVMSLVIFTALVGLMIAPGHIHPVLGFIAILCIAVGAGASGALNMALEGD 120

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G++L+  S++ +G  +NW +  LL  +IF YVVI
Sbjct: 121 IDVLMSRTANRPIPRGRITRGEAMGFGLTLSFFSVMTLGALVNWYAGGLLAFTIFFYVVI 180

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIVIGG AGA+PP++ WA+ TG +S+  L++FLIIF WTPPHFW+LAL 
Sbjct: 181 YTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSVEPLLLFLIIFFWTPPHFWALALF 240

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG+    LG  
Sbjct: 241 RSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWVYGVTSLILGAG 300

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITY 277
             + A   +  +         ++LF  SI Y
Sbjct: 301 MLVLAIEVYRHRTGSQALRATRRLFAFSILY 331


>gi|146276667|ref|YP_001166826.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides ATCC
           17025]
 gi|182639224|sp|A4WQ57|COXX_RHOS5 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|145554908|gb|ABP69521.1| protoheme IX farnesyltransferase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 310

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 131/288 (45%), Positives = 179/288 (62%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG+++AP  +  + ++  I  IA+GAGASGALNM++DAD
Sbjct: 15  FGDYFALLKPRVMSLVVFTALVGLLVAPATVHPMIALTGILFIALGAGASGALNMWWDAD 74

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT +RP+P G + P EA  LG++L+  ++V++GLA N  +A LL  +IF Y V+
Sbjct: 75  IDRVMKRTRNRPVPAGVVQPGEALGLGLALSGIAVVMLGLATNLFAAGLLAFTIFFYAVV 134

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TPQNIVIGG AGA PPMIGWA  TG VS+ SL MF +IF+WTPPHFWSLAL 
Sbjct: 135 YSMWLKRTTPQNIVIGGAAGAFPPMIGWAVATGGVSLESLFMFALIFMWTPPHFWSLALF 194

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML      R T+ H+L Y +L + + V     G     Y ++   L   
Sbjct: 195 MKTDYSDAGVPMLTVTHGRRVTRGHVLAYALLLAPLAVAGAFTGIGGPLYLVVALALNGW 254

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
               A R +       E    R  K  F  S+ YLF+ F  ++ +  +
Sbjct: 255 LLRGAVRIWRRDEAEAEADRYRTEKGFFRFSLYYLFLHFGAILAEAAL 302


>gi|74316353|ref|YP_314093.1| protoheme IX farnesyltransferase [Thiobacillus denitrificans ATCC
           25259]
 gi|123612360|sp|Q3SLW5|COXX_THIDA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|74055848|gb|AAZ96288.1| protoheme IX farnesyltransferase [Thiobacillus denitrificans ATCC
           25259]
          Length = 298

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 109/289 (37%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   F+ L K RV+SL ++TA +G+ LA P   S          I + A A+ A N   +
Sbjct: 12  RCQQFLALCKLRVVSLIVFTAVIGMFLAVPAWPSWTTIWAGTLGIGLVASAAAAFNCLIE 71

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART +RP+P G+++  +  V    L  S ++++   +N ++  L   +   Y 
Sbjct: 72  QKIDAVMARTRARPLPRGELTGTQTLVFAGVLGGSGLLLLHTVVNPLTMWLTLATFVGYA 131

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LK  TPQNIVIGG +GA+PP++GWA+ TG++   +L++FLIIF WTPPHFW+LA
Sbjct: 132 VIYTVLLKPATPQNIVIGGASGAMPPVLGWAAATGEIHHDALLLFLIIFAWTPPHFWALA 191

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  +++Y +A +PMLP    +  T++H+L+YT+L   V +LP   G A   Y +    LG
Sbjct: 192 LYRREEYARAGLPMLPVTHGEAYTRLHVLLYTLLLLAVSLLPVGTGMAGALYLVGAVLLG 251

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
             F  + W       D    + ++ F  SI YL  LF I+++DH   + 
Sbjct: 252 ARFIQYGWALHREYSD---ALARRTFRYSIWYLAALFAIMLLDHYFPIP 297


>gi|85705129|ref|ZP_01036229.1| protoheme IX farnesyltransferase [Roseovarius sp. 217]
 gi|85670451|gb|EAQ25312.1| protoheme IX farnesyltransferase [Roseovarius sp. 217]
          Length = 318

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 133/288 (46%), Positives = 185/288 (64%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  LLKPRVM+L ++TA VG++ AP  +  +    +I  IA+G GASGALNM++++D
Sbjct: 22  FGDFFALLKPRVMTLVVFTALVGLLAAPVGVHPVIGFAAILFIAVGGGASGALNMWWESD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP G+++  EA+  G++LAV S+V++ LA N ++A +L  +IF YVVI
Sbjct: 82  IDALMKRTQKRPIPAGKVTRDEAFAFGITLAVMSVVMLWLATNALAAGILAFTIFFYVVI 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LKR+TPQNIVIGG AGA PPMIGWA+ TG VS+ S++MF +IF+WTPPHFW+LAL 
Sbjct: 142 YTIGLKRWTPQNIVIGGAAGAFPPMIGWAAATGTVSLESVLMFALIFMWTPPHFWALALF 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY KA +PML      R T++HIL+YTVL + + +     G     Y  +       
Sbjct: 202 MRGDYDKAGVPMLTVTHGRRATRVHILVYTVLLAALAIGAAFTGIGGPVYLAVAVIFNAL 261

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   A   +   ED     + RV K+ F  S+ YLF  FT ++ +  +
Sbjct: 262 FLRDAIAIWRRDEDQAEADNYRVEKRAFRLSLWYLFAHFTAILAEAAL 309


>gi|304570539|ref|YP_265560.2| cytochrome c oxidase assembly factor [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|182639252|sp|Q4FPD2|COXX_PELUB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 303

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 123/289 (42%), Positives = 190/289 (65%), Gaps = 1/289 (0%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMY 63
            VF  +    L+KPRVMSL I+T  VG+++AP  +S   ++I+I  +++GAGA+GALNM+
Sbjct: 15  NVFNFSELFKLMKPRVMSLVIFTCAVGLLMAPSTVSTKDAMIAILLVSIGAGAAGALNMW 74

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
           Y++D+D +M RT  RPIP+G+++  +A + G SL+  S++ +    N +SA LL  +I  
Sbjct: 75  YESDLDALMTRTCLRPIPMGKVNKNQALIFGTSLSFFSVIALDYFANTISAVLLLFTILF 134

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YTIWLKR TPQNIVIGG AGA+PP+IGW   T  +S+  +  FLIIF WTP HFW+
Sbjct: 135 YVFVYTIWLKRKTPQNIVIGGAAGALPPVIGWTIATNSLSLEPITFFLIIFFWTPSHFWA 194

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           L+L   DDY+KA IPMLP      +TK++IL+Y++L   + +LP  + F  + + +    
Sbjct: 195 LSLYKSDDYKKAKIPMLPLTNGIESTKINILVYSLLMLPMVILPYAIDFVGLVFLVPALM 254

Query: 244 LGYHFTLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L  ++ +  +  +  K +K + +  K +F  SI YLF++F I ++D ++
Sbjct: 255 LTLYYNILCFELYKFKINKFNPKKAKTIFGYSILYLFLIFVIFLIDKIL 303


>gi|148252413|ref|YP_001236998.1| protoheme IX farnesyltransferase [Bradyrhizobium sp. BTAi1]
 gi|182639189|sp|A5EA98|COXX_BRASB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|146404586|gb|ABQ33092.1| protoheme IX farnesyltransferase (heme O biosynthesis)
           [Bradyrhizobium sp. BTAi1]
          Length = 312

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 132/284 (46%), Positives = 191/284 (67%), Gaps = 1/284 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ LLKPRVMSL I+TA +G+++APGH   + ++ S+  IA+GAGASGALNM  + D
Sbjct: 20  VGDYLALLKPRVMSLVIFTALIGLLIAPGHFHPVLAITSLLCIAVGAGASGALNMALEGD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+++  EA   G++L+  S++ +G+ +NW +  LL  +IF YVVI
Sbjct: 80  IDSLMSRTANRPIPRGRVTRQEALAFGITLSFFSVLTLGILVNWYAGALLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ W + TG ++   L++FLIIF WTPPHFW+LAL 
Sbjct: 140 YTLWLKRWTAQNIVIGGAAGALPPVVAWVAATGSIAPEPLLLFLIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT+L   +   P  LG+    YG++   LG  
Sbjct: 200 RSDDYARAGVPMLPVVAGPDATRLQILLYTILLVAIAAAPWPLGYFDAVYGVVSLALGAG 259

Query: 248 FTLWAWRTFLCK-EDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
              +A   F  +   + +R  +KLF  SI YLF LF  L ++ +
Sbjct: 260 MLWFAIEVFRKRERSQSLRANRKLFAFSILYLFALFATLGLEAV 303


>gi|220920308|ref|YP_002495609.1| protoheme IX farnesyltransferase [Methylobacterium nodulans ORS
           2060]
 gi|254765942|sp|B8I9Q3|COXX_METNO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|219944914|gb|ACL55306.1| protoheme IX farnesyltransferase [Methylobacterium nodulans ORS
           2060]
          Length = 317

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 132/269 (49%), Positives = 183/269 (68%), Gaps = 1/269 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  F  LLKPRVM+L ++TA VG+ ++P H++ +   +S+  IA+GAGASG LNM++DAD
Sbjct: 22  VADFFALLKPRVMALVVFTALVGMTVSPSHVNPVIGAVSLLMIAVGAGASGCLNMWWDAD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT SRPIP G+I P EA   G+ LAV S++++GLA NW++A LL  +I  Y VI
Sbjct: 82  IDAVMTRTRSRPIPAGRIRPEEALTFGLVLAVGSVLMLGLAANWLAAGLLAFTIVFYTVI 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR T QNIVIGG AGA+PPMIG A VTG V I  +++FLIIF+WTPPHFW+LAL+
Sbjct: 142 YSMWLKRATAQNIVIGGAAGALPPMIGQAVVTGSVGIEGIILFLIIFIWTPPHFWALALV 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY KA IPM+PNV    +T+  I+ YT+L + +G+ P  LGF  + YG++    G  
Sbjct: 202 KSADYAKAGIPMMPNVAGPDSTRRQIVGYTLLLAPLGLAPVALGFGGLIYGLVALLGGLA 261

Query: 248 FTLWAWRTFLCKEDKDI-RVTKKLFLESI 275
             + + +    +E +   +    LF  SI
Sbjct: 262 MLVLSLQVHRRREGESADKAAMSLFGFSI 290


>gi|260824085|ref|XP_002606998.1| hypothetical protein BRAFLDRAFT_117595 [Branchiostoma floridae]
 gi|229292344|gb|EEN63008.1| hypothetical protein BRAFLDRAFT_117595 [Branchiostoma floridae]
          Length = 410

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 66/277 (23%), Positives = 132/277 (47%), Gaps = 5/277 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           ++ L K R+  L + +A  G  +APG       ++++    + + A+  +N  ++   D 
Sbjct: 104 YMKLSKIRLTGLVVISAMGGYYMAPGSHDFFTFLLAMTGTGLTSCAANTINQVFEVPFDS 163

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
            M RT +R +  G +SP  A         +  +++   IN ++A L   ++  Y ++YT 
Sbjct: 164 QMDRTRNRVLVRGLLSPLHAVGFATVAGSTGALLLYNWINPLTAALGVGNLALYTLLYTP 223

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            +KR +  N  +G + GAIPP++GWA+ TG +   + V+  I++ W  PHF +L+   + 
Sbjct: 224 -MKRMSIANTWVGSVVGAIPPLMGWAACTGQLEAGAWVLAGILYSWQFPHFNALSWRLRP 282

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +A   M+     D   +   L + +L + +  L       +  +      L  +F+ 
Sbjct: 283 DYSRAGYCMMSVTNPD-LCRRVALRHCLLITTICSLAPFTNLTTWAFAFNSLPLNIYFSY 341

Query: 251 WAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
             W+ +   ED + +  ++LF+ S+ +L  L   + +
Sbjct: 342 LGWKFY---EDANNQSARRLFMASLWHLPTLLLCMFI 375


>gi|54307395|ref|YP_128415.1| protoheme IX farnesyltransferase [Photobacterium profundum SS9]
 gi|46911815|emb|CAG18613.1| hypothetical protoheme IX farnesyltransferase [Photobacterium
           profundum SS9]
          Length = 343

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 161/285 (56%), Gaps = 5/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ + KP+V+++ + TA VG+ LA PG       ++ +  I   + A+ A N   D 
Sbjct: 58  WRDYLTMTKPKVVAMLLLTALVGMCLAVPGIPPAKAVILGLIGIGFQSAAAAAFNHVLDR 117

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            +D  MART +RP+  G+I  W+A V   +L V   VI+      ++A L   S+  Y V
Sbjct: 118 RLDTQMARTYNRPLAKGRIETWKAVVFASTLMVMGFVILLELNA-LTAWLTMASLVGYAV 176

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLK  TPQNIVIGGIAGA PP++GW +VTG +   +L++ +++F WTPPHFW+LA+
Sbjct: 177 VYTVWLKHATPQNIVIGGIAGAAPPLLGWTAVTGQLDPHALLLVMLVFTWTPPHFWALAI 236

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY KA IPMLP       TK  +L+YTV+  IVG+LP + G +   Y +    L  
Sbjct: 237 HRRDDYAKAGIPMLPVTHGIEFTKTMVLLYTVMLFIVGLLPWLTGMSGGVYLVGSSLLNL 296

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A +    K           F  SI +L  LF +L+ DH I
Sbjct: 297 GFIGYALKL---KFADSKGHAWATFKYSIWHLLALFVVLLGDHWI 338


>gi|299068070|emb|CBJ39284.1| protoheme IX farnesyltransferase [Ralstonia solanacearum CMR15]
          Length = 310

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 107/286 (37%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGAVGIWLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  +  + L  + +  + +  N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGTRQILLFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YTV+     +LP + G +   Y  +   LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKFTLLHILLYTVIMVAATILPFVHGMSGYLYLAVALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AWR +    D    + +K F  SI YL +LF  L++DH    
Sbjct: 261 FLAHAWRMYRNYSD---ALAQKTFRYSIVYLSLLFAALLIDHYFKF 303


>gi|37521735|ref|NP_925112.1| protoheme IX farnesyltransferase [Gloeobacter violaceus PCC 7421]
 gi|81709782|sp|Q7NIL7|COXX_GLOVI RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|35212733|dbj|BAC90107.1| cytochrome c oxidase folding protein [Gloeobacter violaceus PCC
           7421]
          Length = 305

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 115/284 (40%), Positives = 166/284 (58%), Gaps = 3/284 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           LN +  L KPR+  L + T    + +A  GH+  L  ++++    + A ++ A N   D 
Sbjct: 20  LNDYYQLTKPRIQVLLLITTAGAMWIAGKGHVEPLLLLVTLLGGTLAASSANAFNCLIDR 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  R IP G+I PW+A +   +L V+S  ++    N  +A L    I  YVV
Sbjct: 80  DIDLLMERTRRRAIPAGRILPWQAALFATALGVASFAVLAAFANLFAALLAISGIGFYVV 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR T QNIVIGG AGAIPP++GWA+VTGD+  ++ V+F IIF+WTPPHFW+LA+
Sbjct: 140 IYTLWLKRTTTQNIVIGGAAGAIPPLVGWAAVTGDLGWSAWVLFGIIFMWTPPHFWALAM 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + ++DY+KA +PMLP V  D  T   I IYT++   V ++   LG     Y +    LG 
Sbjct: 200 MIREDYRKAGVPMLPVVAGDEATARQIFIYTLVLVPVTLVLYPLGTMGWIYLLAAGALGL 259

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
                A+R        D + ++ LF  SI YL +LF  + +D +
Sbjct: 260 WLIEGAFRLLKA--PNDRKESRSLFKRSIFYLMLLFVAMGIDSI 301


>gi|16330773|ref|NP_441501.1| protoheme IX farnesyltransferase [Synechocystis sp. PCC 6803]
 gi|81704003|sp|Q79EF2|COXX_SYNY3 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|1237022|dbj|BAA03062.1| heme O synthase [Synechocystis sp. PCC 6803]
 gi|1653266|dbj|BAA18181.1| cytochrome c oxidase folding protein [Synechocystis sp. PCC 6803]
          Length = 316

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 163/284 (57%), Gaps = 4/284 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPR++ L + T    + +A  G + + K +I++    + A ++  LN  YD D
Sbjct: 19  KSYYQLTKPRIIPLLLITTAASMWIASEGRVDLPKLLITLLGGTLAAASAQTLNCIYDQD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RT +RPIP G++ P  A +  ++L V S  ++   +N +S  L    I  Y+++
Sbjct: 79  IDYEMLRTRARPIPAGKVQPRHALIFALALGVLSFALLATFVNVLSGCLALSGIVFYMLV 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT WLKR T QNIVIGG AG+IPP++GWA+VTGD+S    V+F +IFLWTPPHFW+LAL+
Sbjct: 139 YTHWLKRHTAQNIVIGGAAGSIPPLVGWAAVTGDLSWTPWVLFALIFLWTPPHFWALALM 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLGY 246
            KDDY + ++PMLP +  +  T   I  Y++L     +L         + Y  I   LG 
Sbjct: 199 IKDDYAQVNVPMLPVIAGEEKTVSQIWYYSLLVVPFSLLLVYPLHQLGILYLAIAIILGG 258

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
            F + AW+      D+D  + + LF  SI YL +L   +++D L
Sbjct: 259 QFLVKAWQLKQAPGDRD--LARGLFKFSIFYLMLLCLAMVIDSL 300


>gi|296284254|ref|ZP_06862252.1| protoheme IX farnesyltransferase [Citromicrobium bathyomarinum
           JL354]
          Length = 316

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 122/290 (42%), Positives = 177/290 (61%), Gaps = 2/290 (0%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMY 63
                  F+ L KP V+ L ++T   G++ APGHI+ +    +I  IA+ AG + A N +
Sbjct: 16  MSSHWRDFLALTKPGVVRLVVFTGLCGLLAAPGHINPVLGFTAILCIALAAGGAAAFNQW 75

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
           Y++++D  M RTA RPIP G++S  +A      L  +S+++MGLAI W++A +L +SIF 
Sbjct: 76  YESELDARMKRTAKRPIPAGRVSRNDARDFASVLCGASVLVMGLAIGWLAAAILAVSIFY 135

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YVV+YT+WLK  TPQNIVIGG AGA PP+IGW +VTGD+++  +++F IIF WTPPHFW+
Sbjct: 136 YVVVYTMWLKPRTPQNIVIGGGAGAFPPLIGWVAVTGDITLTPVLLFAIIFFWTPPHFWA 195

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K DY +A +PM+P V  +  T+  IL Y +    +   P  LG A V YG     
Sbjct: 196 LAMFVKSDYAQAGVPMMPVVHGEAATRHQILAYALFMVPLAAAPWYLGTAGVVYGAASLA 255

Query: 244 LGYHFTLWAWR--TFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F   A         +   ++  K+LF  SI YLF LF +L++D ++
Sbjct: 256 LTGFFAALAVPVGLRRSVDGDTMKPEKRLFAYSILYLFALFGVLVIDRVL 305


>gi|149925639|ref|ZP_01913903.1| protoheme IX farnesyltransferase [Limnobacter sp. MED105]
 gi|149825756|gb|EDM84964.1| protoheme IX farnesyltransferase [Limnobacter sp. MED105]
          Length = 300

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 102/286 (35%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV++L ++ A +G+ LA P   +    +     I + AGA+ A N   +  
Sbjct: 18  KQYWTLTKPRVVALIVFCAVIGMFLATPSLPNAQVLIAGTLGIWLVAGAAAAFNCLVEQQ 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART +RP+P G+++  +  V    +    + I+ + +N ++  L   +   Y +I
Sbjct: 78  IDAKMARTRARPLPRGELNSVQTLVFSSMVGGVGVWILYVFVNPLTMWLTLATFVGYAII 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG +GA+PP++GWA+VT  VS  +LV+FLIIF+WTPPHFW+LAL 
Sbjct: 138 YTLLLKPNTPQNIVIGGASGAMPPVLGWAAVTNSVSAEALVLFLIIFVWTPPHFWALALY 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              +Y +A +PMLP       T+ H+ +YT++ +   ++P  +  + + Y +    L   
Sbjct: 198 RTQEYARAGLPMLPVTHGAAFTQFHVFLYTIMLAATTLIPFAMKMSGLIYLVSAVVLNAI 257

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  + ++ +    D    + KK F  SI YL  LF  L+VDH + +
Sbjct: 258 FIGYGYKIWKNYSD---ALAKKAFTYSIAYLAFLFAALLVDHYVTV 300


>gi|148654405|ref|YP_001274610.1| protoheme IX farnesyltransferase [Roseiflexus sp. RS-1]
 gi|182639229|sp|A5UPV7|COXX_ROSS1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|148566515|gb|ABQ88660.1| protoheme IX farnesyltransferase [Roseiflexus sp. RS-1]
          Length = 534

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 113/285 (39%), Positives = 163/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           L  +I L KP V+SL I T    + + P  I  +   + +     + A  S ++N Y D 
Sbjct: 251 LKDYISLTKPGVISLLILTTITSMYITPAGIPELSLVLWTTLGGWLMASGSHSINCYLDK 310

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RPIP G+I  W A  LG++L V + VI+ L +N ++A L       YV 
Sbjct: 311 DIDVNMGRTGRRPIPSGRIPAWHALALGIALGVVAFVILALFVNLLAAILALAGFLYYVF 370

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYTIWLKR +  NIVIGG AGA PP++GWA+VTG ++  +L+++LI+F WTPPHFW+LAL
Sbjct: 371 IYTIWLKRTSKHNIVIGGGAGAFPPLVGWAAVTGSLAPEALLLWLIVFFWTPPHFWALAL 430

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + + DY +A +PMLP V  D+ T+  I+IYT+    +  LP +LG     Y +     G 
Sbjct: 431 IRQKDYARAGVPMLPVVEGDQETRRQIVIYTLSMLALTALPPVLGMLGWAYLMSAAVSGG 490

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A +    + D        L+  S+ YL +LF  + VD ++
Sbjct: 491 LFLHYALKL---RRDGTTTTAWALYKYSLLYLAILFVAMAVDRVV 532


>gi|182639248|sp|Q1LRS0|COXX_RALME RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 305

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 107/286 (37%), Positives = 163/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 19  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWSVLIGGAAGIWLLAGAAFAINCLVEQK 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  +    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 79  IDALMRRTAWRPSATGEITTTQTLIFSAVLGGAGMWLLHVFANDLTMWLTFATFLGYAVV 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GW++V+G V   +  + LIIF WTPPHFW+LAL 
Sbjct: 139 YTILLKPATPQNIVIGGLSGAMPPALGWSAVSGTVPAEAWFLVLIIFTWTPPHFWALALY 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    +R T +HIL+YT++     +LP + G +   Y +    LG  
Sbjct: 199 RRADYAKSGLPMLPITHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLVAALGLGLV 258

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AW+ +    D    + ++ F  SI YL +LF +L+VDH    
Sbjct: 259 FLGYAWKLYRNYSDG---LAQRTFRYSILYLSLLFAVLLVDHYFKF 301


>gi|311103446|ref|YP_003976299.1| protoheme IX farnesyltransferase [Achromobacter xylosoxidans A8]
 gi|310758135|gb|ADP13584.1| protoheme IX farnesyltransferase [Achromobacter xylosoxidans A8]
          Length = 297

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 106/287 (36%), Positives = 163/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              + VL KPRV  LA++ A +G+ LA PG   + + +     I + A A+ A+N   + 
Sbjct: 12  FRQYFVLTKPRVTQLAVFCAVIGMFLAAPGIPDMRRVLFGTLGIWLLAAAAFAINCLIEQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  M RTA R    G IS ++   +   L  + + ++   +N ++  L F +   Y V
Sbjct: 72  EIDARMLRTARRGTARGTISSFQVLSMSGLLGGAGMFVLYHMVNPLTMWLTFATFVGYAV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF+WTPPHFW+LAL
Sbjct: 132 IYTVILKPRTPQNIVIGGLSGAMPPALGWATVADSVPAEAWILVLIIFIWTPPHFWALAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY K+ +PMLP    ++ T++HIL+Y+V      +LP  +  +   Y +    LG 
Sbjct: 192 YRNHDYAKSGLPMLPVTHGNQFTRLHILLYSVALVATTLLPYAIRMSGELYLLSALVLGG 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +AWR +    D+   + + +F  SI YL +LF  L+VDH + +
Sbjct: 252 MFVSYAWRLYRAYSDE---LARSMFRFSILYLALLFGALLVDHWVGL 295


>gi|332670383|ref|YP_004453391.1| protoheme IX farnesyltransferase [Cellulomonas fimi ATCC 484]
 gi|332339421|gb|AEE46004.1| protoheme IX farnesyltransferase [Cellulomonas fimi ATCC 484]
          Length = 299

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 107/289 (37%), Positives = 155/289 (53%), Gaps = 3/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVI-SIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L + T    ++LA G    L  V+ ++   A  AG++  LN Y D 
Sbjct: 11  VGAYVALTKPRVIELLLVTTLPTMILAQGGFPSLGLVLATLVGGAAAAGSANVLNCYIDR 70

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP   G+ISP  A + G++L V S+  + L +N  SA L   +I  YVV
Sbjct: 71  DIDRVMNRTKRRPTATGEISPRAALLFGLTLGVVSLTWLWLVVNPASAWLTAGAILIYVV 130

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT+ LKR TPQNIV GG AG +P +IGW++VTG VS   LV+F +IF WTPPH+W L++
Sbjct: 131 GYTMILKRRTPQNIVWGGAAGCMPVLIGWSAVTGGVSWTPLVLFGVIFFWTPPHYWPLSM 190

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A +PMLP V  D      ++ YT+      +L   +   +  Y ++   LG 
Sbjct: 191 KFRKDYAAAGVPMLPVVAKDAKVAREMIAYTLAMIACTLLLVPVAGMTWVYAVVATALGA 250

Query: 247 HFTLWAWRTFLCKED--KDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F            D  +       +F  SITYL +L   + VD  + +
Sbjct: 251 WFLWSCVTLLRRANDPARGRLRAMTVFHGSITYLTLLSVAIAVDVFLPL 299


>gi|150865531|ref|XP_001384788.2| Heme A farnesyltransferase [Scheffersomyces stipitis CBS 6054]
 gi|149386787|gb|ABN66759.2| Heme A farnesyltransferase [Scheffersomyces stipitis CBS 6054]
          Length = 452

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/309 (22%), Positives = 129/309 (41%), Gaps = 19/309 (6%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
            R+N +I L KP +  L   ++     ++P  +S+ +        A+ +GA+ A+NM  +
Sbjct: 136 SRINPYIKLTKPNLTVLVTLSSICSYAISPYSVSLGELAFLTIGTALCSGAANAINMGRE 195

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            + DK M RT  RP+  G +SP +A+    +       ++ + +N   A L F ++  Y 
Sbjct: 196 PEFDKKMPRTVGRPVVRGLVSPTQAYTFAAATGTIGCSMLWIGVNPTVAILGFTNLVLYA 255

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            IYT   KR +  N  +G I GAIPP++GWA+ +      +  +  +++ W  PHF +L+
Sbjct: 256 WIYTSL-KRRSIINTWVGAIVGAIPPLMGWAASSPLSHPGAWCLAGLLYAWQFPHFNALS 314

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
               + Y++A   M       +      L Y+ L   +    T  G     + I      
Sbjct: 315 HNIAEQYKQAGYVMTA-AENPKLNARVALRYSFLMFPLCFGLTYYGVTDWVFPIDSAIAN 373

Query: 246 YHFTLWAWRTFLCKEDKDIRV-------------TKKLFLESITYLFVLFTILMVDHLID 292
                 A++ +  ++                    KKLF  S+ +L  +  + M+     
Sbjct: 374 GWLAYLAFQFWRQQQKNYSGSNPTAEGLALAGTHAKKLFWCSVWHLPAVLILAMIHK--- 430

Query: 293 MKTVERYFF 301
            K     +F
Sbjct: 431 -KGQWDRWF 438


>gi|82701325|ref|YP_410891.1| protoheme IX farnesyltransferase [Nitrosospira multiformis ATCC
           25196]
 gi|123545220|sp|Q2YCM2|COXX_NITMU RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|82409390|gb|ABB73499.1| protoheme IX farnesyltransferase [Nitrosospira multiformis ATCC
           25196]
          Length = 298

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 113/289 (39%), Positives = 174/289 (60%), Gaps = 4/289 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R+  F  L KPRV+SL ++TA +G+ L+ PG + +   + +   IA  AGA+ A+N   
Sbjct: 13  SRVQQFYRLTKPRVVSLIVFTAVIGMFLSVPGVVPLDTLIFATVGIAFVAGAAAAVNCLV 72

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID +MART  RP+P G ++  E +V    +  + ++I+   +N ++  L   +   Y
Sbjct: 73  EQKIDAVMARTRGRPLPRGTVTSPETFVFLALVGGAGLLILHQLVNPLTMWLTLGTFVGY 132

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            +IYT+ LK  TPQNIVIGG +GA+PP++GWA+VTG+VS  +L++FLIIF WTPPHFW+L
Sbjct: 133 AIIYTVILKPMTPQNIVIGGASGAMPPVLGWAAVTGEVSADALLLFLIIFAWTPPHFWAL 192

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  K +Y K  +PMLP    D+ T++H+L+YT++   V ++P     + + Y      L
Sbjct: 193 ALYRKLEYAKVGMPMLPVTHGDKFTRLHVLLYTLILIAVTLMPYATQMSGLIYLAGAIVL 252

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
              F  +A + +L   D   ++ +  F  SI YL  LF +L+VDH I  
Sbjct: 253 DVIFLYYAVKIYLNYSD---QLARSAFRYSILYLAGLFAVLLVDHYIRF 298


>gi|17545091|ref|NP_518493.1| protoheme IX farnesyltransferase [Ralstonia solanacearum GMI1000]
 gi|17427381|emb|CAD13900.1| probable protoheme ix farnesyltransferase (heme o synthase)
           transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 310

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 106/286 (37%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGAVGIWLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  +  + L  + +  + +  N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGARQILLFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y  +   LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKFTLLHILLYTLIMVAATILPFVHGMSGYLYLAVALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F + AWR +    D    + +K F  SI YL +LF  L++DH    
Sbjct: 261 FLVHAWRMYRNYSD---ALAQKTFRYSIVYLSLLFAALLIDHYFKF 303


>gi|114561438|ref|YP_748951.1| protoheme IX farnesyltransferase [Shewanella frigidimarina NCIMB
           400]
 gi|122301044|sp|Q089F2|CYOE2_SHEFN RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|114332731|gb|ABI70113.1| protoheme IX farnesyltransferase [Shewanella frigidimarina NCIMB
           400]
          Length = 303

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 170/285 (59%), Gaps = 4/285 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   +  + KP+V++L + T  VG+ L+ PG + +   V  +  IAM AG++ A N   D
Sbjct: 17  QWRAYFEMTKPKVVALMLLTVLVGMCLSVPGIVPLQPLVAGMAGIAMMAGSAAAFNHLID 76

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART +RP+P G+IS  +A    VSL     V++   +N ++A L F S+  Y 
Sbjct: 77  RKIDGLMARTYNRPLPKGKISTTKAVTFAVSLGSLGFVVLYTLVNPLTAWLTFASLIGYA 136

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           ++YT +LKR T QNIVIGG+AGA+PP++GW ++T ++   +L++ +IIF WTPPHFW+LA
Sbjct: 137 LVYTAYLKRATSQNIVIGGLAGAMPPLLGWTAITNELHGYALLLVIIIFTWTPPHFWALA 196

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  + +Y K  IPMLP       TK  IL+YT+L +I  +LP ++G     Y +    L 
Sbjct: 197 IHRRKEYAKVDIPMLPVTHGVEFTKTCILLYTILLAIACLLPVLVGMCGPIYLVGSTVLS 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+    K      ++ ++F  SI +L VLF +L+VDH 
Sbjct: 257 CGFIYKAWQL---KFHDYPELSMQVFKFSIYHLMVLFIVLLVDHY 298


>gi|317121248|ref|YP_004101251.1| protoheme IX farnesyltransferase [Thermaerobacter marianensis DSM
           12885]
 gi|315591228|gb|ADU50524.1| protoheme IX farnesyltransferase [Thermaerobacter marianensis DSM
           12885]
          Length = 313

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 106/282 (37%), Positives = 152/282 (53%), Gaps = 4/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L+KP VM L + T    + +A G        ++++    +  GA+  LN   D 
Sbjct: 21  LRDYLTLMKPGVMLLVLVTTAASMWVALGEAPHPWTLLVTLAGTMLAGGAAATLNHVLDR 80

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           D+D  M RT+ RPI  G++ P  A    V LA+ S  ++   +N ++A +    I  YV 
Sbjct: 81  DMDAAMPRTSRRPIAAGRVHPGRATAFAVVLAMLSFALLYTQVNPLTAYIAAGGIAFYVG 140

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR TPQNIVIGG AGA+ P+IGWA+ TG + +A++VMFLI+F WTPPHFW+LA+
Sbjct: 141 VYTAWLKRRTPQNIVIGGAAGAVGPLIGWAAATGRLDVAAVVMFLIVFFWTPPHFWALAI 200

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +D+Y +A +PMLP V     T   I  YT +T  V +    LG  S  Y      LG 
Sbjct: 201 ALRDEYAQAKVPMLPVVAGVDATLRQIYFYTWVTVAVTLAMAPLGVLSWVYTAAAVVLGV 260

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            +            D      + L+  SI YLF LF  +++D
Sbjct: 261 RYLRLTRGLMAETSD---ARARALYGYSIVYLFSLFAAMVLD 299


>gi|90412705|ref|ZP_01220706.1| protoheme IX farnesyltransferase [Photobacterium profundum 3TCK]
 gi|90326280|gb|EAS42699.1| protoheme IX farnesyltransferase [Photobacterium profundum 3TCK]
          Length = 316

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 108/285 (37%), Positives = 160/285 (56%), Gaps = 5/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ + KP+V+++ + TA VG+ LA PG       ++ +  I   + A+ A N   D 
Sbjct: 31  WRDYLTMTKPKVVAMLLLTALVGMCLAVPGIPPAKAVILGLIGIGFQSAAAAAFNHVLDR 90

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
             D  MART +RP+  G+I  W+A V   +L V+  VI+      ++A L   S+  Y V
Sbjct: 91  RFDTQMARTYNRPLAKGRIETWKAVVFASTLMVAGFVILLELNA-LTAWLTMASLVGYAV 149

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLK  TPQNIVIGGIAGA PP++GW +VTG +   +L++ +++F WTPPHFW+LA+
Sbjct: 150 VYTVWLKHATPQNIVIGGIAGAAPPLLGWTAVTGQLDPHALLLVMLVFTWTPPHFWALAI 209

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY KA IPMLP       TK  +L+YTV+  +VG+LP + G +   Y +    L  
Sbjct: 210 HRRDDYAKAGIPMLPVTHGIEFTKTMVLLYTVMLFVVGLLPWLTGMSGGVYLVGSSLLNL 269

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A +                F  SI +L  LF +L+ DH I
Sbjct: 270 GFIGYALKLKFV---DSKGHAWATFKYSIWHLLALFVVLLGDHWI 311


>gi|291443824|ref|ZP_06583214.1| cytochrome oxidase assembly factor [Streptomyces roseosporus NRRL
           15998]
 gi|291346771|gb|EFE73675.1| cytochrome oxidase assembly factor [Streptomyces roseosporus NRRL
           15998]
          Length = 303

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 112/289 (38%), Positives = 164/289 (56%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D
Sbjct: 14  RVKAFVALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLMTTIGGYLSAGGANALNMYID 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E    G+ LAV S +  GL +NW+SA L   ++  YV
Sbjct: 74  RDIDALMDRTSQRPLVTGMVSPRECLAFGIGLAVFSTLWFGLLVNWLSAALALGALLFYV 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LKR T QNIV GGIAG +P +IGW++VT  VS A++++F +IF WTPPH+W L+
Sbjct: 134 VIYTMLLKRRTSQNIVWGGIAGCMPVLIGWSAVTNTVSWAAVILFAVIFFWTPPHYWPLS 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V T+R     I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 194 MKVKDDYARVGVPMLPVVATNRVVARQIVLYSWVMVAVSLLLTPLGYTGWFYTAVALLSG 253

Query: 246 YHFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 254 GAWLWEAHGLQNRAKAGVTGAKLKEMRLFHWSITYVSLLFLAVAVDPFL 302


>gi|239817349|ref|YP_002946259.1| protoheme IX farnesyltransferase [Variovorax paradoxus S110]
 gi|239803926|gb|ACS20993.1| protoheme IX farnesyltransferase [Variovorax paradoxus S110]
          Length = 301

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 113/288 (39%), Positives = 169/288 (58%), Gaps = 7/288 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALNMY 63
           L  F  L KPRV+ L ++ A +G+VLA    P    V ++V++   I + AGA+ A N  
Sbjct: 16  LRQFYALTKPRVVQLIVFCALIGMVLAVPGLPSWADVQRAVLACIGIWLVAGAAAAFNCL 75

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            +  ID  M RTA RP   GQ+S  +A V    L  +   ++   +N ++  L F +   
Sbjct: 76  VEKGIDAKMKRTAWRPTARGQLSDLQALVFSALLCAAGSALLWFQVNPLTMWLTFATFVG 135

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TGDV   +L++FLIIFLWTPPHFW+
Sbjct: 136 YAVIYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGDVGPEALILFLIIFLWTPPHFWA 195

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL   +DY+KA +PMLP    +  T++ +L+YT +     ++P + G +   Y  +   
Sbjct: 196 LALYRVEDYRKAGLPMLPVTHGNEFTRLQVLLYTFILFAACLMPFIYGMSGWLYLAVAVG 255

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           +   FT +A+  +    D    + +K F  S+ +L VLF  L+VDH +
Sbjct: 256 VSIGFTGYAFALWRNYSD---ALARKTFRFSLIHLSVLFAALLVDHYL 300


>gi|71023219|ref|XP_761839.1| hypothetical protein UM05692.1 [Ustilago maydis 521]
 gi|46100862|gb|EAK86095.1| hypothetical protein UM05692.1 [Ustilago maydis 521]
          Length = 1527

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/289 (23%), Positives = 125/289 (43%), Gaps = 15/289 (5%)

Query: 9    NFFIVLLKPRVMSLAIYTAFVGIVLAPGHI------SVLKSVISIFAIAMGAGASGALNM 62
              +  L K R+  L + T   G  L P  +       V   +     + + + A+ ALN 
Sbjct: 1214 KLYKQLSKSRLTFLVVLTGMAGYALCPASLTVAVASPVTTLLALTAGMTLCSAAANALNQ 1273

Query: 63   YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
              ++  D  M RT +RP+P   ++P  A+      A S + ++   +N ++A L   ++ 
Sbjct: 1274 LVESPYDAQMQRTRARPLPSRSVTPLHAFTFASVSAASGVGLLLTTVNPLTALLGAANVV 1333

Query: 123  CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLI----IFLWTP 178
             Y   YT  +KR T  N  +G + GA+PP++GWA+ TG +  ++ V        +F W  
Sbjct: 1334 LYSFTYTP-MKRSTIANTWVGAVVGALPPLMGWAACTGTLHTSTDVGGWSLAALLFAWQF 1392

Query: 179  PHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVT-Y 237
            PHF SLA   + +Y +    M+         ++ +     L  I  ++  + G  S   Y
Sbjct: 1393 PHFNSLAHTLRAEYARGGYRMMAVTDPALNRRVSLRYAVALLPICTLMIPLSGIVSPVAY 1452

Query: 238  GIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILM 286
             ++   L       AW+ +    ++ ++  +  F  S+ +L  +  + M
Sbjct: 1453 AVLSTPLNLLMAHAAWKFY---RERTVKSARWCFWVSLIHLPAVMLLAM 1498


>gi|326382197|ref|ZP_08203889.1| protoheme IX farnesyltransferase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326198927|gb|EGD56109.1| protoheme IX farnesyltransferase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 318

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 99/299 (33%), Positives = 162/299 (54%), Gaps = 10/299 (3%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            +I L KPRV+ L + +    ++ A  G + +   +I++    +GA ++ +LNM  DADI
Sbjct: 22  AYIALTKPRVIELLLVSTIPVMLQAERGSVDIALILITVVGGWLGAASANSLNMVADADI 81

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLA-------INWVSATLLFMSI 121
           D+ M RT  RP+    +    A V G+ LA  S  ++           +++ + L+ ++I
Sbjct: 82  DQKMKRTERRPLARHAVPVRNALVFGIVLAALSFAVLYFGTANSAGERSFLPSILVMITI 141

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             YV +YT+ LKR T QN++ GG AG +P ++GWA+VT  +S    VMFL++F WTPPH 
Sbjct: 142 GFYVGVYTLILKRRTWQNVIWGGAAGCMPALVGWAAVTHSLSWQPFVMFLVVFFWTPPHT 201

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LA+  ++DY+ A +PM P + +D     H+L+YT LT +      ++   S  Y ++ 
Sbjct: 202 WALAMRYREDYRAAGVPMFPVIASDERVTTHMLVYTWLTVLTSFF--LIPATSWIYLVVA 259

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
              G  F     + ++           K+FL S  YL +LF  L VD +I++ T+  YF
Sbjct: 260 VGSGAWFIYMVTKLYVETRRGVEVKPLKIFLTSNEYLALLFCGLAVDAVINLPTISSYF 318


>gi|126737267|ref|ZP_01753002.1| protoheme IX farnesyltransferase [Roseobacter sp. SK209-2-6]
 gi|126721852|gb|EBA18555.1| protoheme IX farnesyltransferase [Roseobacter sp. SK209-2-6]
          Length = 314

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 125/288 (43%), Positives = 180/288 (62%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TAFVG++ +P  +  +    ++  IA+G GASGALNM++DAD
Sbjct: 19  FGDYFALLKPRVMSLVVFTAFVGLLASPVSVHPVIGFCAVLFIAIGGGASGALNMWWDAD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT  RPIP G++   EA  LG++L+  S++++ LA N  +   L  +IF YVVI
Sbjct: 79  IDRVMKRTKGRPIPAGKVEEGEALSLGLALSGLSVIMLALATNVFAGAFLAFTIFFYVVI 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +S+   +MF + F+WTPPHFW+LAL 
Sbjct: 139 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGTMSVEPWLMFALTFMWTPPHFWALALF 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R T++HILIYTVL +++ V  +  G     Y  +   +   
Sbjct: 199 MRSDYDDAGVPMLTVTHGRRATRVHILIYTVLLALLAVGTSFSGIGGPIYLAVAVVMNAL 258

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   AW+     ED     + +  +  F  S+ YLF+ F  ++ + L+
Sbjct: 259 FLAGAWKISRRNEDMSEEDNFKAERSFFKLSLLYLFLHFGAILAEALL 306


>gi|313839976|gb|EFS77690.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL086PA1]
          Length = 337

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGTNWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYETAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|73540029|ref|YP_294549.1| protoheme IX farnesyltransferase [Ralstonia eutropha JMP134]
 gi|72117442|gb|AAZ59705.1| Protoheme IX farnesyltransferase [Ralstonia eutropha JMP134]
          Length = 311

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 104/286 (36%), Positives = 160/286 (55%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 25  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWRVLIGGGAGIWLLAGAAFAINCLVEQK 84

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  +    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 85  IDALMRRTAWRPSATGEITTTQTLIFSAVLGGAGMWLLHVFANDLTMWLTFATFLGYAVV 144

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GWA+V  DV   +  + LIIF WTPPHFW+LAL 
Sbjct: 145 YTILLKPATPQNIVIGGLSGAMPPALGWAAVANDVPAEAWFLVLIIFTWTPPHFWALALY 204

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T ++IL+YT++     +LP + G +   Y      LG  
Sbjct: 205 RRADYAKSGLPMLPITHGEKYTLLNILLYTLVMIAATLLPFVYGMSGYIYLASALVLGAW 264

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  ++W  +    D   ++ ++ F  SI YL +LF  L++DH    
Sbjct: 265 FLKYSWTMYRNYSD---QLAQRAFRFSILYLSLLFAALLIDHYFKF 307


>gi|319784699|ref|YP_004144175.1| protoheme IX farnesyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170587|gb|ADV14125.1| protoheme IX farnesyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 314

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 155/283 (54%), Positives = 206/283 (72%), Gaps = 1/283 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVMSL ++TAFVG+V AP  I+ L +VI+I AIA+GAGASGALNM+YDADID
Sbjct: 23  DFFALLKPRVMSLVVFTAFVGLVAAPVTINPLLAVIAILAIAIGAGASGALNMWYDADID 82

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RTASRP+P G+I P EA   G+ L+V S++ +G+ +NW++ATLL  +IF Y V+YT
Sbjct: 83  AVMTRTASRPVPAGRIQPHEALTFGLVLSVLSVMTLGVLVNWLAATLLAFTIFFYAVVYT 142

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR+TPQNIVIGG AGAIPP+IGWA+VTG VS+ S+V+FLIIFLWTPPHFW+LAL   
Sbjct: 143 MWLKRWTPQNIVIGGAAGAIPPVIGWAAVTGTVSLESVVLFLIIFLWTPPHFWALALFKS 202

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY KA IPM+PNV    +T+  I  Y ++ + VGVLP +LG+ +  YG+    LG  F 
Sbjct: 203 EDYAKAGIPMMPNVAGHASTRRQIFAYALVLAPVGVLPWLLGYTTPFYGVAALLLGIGFA 262

Query: 250 LWAWRTFLCKEDKD-IRVTKKLFLESITYLFVLFTILMVDHLI 291
            +AW+     +D   ++  K LF  S+ YLF +F   + D ++
Sbjct: 263 WYAWKVLGMADDDRVMKPAKALFAYSLLYLFAIFAAYLADSVV 305


>gi|328545013|ref|YP_004305122.1| Protoheme IX farnesyltransferase 2 [polymorphum gilvum SL003B-26A1]
 gi|326414755|gb|ADZ71818.1| Protoheme IX farnesyltransferase 2 [Polymorphum gilvum SL003B-26A1]
          Length = 312

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 144/269 (53%), Positives = 193/269 (71%), Gaps = 1/269 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ LLKPRVMSL I+TAFVG++LAPG +  + + +++  IA+GAGASGALNM+YDAD
Sbjct: 24  VGDYVALLKPRVMSLVIFTAFVGMMLAPGVLHPVLAAVALLCIAIGAGASGALNMWYDAD 83

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M+RTA RPIP G+IS  E +  G++L++ S+V +GL +NW +   L  +IF YVV+
Sbjct: 84  IDRVMSRTAKRPIPAGKISRQECFAFGMTLSIGSVVTLGLLVNWFAGAFLAFTIFFYVVV 143

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PPMIGWA+VTGDVS+ SLV+FLIIF+WTPPHFW+LAL 
Sbjct: 144 YTMWLKRSTPQNIVIGGAAGAFPPMIGWAAVTGDVSLESLVLFLIIFMWTPPHFWALALF 203

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY+ A IPMLP V  +  T+  IL Y+++ + + V P +LGFA   YGI    LG  
Sbjct: 204 KSGDYRAAGIPMLPVVAGEDATRNQILAYSLILTPIAVSPYLLGFAGPLYGIASTVLGAV 263

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESI 275
           F   A R +  +  D+  +   +LF  SI
Sbjct: 264 FFALALRVWRRRSGDEARKAAVRLFSFSI 292


>gi|241661867|ref|YP_002980227.1| protoheme IX farnesyltransferase [Ralstonia pickettii 12D]
 gi|240863894|gb|ACS61555.1| protoheme IX farnesyltransferase [Ralstonia pickettii 12D]
          Length = 313

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWSVLIGGAVGIWLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  V  V L  + +  + +  N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGTRQILVFSVVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y +    LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKYTLLHILLYTLIMIAATILPFVYGMSGYIYLVTALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AWR +    D    + +K F  SI YL +LF  L+VDH    
Sbjct: 261 FLSYAWRMYRKYSD---ALAQKTFRYSIIYLSILFAALLVDHYFKF 303


>gi|73956024|ref|XP_546634.2| PREDICTED: similar to heme A:farnesyltransferase [Canis familiaris]
          Length = 787

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/262 (25%), Positives = 124/262 (47%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + T   G  LAPG       +++     + + A+ ++N +++   D  M
Sbjct: 502 RLSKIKLTALVVSTTSAGFALAPGPFDWPCFLLTSLGTGLASCAANSINQFFEVPFDSNM 561

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A       AV  + ++   +N ++  L   +IF Y   YT  L
Sbjct: 562 NRTKNRPLVRGQISPLLAVSFATCCAVPGVALLTWGVNPLTGALGVFNIFLYTCCYTP-L 620

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GA+PP++GW + TG +   + ++  I++ W  PHF +L+   ++DY
Sbjct: 621 KRISIANTWVGAVVGAVPPVMGWTAATGSLDAGAFLLGGILYSWQFPHFNALSWGLREDY 680

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    +     +L   + T+ +I   +  + T   
Sbjct: 681 SRGGYCMMSVT-HPALCRRVALRHCLALIGLSTAAPVLDVTTWTFPVISLPINLYITYLG 739

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R +    D D + ++KLF  S
Sbjct: 740 FRFYT---DADRKSSRKLFFCS 758


>gi|296140221|ref|YP_003647464.1| protoheme IX farnesyltransferase [Tsukamurella paurometabola DSM
           20162]
 gi|296028355|gb|ADG79125.1| protoheme IX farnesyltransferase [Tsukamurella paurometabola DSM
           20162]
          Length = 328

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 99/292 (33%), Positives = 160/292 (54%), Gaps = 3/292 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            +I L KP+V+ L +      ++LA  GH+++   + ++F   +GA ++  LNM  DADI
Sbjct: 37  AYIALTKPKVIELLLVATIPVMLLADRGHVNLGLILSTLFGGWLGAASANTLNMVADADI 96

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK M RT  RP+    +    A + G++LA +S   + L  N ++A+L+ ++I  Y+ +Y
Sbjct: 97  DKKMKRTERRPLARQAVPTRHALIFGIALAAASFAWLSLTTNLLAASLVLVTIAFYLFVY 156

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P ++GWA+ TG +   ++V+FL+IF WTPPH W+LA+  
Sbjct: 157 TMLLKRRTSQNVVWGGAAGCMPTLVGWAAATGTIQWPAIVLFLVIFFWTPPHTWALAMRY 216

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           ++DY+ A +PMLP V  + T    ++ YT  T I  ++            +     G  F
Sbjct: 217 REDYKAAGVPMLPVVAPETTVARQMVWYTWATVITTLVLIPAAGVVYA--VAAALCGAWF 274

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
                + +   +        K+FL+S  YL VLF  L VD +++  TV    
Sbjct: 275 LYAVHKLYNQTKAGQEIKPLKVFLQSNNYLAVLFCALSVDSILNYPTVGHLL 326


>gi|313793911|gb|EFS41935.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL110PA1]
 gi|313801301|gb|EFS42552.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL110PA2]
 gi|314963734|gb|EFT07834.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL082PA1]
 gi|327452063|gb|EGE98717.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL092PA1]
          Length = 337

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGTNWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|172039513|ref|YP_001806014.1| protoheme IX farnesyltransferase [Cyanothece sp. ATCC 51142]
 gi|171700967|gb|ACB53948.1| cytochrome c oxidase folding protein [Cyanothece sp. ATCC 51142]
          Length = 314

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 114/285 (40%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +   +  I++    + A ++  +N  YD 
Sbjct: 17  VRSYYQLTKPRIIPLLLITTAASMWIASEGEVDSFRLFITLLGGTLAAASAQVMNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++    A +  + LAV S  +  + IN +S  L    I  Y++
Sbjct: 77  DIDYEMLRTRARPIPSGRVQSRHALIFALVLAVISFSLFLVYINLLSGLLAMSGIAFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG AG+IPP++GWA+VTGD+S A  ++F IIFLWTPPHFW+LAL
Sbjct: 137 VYTHFLKRNTPQNIVIGGAAGSIPPLVGWAAVTGDLSWAPWILFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLT-SIVGVLPTMLGFASVTYGIIVFFLG 245
           + KDDY + ++PM+P +  + +T   I  YT+L      +L   +G +   YG++  FLG
Sbjct: 197 MIKDDYAQVNVPMMPVIEGEESTVRQIWWYTLLVIPCTFLLVYPVGASGWLYGVMALFLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F    W       DKD+   K LF  SI YL +L T ++VD L
Sbjct: 257 AIFIKKTWLLKQNPLDKDM--AKSLFKFSILYLMLLCTAMVVDSL 299


>gi|238231399|ref|NP_001153944.1| heme A:farnesyltransferase [Acyrthosiphon pisum]
 gi|239790803|dbj|BAH71938.1| ACYPI009141 [Acyrthosiphon pisum]
          Length = 402

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 74/282 (26%), Positives = 134/282 (47%), Gaps = 6/282 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++ L K R+ SL + T   G  +AP    ++  ++      M +GA+ ++N Y++   
Sbjct: 90  QHYLKLSKSRLTSLVVVTTMAGYAMAPAPFDLVTFILCSAGTGMVSGAANSINQYHEVPF 149

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M+RT +R +  G ++P  A           +V +   +N V+A L   ++F Y  IY
Sbjct: 150 DAQMSRTKNRLLVRGILTPIHALTFAAVSGSLGLVTLYYGVNPVTAALGAANLFLYTSIY 209

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGD-VSIASLVMFLIIFLWTPPHFWSLALL 187
           T  +KR +  N  IG + GAIPP++GWA  TG  +    L++  +++ W  PHF +L+  
Sbjct: 210 TP-MKRLSILNTWIGSVVGAIPPLMGWAGCTGGVIDSGGLLLAGLLYAWQFPHFNALSWN 268

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L YT+    +          ++ + I V  L  +
Sbjct: 269 LRPDYSRAGYRMMSVTNPG-LCRRTALRYTIGVFGLCCAAPFCELTNIYFSIAVSPLNAY 327

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   AW+     ++ D + ++ LF  S+ +L  L  +L+V+ 
Sbjct: 328 FVYLAWKFH---QNSDSKTSRNLFRFSLIHLPALMILLLVNK 366


>gi|17228443|ref|NP_484991.1| protoheme IX farnesyltransferase [Nostoc sp. PCC 7120]
 gi|81772720|sp|Q8YYA3|COXX_ANASP RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|17130294|dbj|BAB72905.1| heme O synthase [Nostoc sp. PCC 7120]
          Length = 318

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 166/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +  +  ++++    + A ++  +N  YD 
Sbjct: 18  IQSYYQLTKPRIIPLLLITTAGSMWIAAQGQVDPVLLLVTMAGGTLAAASAQTINCIYDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P G++   +A +  ++LAV S  ++ +  N ++A+L    I  YV+
Sbjct: 78  DIDYEMERTRHRPMPSGKVQVRDALIFAIALAVLSFTLLTVFANLLAASLALSGIIFYVL 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIP ++GWA+VTG +S ++ ++F I+FLWTPPHFW+LAL
Sbjct: 138 IYTHWLKRHSTQNIVIGGAAGAIPALVGWAAVTGTLSWSAWLIFAIVFLWTPPHFWALAL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + +DDY K  IPMLP V  +  T   I  YT++T    +L       + + Y  I   LG
Sbjct: 198 MIRDDYAKVGIPMLPVVEGNAATVKQIWYYTLITVAATLLLVYPLHASGIVYAAIAISLG 257

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   +WR       +D    ++LFL SI+Y+ +L   ++VD L
Sbjct: 258 AVFIRKSWRL--LHNPEDRPTARELFLYSISYMMLLCLGMVVDSL 300


>gi|313763521|gb|EFS34885.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL013PA1]
 gi|313816703|gb|EFS54417.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL059PA1]
 gi|313829469|gb|EFS67183.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL063PA2]
 gi|314914821|gb|EFS78652.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL005PA4]
 gi|314919363|gb|EFS83194.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL050PA1]
 gi|314920728|gb|EFS84559.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL050PA3]
 gi|314930608|gb|EFS94439.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL067PA1]
 gi|314957536|gb|EFT01639.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL002PA1]
 gi|314968438|gb|EFT12536.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL037PA1]
 gi|315099149|gb|EFT71125.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL059PA2]
 gi|315100368|gb|EFT72344.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL046PA1]
 gi|315108947|gb|EFT80923.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL030PA2]
 gi|327454900|gb|EGF01555.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL087PA3]
 gi|327457814|gb|EGF04469.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL083PA2]
 gi|328755266|gb|EGF68882.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL087PA1]
 gi|328758253|gb|EGF71869.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL025PA2]
          Length = 337

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGTNWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|315079583|gb|EFT51576.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL053PA2]
          Length = 337

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 150/290 (51%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q       + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQEPGRRGLIYGIILEIIATIILGFGTNWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|326404560|ref|YP_004284642.1| protoheme IX farnesyltransferase [Acidiphilium multivorum AIU301]
 gi|325051422|dbj|BAJ81760.1| protoheme IX farnesyltransferase [Acidiphilium multivorum AIU301]
          Length = 317

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 136/288 (47%), Positives = 188/288 (65%), Gaps = 6/288 (2%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ LLKPRV+ L +YT   G+++APG I+ +    +I  IAM AGA+GA+NM+YD DID
Sbjct: 30  DWLALLKPRVLYLVVYTGAAGLLVAPGGINPILGFAAILCIAMAAGAAGAINMWYDRDID 89

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RTA RPIP G+ISP  A   GV+L+  S+++M LA N ++A LL  SI  YV IYT
Sbjct: 90  AVMRRTAGRPIPTGRISPDGALAYGVALSALSVLLMWLATNLLAAGLLAASIGFYVFIYT 149

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PP+IGWA+ TG V +  +++F IIF WTPPHFW+L+L   
Sbjct: 150 MWLKRRTPQNIVIGGAAGAFPPVIGWAAATGHVGLLPVLLFAIIFFWTPPHFWALSLFAS 209

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DYQKA +PMLP V   + T++ ++ YT+    + +LP +L  A   YG     LG  F 
Sbjct: 210 ADYQKAGVPMLPVVAGQKATRLAVMRYTLWLVPLSLLPYVLHLAGPVYGASAMVLGLAFV 269

Query: 250 LWAWRTFLCKEDKD------IRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++WR    ++D++          K  F  SI YLF++F  L++DHL+
Sbjct: 270 WYSWRVLRDRQDENGVSLTRDAPAKAAFKFSILYLFLIFGALVLDHLV 317


>gi|314954436|gb|EFS98842.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL027PA1]
          Length = 337

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKIGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGTNWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|329851444|ref|ZP_08266201.1| protoheme IX farnesyltransferase [Asticcacaulis biprosthecum C19]
 gi|328840290|gb|EGF89862.1| protoheme IX farnesyltransferase [Asticcacaulis biprosthecum C19]
          Length = 338

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 123/297 (41%), Positives = 178/297 (59%), Gaps = 15/297 (5%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  LLKPRVMSL ++TA  G+++A   I    + I++  IA+GAGA+GALNM  + + D
Sbjct: 37  DYFQLLKPRVMSLVVFTALTGLIIADQPIHPFLAFIAVLCIALGAGAAGALNMALEGETD 96

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGL-AINWVSATLLFMSIFCYVVIY 128
            +M RT  RP+  G+++  +A   G  LA  S+ +M +   + ++A LL M+I  YVV+Y
Sbjct: 97  ALMRRTKLRPVAAGRVTRNDALTFGGVLAFLSVFMMWIAFPDGLAAGLLAMTIVYYVVLY 156

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR TPQNIVIGG AGA PP+IGWA+ TG     + ++F IIFLWTPPH W+LAL  
Sbjct: 157 TLVLKRRTPQNIVIGGAAGAFPPVIGWAAATGAAPWEAWILFAIIFLWTPPHSWALALYT 216

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY KA IPM+P     ++T++ IL+Y+++ + V  LP  +G   + YG +    G  F
Sbjct: 217 AEDYAKAGIPMMPVARGAKSTRLQILLYSLVMAPVACLPMAVGLGGLVYGFVSVVGGAVF 276

Query: 249 TLWAWRTFLCKE--------------DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +A R +L +                K+    + LF  SI YL  LF  L+V+HLI
Sbjct: 277 IYFALRVYLSRAGDHPEGGENSLYDVKKEALSARNLFAYSIFYLTALFATLLVEHLI 333


>gi|332533260|ref|ZP_08409127.1| heme O synthase, protoheme IX farnesyltransferase COX10-CtaB
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037339|gb|EGI73794.1| heme O synthase, protoheme IX farnesyltransferase COX10-CtaB
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 309

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 103/287 (35%), Positives = 165/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ + K +V+++ + TA+VG+ LAP     ++   IS+  I + + A+  +N   D+
Sbjct: 26  LQDYLAISKFKVVAMLVLTAWVGLALAPDVGRGMVVQFISLLGIGLLSAAAAVINHVVDS 85

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  MART  RP+  G++S   A      + V+  +++ +  N ++A L   ++  Y  
Sbjct: 86  EIDSKMARTRHRPVAKGRLSKTHALSFAAVIGVAGFIMLMVWANTLTAILTLFALVGYAF 145

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA+PP++GW S T  ++ A  ++ +IIF WTPPHFW+LA+
Sbjct: 146 VYTSFLKRATPQNIVIGGLAGAMPPLLGWVSETNQMAAAPWLLVMIIFTWTPPHFWALAI 205

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY++A IPMLP        K  ++ Y+VL ++V VLP ++G + + Y I    L  
Sbjct: 206 ARKSDYERAKIPMLPVTHGIDFCKTCVVAYSVLLAVVCVLPYLIGMSGLIYLIGACVLNA 265

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A    +   D+       LF  SI +L VLF IL +D  + +
Sbjct: 266 VFIYKAVNLKIAGNDET---AMDLFRFSIIHLMVLFVILFIDKWLPL 309


>gi|182639250|sp|Q6A7G0|COXX_PROAC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|314923812|gb|EFS87643.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL001PA1]
 gi|314966174|gb|EFT10273.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL082PA2]
 gi|314981940|gb|EFT26033.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL110PA3]
 gi|315090852|gb|EFT62828.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL110PA4]
 gi|315095064|gb|EFT67040.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL060PA1]
 gi|315104296|gb|EFT76272.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL050PA2]
 gi|315106818|gb|EFT78794.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL030PA1]
 gi|327328156|gb|EGE69925.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL103PA1]
          Length = 337

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +   + ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLVTTLPVMFLASHGVPKLGLVIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILWIIATIILGFGANWLSAALALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVGWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T  + ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVAIQILIYTVMTVAISLVLWPVAHMGWIYVVVAVVSGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|182639249|sp|Q8Y2G4|COXX_RALSO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 307

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 106/286 (37%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 18  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGAVGIWLFAGAAFAINCLVERK 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  +  + L  + +  + +  N ++  L F +   Y +I
Sbjct: 78  IDAMMRRTAWRPSASGELGARQILLFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 138 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y  +   LG+ 
Sbjct: 198 RRADYAKSGLPMLPITHGEKFTLLHILLYTLIMVAATILPFVHGMSGYLYLAVALVLGFG 257

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F + AWR +    D    + +K F  SI YL +LF  L++DH    
Sbjct: 258 FLVHAWRMYRNYSD---ALAQKTFRYSIVYLSLLFAALLIDHYFKF 300


>gi|315182389|gb|ADT89302.1| protoheme IX farnesyltransferase [Vibrio furnissii NCTC 11218]
          Length = 298

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 173/288 (60%), Gaps = 4/288 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           V R + ++ L KP+V++L + TA VG+ LA PG +    +V+ +  I + AG++ ALN  
Sbjct: 14  VSRWHIYLTLTKPKVVALMLLTALVGMCLAQPGLMPFKAAVLGLSGIGLMAGSAAALNHL 73

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D  ID MMART  RP+P G+I      +   +L +    I+   +N ++A L F S+  
Sbjct: 74  IDRRIDAMMARTYKRPLPSGEIQASRVMLFAFALGIVGFAILYWGVNGLTAWLTFASLLG 133

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT++LKR TPQNIVI G+AGA+PP++GW SVTG++   + ++ +IIF+WTPPHFW+
Sbjct: 134 YAVVYTLYLKRATPQNIVIAGLAGAMPPLLGWTSVTGELHANAWLLVMIIFIWTPPHFWA 193

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  KDDY KA IPMLP       TK  IL+YT L ++V VLP ++G + V Y      
Sbjct: 194 LAIHRKDDYAKADIPMLPVTHGVEYTKTSILLYTFLLALVCVLPVLVGMSGVIYFAASSV 253

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F   AW     K D +       F  SI +L +LF  L++DH +
Sbjct: 254 LSLGFIYSAWAL---KYDPENSSAINTFKYSIYHLMMLFIALLLDHYL 298


>gi|332675987|gb|AEE72803.1| protoheme IX farnesyltransferase [Propionibacterium acnes 266]
          Length = 345

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 56  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 115

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 116 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGANWLSAGLALIANLFYVF 175

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 176 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 235

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 236 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 295

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 296 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 345


>gi|257053551|ref|YP_003131384.1| protoheme IX farnesyltransferase [Halorhabdus utahensis DSM 12940]
 gi|256692314|gb|ACV12651.1| protoheme IX farnesyltransferase [Halorhabdus utahensis DSM 12940]
          Length = 478

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 96/290 (33%), Positives = 146/290 (50%), Gaps = 7/290 (2%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGAL 60
            +  L  ++ L KPR+M L    A  G+ LA      ++V   + ++    +  GASG  
Sbjct: 191 MLATLQAYVRLTKPRLMWLLCLVASAGMALATTGGRTLTVETILATLSGGVLAIGASGTF 250

Query: 61  NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS 120
           N   + D+DK M RT+ RP+   +I    A   G+ L+  S+ I    +N ++A L   +
Sbjct: 251 NHVLERDVDKRMQRTSDRPVVTDRIPIRNAVAFGLLLSALSLAIFA-TVNVLAAALGLSA 309

Query: 121 IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH 180
           I  Y V+YT+ LK  T QN VIGG AGA+P +IGW +VTG   +  L +  I+FLWTP H
Sbjct: 310 ILFYSVVYTLLLKPNTVQNTVIGGFAGALPALIGWVAVTGTFGVPGLALAGIVFLWTPAH 369

Query: 181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII 240
           F++LAL  +DDY +   PM+P V  +  T+ HIL+Y   T +       L    V YG  
Sbjct: 370 FYNLALAYQDDYARGGFPMMPVVRGETVTRKHILLYLGATLLAASGLATLANLGVLYGAT 429

Query: 241 VFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           V  +G  F    W   +   ++      + F  S  +L  L   +++D +
Sbjct: 430 VSIVGAIFL---WAVLVLHRERTTDAAFRAFHASNAFLGALLVAVVIDAM 476


>gi|15789856|ref|NP_279680.1| heme synthase [Halobacterium sp. NRC-1]
 gi|74569695|sp|Q9HRJ8|COXX_HALSA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|10580252|gb|AAG19160.1| heme synthase [Halobacterium sp. NRC-1]
          Length = 442

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 151/290 (52%), Gaps = 10/290 (3%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP------GHISVLKSVISIFAIAMGAGASGALN 61
           +  ++ L+KPR+M L    A  G+ LA         +S    V+++    +  GASG  N
Sbjct: 156 VRAYVQLMKPRLMWLLCLVAGAGMALASSQLGAGQQLSAATVVLTLGGGVLSIGASGTFN 215

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              + + D+ MART  RP+   +I P  A   GV L V+S+     A+N ++A L   +I
Sbjct: 216 HVLEREQDEKMARTDDRPVVTDRIPPRNALAFGVVLGVASLAAFA-AVNLLTAVLGLTAI 274

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y ++YT+ LK  T Q+ VIGG AGA+P +IGW +VTG V +  +V+  +IFLWTP HF
Sbjct: 275 AFYSIVYTLVLKPNTRQSTVIGGAAGALPALIGWVAVTGAVGVGGVVLAGVIFLWTPAHF 334

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           ++LAL  KDDY++   P++P V  +  T+ HI+ Y   T    V+   L      Y    
Sbjct: 335 YNLALAYKDDYERGGFPLMPVVEGEAKTRRHIVYYIGATLASAVVLAELTGLGPLYAATT 394

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             LG  F  +A R      ++D R   + F  S  YL  L   +++D ++
Sbjct: 395 VLLGAVFLYFAIRLH---RERDRRAAMRSFHASNAYLGCLLVAVVLDTMV 441


>gi|39933910|ref|NP_946186.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|39647757|emb|CAE26277.1| heme O synthase [Rhodopseudomonas palustris CGA009]
          Length = 321

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 138/282 (48%), Positives = 191/282 (67%), Gaps = 1/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL ++TA VG+++APG    + ++ +I  IA+G GA+GALNM+Y+ D
Sbjct: 29  VADYIALLKPRVMSLVVFTALVGLLMAPGSFHPVLAITAIICIAVGGGAAGALNMWYEDD 88

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RPIP G+++  EA   G++LA  S+V +G+ +NW++A LL  +IF YVVI
Sbjct: 89  IDAKMTRTANRPIPRGRVTRPEALTFGMTLAFFSVVTLGILVNWIAAGLLAFTIFFYVVI 148

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ WASVTG +++  +++FLIIF WTPPHFW+LAL 
Sbjct: 149 YTMWLKRWTAQNIVIGGAAGALPPVVAWASVTGSLAVEPILLFLIIFFWTPPHFWALALF 208

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YTV    V   P  LG+  V YG+    LG  
Sbjct: 209 RNDDYARAGVPMLPVVAGPDHTRLQILLYTVALVAVAAAPWPLGYFDVIYGVASLALGGW 268

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITYLFVLFTILMVD 288
             + A R +  +         + LF  SI YLF LF IL+V+
Sbjct: 269 MLVLAVRVYRHRSGSAALRATRNLFKFSILYLFALFAILLVE 310


>gi|182677721|ref|YP_001831867.1| protoheme IX farnesyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|205693130|sp|B2IGJ6|COXX_BEII9 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182633604|gb|ACB94378.1| protoheme IX farnesyltransferase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 321

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 146/286 (51%), Positives = 202/286 (70%), Gaps = 1/286 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
           + +  LLKPRVMSL I+TA  G+++AP  +  +    S+ AIA+GAGASGALNM+YDADI
Sbjct: 18  SDYFALLKPRVMSLVIFTALAGMLIAPDPVHPIVGFASLLAIAVGAGASGALNMWYDADI 77

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA RPIPLG++ P EA   G++L+  S+  +G+  NW++A  L  +IF YVVIY
Sbjct: 78  DAVMKRTAKRPIPLGRVMPNEALAFGLTLSFLSVFTLGIVANWLAAGFLAFTIFFYVVIY 137

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG AGA PPM+G+A+ TG  S++S ++F IIF+WTPPHFW+LAL  
Sbjct: 138 TMWLKRSTPQNIVIGGAAGAFPPMVGYAAATGHFSLSSFILFAIIFIWTPPHFWALALGR 197

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY++A IPM+PNV     T++ IL+YT+L + +GV P +LGFAS  YG++   LG   
Sbjct: 198 SEDYRQAGIPMMPNVKGAARTRLEILLYTLLLAPLGVAPWLLGFASFVYGMLSIALGAAM 257

Query: 249 TLWAWRTFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHLIDM 293
             +A R ++ +E     R  K LF  SI YLF+LF  ++V+ L+ +
Sbjct: 258 LFFAARVYIVQEGPSADRHAKALFGFSILYLFLLFAEIVVERLVPI 303


>gi|319795675|ref|YP_004157315.1| protoheme ix farnesyltransferase [Variovorax paradoxus EPS]
 gi|315598138|gb|ADU39204.1| protoheme IX farnesyltransferase [Variovorax paradoxus EPS]
          Length = 301

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 113/289 (39%), Positives = 169/289 (58%), Gaps = 7/289 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALNMY 63
           L  F  L KPRV+ L ++ A +G+VLA    P    V ++V++   I + AGA+ A N  
Sbjct: 16  LRQFYALTKPRVVQLIVFCALIGMVLAVPGLPSWFDVQRAVLACIGIWLVAGAAAAFNCL 75

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            +  ID  M RTA RP   GQ+S  +A V    L  +   ++   +N ++  L F +   
Sbjct: 76  VEKGIDAKMKRTAWRPTARGQLSDLQALVFSALLCAAGSALLWFTVNPLTMWLTFATFVG 135

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TGDV   +L++FLIIFLWTPPHFW+
Sbjct: 136 YAVIYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGDVGPEALILFLIIFLWTPPHFWA 195

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL   +DY+KA +PMLP    +  T++ +L+YT +     ++P + G +   Y  +   
Sbjct: 196 LALYRVEDYRKAGLPMLPVTHGNEFTRLQVLLYTFILFAACLMPFIYGMSGWLYLAVAVV 255

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           +   FT +A+  +    D    + +K F  S+ +L VLF  L+VDH + 
Sbjct: 256 VSIGFTGYAFALWRNYSD---TLARKTFRFSLIHLSVLFLALLVDHYLH 301


>gi|289428641|ref|ZP_06430324.1| protoheme IX farnesyltransferase [Propionibacterium acnes J165]
 gi|295131110|ref|YP_003581773.1| protoheme IX farnesyltransferase [Propionibacterium acnes SK137]
 gi|289158039|gb|EFD06259.1| protoheme IX farnesyltransferase [Propionibacterium acnes J165]
 gi|291375558|gb|ADD99412.1| protoheme IX farnesyltransferase [Propionibacterium acnes SK137]
 gi|313773460|gb|EFS39426.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL074PA1]
 gi|313808020|gb|EFS46501.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL087PA2]
 gi|313811512|gb|EFS49226.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL083PA1]
 gi|313813429|gb|EFS51143.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL025PA1]
 gi|313822089|gb|EFS59803.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL036PA1]
 gi|313823677|gb|EFS61391.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL036PA2]
 gi|313826001|gb|EFS63715.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL063PA1]
 gi|313831253|gb|EFS68967.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL007PA1]
 gi|313834864|gb|EFS72578.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL056PA1]
 gi|314924739|gb|EFS88570.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL036PA3]
 gi|314974129|gb|EFT18225.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL053PA1]
 gi|314976581|gb|EFT20676.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL045PA1]
 gi|314978963|gb|EFT23057.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL072PA2]
 gi|314984400|gb|EFT28492.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL005PA1]
 gi|314986592|gb|EFT30684.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL005PA2]
 gi|314990949|gb|EFT35040.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL005PA3]
 gi|315081188|gb|EFT53164.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL078PA1]
 gi|315083553|gb|EFT55529.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL027PA2]
 gi|315089245|gb|EFT61221.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL072PA1]
 gi|315095268|gb|EFT67244.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL038PA1]
 gi|327328469|gb|EGE70231.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL096PA2]
 gi|327329664|gb|EGE71420.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL096PA3]
 gi|327444257|gb|EGE90911.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL043PA2]
 gi|327444864|gb|EGE91518.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL043PA1]
 gi|327446349|gb|EGE93003.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL013PA2]
 gi|328752339|gb|EGF65955.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL020PA1]
 gi|328759998|gb|EGF73581.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL099PA1]
          Length = 337

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGANWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|187927335|ref|YP_001897822.1| protoheme IX farnesyltransferase [Ralstonia pickettii 12J]
 gi|309779964|ref|ZP_07674718.1| protoheme IX farnesyltransferase [Ralstonia sp. 5_7_47FAA]
 gi|187724225|gb|ACD25390.1| protoheme IX farnesyltransferase [Ralstonia pickettii 12J]
 gi|308921323|gb|EFP66966.1| protoheme IX farnesyltransferase [Ralstonia sp. 5_7_47FAA]
          Length = 313

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 108/286 (37%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWSVLIGGAVGIWLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  V  + L  + +  + +  N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGTRQILVFSLVLGGAGMWTLHVFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y +    LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKYTLLHILLYTLIMIAATILPFVYGMSGYIYLVTALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AWR +    D    + +K F  SI YL +LF  L+VDH    
Sbjct: 261 FLSYAWRMYRKYSD---ALAQKTFRYSIIYLSILFAALLVDHYFKF 303


>gi|114319463|ref|YP_741146.1| protoheme IX farnesyltransferase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225857|gb|ABI55656.1| protoheme IX farnesyltransferase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 309

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 118/287 (41%), Positives = 169/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L ++TA VG+ LA PG +  +   +    IA+ AG++ ALN   D 
Sbjct: 22  WRDYLTLTKPRVVVLMVFTAIVGMFLASPGQVPWVALTVGSLGIALAAGSAAALNHLADQ 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+P G + P +       L V+ + ++ L IN ++A L F S+  Y +
Sbjct: 82  RIDAIMARTRRRPLPSGHLRPLQVLGFSSLLGVAGLGMLALWINPLTAALTFASLIGYAL 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG AGA PP++GW +VTG V   +L++FLI+F+WTPPHFW+LA+
Sbjct: 142 VYTLYLKRATPQNIVIGGAAGAAPPLLGWTAVTGSVDAHALLLFLIVFVWTPPHFWALAV 201

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY++A +PMLP V  +R T+  IL+YTVL   V +LP         Y      LG 
Sbjct: 202 ARLKDYERADVPMLPVVYGERFTRWQILLYTVLLLAVSLLPWATFMGGWLYLAAAVGLGG 261

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            + +   R  L       R+  + F  SI YLF LF  L+VD  + +
Sbjct: 262 WYLMLNVRLLLT---PGPRLPMRSFRFSIIYLFGLFAALLVDRQLPV 305


>gi|313819587|gb|EFS57301.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL046PA2]
 gi|314962157|gb|EFT06258.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL002PA2]
 gi|315087071|gb|EFT59047.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL002PA3]
          Length = 337

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLITTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQEMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGANWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|300741465|ref|ZP_07071486.1| protoheme IX farnesyltransferase [Rothia dentocariosa M567]
 gi|300380650|gb|EFJ77212.1| protoheme IX farnesyltransferase [Rothia dentocariosa M567]
          Length = 303

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 100/298 (33%), Positives = 158/298 (53%), Gaps = 3/298 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGI-VLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +I L KP+++ L + T    +   A G  S    + ++   AM AG+S A N Y D
Sbjct: 6   KIKAYIHLTKPQIIELLLVTTAPTMMFAAHGMPSFWLVINTLLGGAMAAGSSCAFNCYID 65

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID+ M RT  RP+  G+++  EA +    LAV S+V +   +N +S  L   +I  YV
Sbjct: 66  RDIDRKMKRTEKRPLVTGELTDREALIFAWVLAVISVVYLWTMVNPLSGLLGLAAILLYV 125

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V Y+++LK+ T QNIV GGIAG +P +I WA+V   +   +LV+F +IFLWTPPH+W L+
Sbjct: 126 VFYSMYLKKRTTQNIVWGGIAGCMPVLIAWAAVRNTIEWPALVLFTVIFLWTPPHYWPLS 185

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PML  +   +   + +++Y     I  +L   +G A   YG+     G
Sbjct: 186 MKYAEDYKAAGVPMLGAIAPAQAVSVQVVLYGWAMVICSLLLIPIGGAGWVYGVSAATAG 245

Query: 246 YHFTLWAWRTFL--CKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYFF 301
             F     +      ++    R    +F  SITYL +LF  L +D  +    +E + F
Sbjct: 246 AWFLYHCHKLHYLALQQVATSRTAMVVFFGSITYLTILFIALAIDPFVGQPILESFIF 303


>gi|254424947|ref|ZP_05038665.1| protoheme IX farnesyltransferase [Synechococcus sp. PCC 7335]
 gi|196192436|gb|EDX87400.1| protoheme IX farnesyltransferase [Synechococcus sp. PCC 7335]
          Length = 333

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 109/285 (38%), Positives = 170/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L +     G+ +A  G +  +  ++++ +  + A ++  +N  YD 
Sbjct: 18  IQSYWQLTKPRIIPLLLIETAAGMWVAGEGRVGPVLLLVTLLSGTLAAASAQTINCIYDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RPIP G+I P +A +  + +A+ S  ++    N +SA+L  + I  YV 
Sbjct: 78  DIDYDMERTRHRPIPSGRIQPRDALLFALVMAMMSFSLLASFANLLSASLAMLGIMVYVG 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR +PQNIVIGG AGAIPP++GWA+VTG + +A+ V F I+F+WTPPHFW+LA+
Sbjct: 138 VYTFWLKRSSPQNIVIGGAAGAIPPLVGWAAVTGHLDLAAWVFFAIVFVWTPPHFWALAM 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           L KDDY K ++PM+P VV ++ T   I  YTV    + ++     G   V YG+    LG
Sbjct: 198 LIKDDYAKVNVPMMPVVVGNQETAKQIWRYTVGLVPLTLVMVYPLGACGVVYGLGAAVLG 257

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+     +D+D  + +  F  SI Y+ +L  ++++D L
Sbjct: 258 GLFLKKAWQLRCHFDDRD--LARGTFKYSIFYMMLLAVVMVLDSL 300


>gi|83642966|ref|YP_431401.1| protoheme IX farnesyltransferase [Hahella chejuensis KCTC 2396]
 gi|123535411|sp|Q2SQU8|CYOE_HAHCH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|83631009|gb|ABC26976.1| protoheme IX farnesyltransferase [Hahella chejuensis KCTC 2396]
          Length = 299

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 121/287 (42%), Positives = 168/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KPRV++L + TA VG++LA    +     ++    IA+ A ++ A+N   D 
Sbjct: 13  WRDYYELCKPRVVALMMLTAVVGMLLASDQGMPWNALILGNLGIALLASSAAAINHIVDQ 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RPI  G++    A     SLAV  + I+   +N ++A L   S+  Y V
Sbjct: 73  KIDAVMARTQKRPIVQGRVDNVHALTFAFSLAVVGMAILAWGVNPLTAWLTLASLIGYAV 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIV+GG+AGA PP++GW SVTG V   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 VYTLFLKRATPQNIVLGGLAGAAPPLLGWTSVTGTVDPHALLLVLIIFAWTPPHFWALAV 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KD+Y KA +PMLP    DR TK+HIL+YT++     +LP + G     Y +    LG 
Sbjct: 193 HRKDEYAKAGVPMLPVTHGDRYTKLHILLYTLMLFAASMLPFITGMCGWIYFVAALALGV 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +    D       K F  SITYL +LF  L+ DH I +
Sbjct: 253 RFLDWAWAMW---RDSRKHAAIKTFRYSITYLMLLFVALLADHYIPV 296


>gi|75906749|ref|YP_321045.1| protoheme IX farnesyltransferase [Anabaena variabilis ATCC 29413]
 gi|123610676|sp|Q3MFT6|COXX_ANAVT RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|75700474|gb|ABA20150.1| Protoheme IX farnesyltransferase [Anabaena variabilis ATCC 29413]
          Length = 318

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +  +  ++++    + A ++  +N  YD 
Sbjct: 18  IQSYYQLTKPRIIPLLLITTAGSMWIAAQGQVDPVLLLVTMAGGTLAAASAQTINCIYDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P G++   +A +  ++LAV S  ++ +  N ++A+L    I  YV+
Sbjct: 78  DIDYDMERTRHRPMPSGKVQVRDALIFAIALAVLSFTLLTVFANLLAASLALSGIIFYVL 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIP ++GWA+VTG +S ++ ++F I+FLWTPPHFW+LAL
Sbjct: 138 IYTHWLKRHSTQNIVIGGAAGAIPALVGWAAVTGTLSWSAWLIFAIVFLWTPPHFWALAL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + +DDY K  IPMLP V  +  T   I  YT++T +  +L       + + Y  I   LG
Sbjct: 198 MIRDDYAKVGIPMLPVVEGNAATVKQIWYYTLITVVATLLLVYPLHSSGIVYAAIAISLG 257

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   +WR       +D    ++LFL SI+Y+ +L   +++D L
Sbjct: 258 AVFIRKSWRL--LHNPEDRPTARELFLYSISYMMLLCLGMVIDSL 300


>gi|169235577|ref|YP_001688777.1| protoheme IX farnesyltransferase [Halobacterium salinarum R1]
 gi|205693397|sp|B0R3W4|COXX_HALS3 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|167726643|emb|CAP13429.1| protoheme IX farnesyltransferase [Halobacterium salinarum R1]
          Length = 459

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 151/290 (52%), Gaps = 10/290 (3%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP------GHISVLKSVISIFAIAMGAGASGALN 61
           +  ++ L+KPR+M L    A  G+ LA         +S    V+++    +  GASG  N
Sbjct: 173 VRAYVQLMKPRLMWLLCLVAGAGMALASSQLGAGQQLSAATVVLTLGGGVLSIGASGTFN 232

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              + + D+ MART  RP+   +I P  A   GV L V+S+     A+N ++A L   +I
Sbjct: 233 HVLEREQDEKMARTDDRPVVTDRIPPRNALAFGVVLGVASLAAFA-AVNLLTAVLGLTAI 291

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y ++YT+ LK  T Q+ VIGG AGA+P +IGW +VTG V +  +V+  +IFLWTP HF
Sbjct: 292 AFYSIVYTLVLKPNTRQSTVIGGAAGALPALIGWVAVTGAVGVGGVVLAGVIFLWTPAHF 351

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           ++LAL  KDDY++   P++P V  +  T+ HI+ Y   T    V+   L      Y    
Sbjct: 352 YNLALAYKDDYERGGFPLMPVVEGEAKTRRHIVYYIGATLASAVVLAELTGLGPLYAATT 411

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             LG  F  +A R      ++D R   + F  S  YL  L   +++D ++
Sbjct: 412 VLLGAVFLYFAIRLH---RERDRRAAMRSFHASNAYLGCLLVAVVLDTMV 458


>gi|302381917|ref|YP_003817740.1| protoheme IX farnesyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192545|gb|ADL00117.1| protoheme IX farnesyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 328

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 122/300 (40%), Positives = 171/300 (57%), Gaps = 19/300 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVMSL ++TA  G+V+APG ++     I++  IA+GAGA+GA NM  + D D
Sbjct: 19  DFFQLLKPRVMSLVVFTALTGLVVAPGSVNPFVGAIAVLCIAIGAGAAGAFNMALEGDTD 78

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RP+  G++   +A   GV L+V S++++G+  NW +A LL M+I  Y V YT
Sbjct: 79  ALMRRTRGRPVAAGRLKKNDAMAFGVVLSVFSVMLLGMNTNWFAAGLLLMTILYYAVFYT 138

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           + LKR TPQNIVIGG AGA PP+IGWA+ TG     + ++FLIIFLWTPPH W+LAL   
Sbjct: 139 LMLKRRTPQNIVIGGAAGAFPPVIGWAAATGSAPWQAWLLFLIIFLWTPPHSWALALYST 198

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY KA IPM+P     ++T++ IL+Y+++   + + P   G     Y  +    G  F 
Sbjct: 199 GDYAKAGIPMMPVARGAKSTRLQILLYSLVLVPIAIAPGFTGMGGPVYLAVSIGGGALFL 258

Query: 250 LWAWRTFLCKEDKDI-------------------RVTKKLFLESITYLFVLFTILMVDHL 290
             A R +  +                        +  + LF  SI YL  LF  L+V+ L
Sbjct: 259 ALAVRIWRSRAGDAPDKAEAVGREAALYDVRAEAKPARNLFAFSILYLMALFAALLVESL 318


>gi|327334180|gb|EGE75894.1| protoheme IX farnesyltransferase [Propionibacterium acnes HL097PA1]
          Length = 337

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +  ++ ++      A ++   N   D 
Sbjct: 48  VHAYVALTKPRIIELLLVTTLPVMFLASHGLPKLGLAIATMVGGLFAAASANVFNCVIDV 107

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 108 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILEIIATIILGFGANWLSAGLALIANLFYVF 167

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 168 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVRWEPLVLFFIVFWWTPPHTWALSF 227

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T    ++   +      Y ++    G 
Sbjct: 228 RYREDYEAAGVPMLPVVRDAPEVTIQILIYTVMTVATSLVLWPVAHMGWIYVVVAVASGA 287

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 288 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 337


>gi|270159024|ref|ZP_06187680.1| protoheme IX farnesyltransferase [Legionella longbeachae D-4968]
 gi|289166139|ref|YP_003456277.1| Polyprenyltransferase (cytochrome oxidase assembly factor)
           [Legionella longbeachae NSW150]
 gi|269987363|gb|EEZ93618.1| protoheme IX farnesyltransferase [Legionella longbeachae D-4968]
 gi|288859312|emb|CBJ13247.1| putative Polyprenyltransferase (cytochrome oxidase assembly factor)
           [Legionella longbeachae NSW150]
          Length = 295

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 173/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +I L KPRV+ L + T  VG+ LA PG +++     S+  I + AG++ A+N   D 
Sbjct: 14  WRNYIELCKPRVVLLMLLTVVVGMYLATPGWVNLFLLSASLLGIGLCAGSAAAINHLVDK 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  GQ+S  +A    + +    + ++ + +N ++A L F+++  Y  
Sbjct: 74  RIDAIMARTKKRPVASGQVSVRQALWFALIMGTIGLTVLAVFVNGLTALLTFITLIGYAG 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW SVT  +   +L++ LIIF+WTPPHFW+LA+
Sbjct: 134 IYTGYLKRATPQNIVIGGLAGAAPPLLGWTSVTNQLDPQALLLVLIIFIWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              ++YQ A IPMLP     + TK++I +YT+L  +  VLP ++G + + Y I    LG 
Sbjct: 194 YRYEEYQHAQIPMLPVTHGIQFTKLNIYLYTILLVVASVLPFVIGMSGLFYLIGALVLGA 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  WA++ +    +    +  + F  SI YL +LF  L++DH +
Sbjct: 254 RFLFWAYQLYH---NDKPVIAMQTFRFSIVYLMLLFVFLLIDHYL 295


>gi|2398716|emb|CAB16181.1| cytochrome c oxidase assembly factor [Mycobacterium leprae]
          Length = 289

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 106/288 (36%), Positives = 158/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G  + L  + ++      A  +   N   DADI
Sbjct: 3   AYLALTKPRVIELLLVTAIPAMLLADRGSANPLLILNTLLGGISAAAGANTFNCVADADI 62

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RT+ RP+    + P  A VLG++L   S   +    N +S  L   ++  YV +Y
Sbjct: 63  DKLMKRTSRRPLARAAVPPRNALVLGLALTAGSFFWLWWTTNLLSGLLALATVAFYVFVY 122

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW+++T  +   +L MF IIF WTPPH W+LA+  
Sbjct: 123 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAITDTIGWPALAMFAIIFFWTPPHTWALAMRY 182

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ AS+PMLP V T+R     ILIYT LT++  ++  +       Y  +    G  F
Sbjct: 183 KDDYKVASVPMLPAVATERHVTKQILIYTWLTALSTLVLALA--TGWLYMAVAVVAGAWF 240

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + ++     +     +LFL+S  YL V+F  L VD ++ + T+
Sbjct: 241 LTMAHQLYVGVCAGEPVKPLRLFLQSNNYLAVVFCALAVDSVLALPTL 288


>gi|119475291|ref|ZP_01615644.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2143]
 gi|119451494|gb|EAW32727.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2143]
          Length = 303

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 103/286 (36%), Positives = 162/286 (56%), Gaps = 5/286 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   +  L KP V+ L + T+ +G+ ++ PG + +   ++    I + +     +N   D
Sbjct: 14  RWRDYYELTKPNVVYLMLLTSAIGMFMSVPGIVPLDILILGNLGIGLCSACGAVVNHLVD 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART  RP+  G+IS  +A +    L V+ + I+ +AIN ++A L   S+  Y 
Sbjct: 74  QRIDALMARTNKRPVAQGRISQIQAGIFAAVLGVTGMAILLIAINQLTAWLTLFSLIGYA 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+WLKR TPQNIVIGG+ GA PP++GW SVT ++   +L++ LIIF WTPPHFW+LA
Sbjct: 134 VIYTLWLKRATPQNIVIGGLPGAAPPLLGWTSVTNEIHGHALLLVLIIFAWTPPHFWALA 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  ++DY +A+IPMLP       T +HI++YT +     +LP   G + + Y +    LG
Sbjct: 194 INRREDYARAAIPMLPVTHGVEYTSLHIVLYTFILIAASLLPFATGMSGLLYLVGAVVLG 253

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
                W+ +        +       F  SI YL  ++ I+++DH +
Sbjct: 254 SIHLYWSVQIMR----GNPTAPMATFKFSIIYLMAIYMIMLIDHYV 295


>gi|302533789|ref|ZP_07286131.1| protoheme IX farnesyltransferase [Streptomyces sp. C]
 gi|302442684|gb|EFL14500.1| protoheme IX farnesyltransferase [Streptomyces sp. C]
          Length = 322

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 114/289 (39%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  F+ L KPR++ L + T    + LA  G  S+   + + F   + AG + ALNMY D
Sbjct: 33  RVMAFVALTKPRIIELLLITTVPVMFLAEQGVPSLWLVLATCFGGYLSAGGANALNMYID 92

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT+ RP+  G +SP E  V G+SL V S +  GL INW+SA L   ++  YV
Sbjct: 93  RDIDALMDRTSQRPLVTGMVSPTECLVFGISLGVVSTLFFGLLINWLSAALALGALLFYV 152

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GGIAG +P +IGW++V  +VS A++++FL+IF WTPPH+W L+
Sbjct: 153 VVYTMLLKRRTAQNIVWGGIAGCMPVLIGWSAVKNEVSWAAVILFLVIFFWTPPHYWPLS 212

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY +  +PMLP V  +R     I++Y+ +   V +L T LG+    Y  +    G
Sbjct: 213 MKVKDDYARVGVPMLPVVAGNRAVARQIVLYSWVMVAVSLLLTPLGYTGWFYTSVALLAG 272

Query: 246 YHFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +   A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 273 GWWLWEAHALSARAKAGVTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 321


>gi|256825158|ref|YP_003149118.1| protoheme IX farnesyltransferase [Kytococcus sedentarius DSM 20547]
 gi|256688551|gb|ACV06353.1| protoheme IX farnesyltransferase [Kytococcus sedentarius DSM 20547]
          Length = 312

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 159/290 (54%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +I L KPR++ L + T F  + LA  G  S    + ++    + A ++  LN Y D 
Sbjct: 17  VRAYISLCKPRIIELLLITTFPVMFLAERGVPSWWLVIATLVGGTLSASSANVLNCYLDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT++RP+  GQ+SP  A V G  L V+S++ +GL +NW+SA L F +I  Y  
Sbjct: 77  DIDAKMHRTSNRPLVTGQVSPRAALVFGTVLGVASVLWLGLLVNWLSAALSFGAIVLYAW 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YTI LKR T QNIV GG+AG IP +IGW++VT  +   +LV+F+ +F WTPPH+W L++
Sbjct: 137 FYTIVLKRRTSQNIVWGGLAGCIPVLIGWSAVTNSLDWPALVLFVFVFFWTPPHYWPLSM 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PMLP +  +      I++Y   T +  ++   +G     Y ++    G 
Sbjct: 197 KFREDYANAGVPMLPVLENNIAVGRKIVLYAWATFLTSLVLIPVGPMGWIYTVVAVLSGG 256

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + +            +      +LF  SI+Y+ VLF  + +D L+  
Sbjct: 257 LFVMESHTLLRGARAGLSEAEIKPMRLFHYSISYVSVLFMAVAIDPLLYW 306


>gi|282854712|ref|ZP_06264047.1| protoheme IX farnesyltransferase [Propionibacterium acnes J139]
 gi|282582294|gb|EFB87676.1| protoheme IX farnesyltransferase [Propionibacterium acnes J139]
          Length = 340

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ ++ L KPR++ L + T    + LA   +  +   + ++      A ++   N   D 
Sbjct: 51  VHAYVALTKPRIIELLLVTTLPVMFLASHGVPKLGLVIATMVGGLFAAASANVFNCVIDV 110

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP+P  Q+    A + G+ L + + +I+G   NW+SA L  ++   YV 
Sbjct: 111 DIDQKMRRTRRRPLPRHQVPRRSALIYGIILWIIATIILGFGANWLSAALALIANLFYVF 170

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN + GGIAG  PP+IGW +VTG V    LV+F I+F WTPPH W+L+ 
Sbjct: 171 VYSMLLKRRTWQNTIWGGIAGCFPPLIGWTAVTGSVGWEPLVLFFIVFWWTPPHTWALSF 230

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY+ A +PMLP V       + ILIYTV+T  + ++   +      Y ++    G 
Sbjct: 231 RYREDYEAAGVPMLPVVRDAPEVAIQILIYTVMTVAISLVLWPVAHMGWIYVVVAVVSGA 290

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F + A +            +     LF  S TYL +LF  + VD LI +
Sbjct: 291 VFIVEAAQLLRRANAGLRDALLKPMGLFHWSNTYLSLLFLAIAVDPLIHL 340


>gi|85714204|ref|ZP_01045193.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85714921|ref|ZP_01045907.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85715325|ref|ZP_01046308.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85717126|ref|ZP_01048086.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85696086|gb|EAQ33984.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85697971|gb|EAQ35845.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85698407|gb|EAQ36278.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
 gi|85699330|gb|EAQ37198.1| protoheme IX farnesyltransferase [Nitrobacter sp. Nb-311A]
          Length = 330

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 128/271 (47%), Positives = 178/271 (65%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVMSL I+TA VG+++APGH+  +   ISI  IA+GAGASGALNM  + D
Sbjct: 38  VADYFALLKPRVMSLVIFTALVGLMIAPGHVHPVLGFISILCIAVGAGASGALNMALEGD 97

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G++L+  S++ +G  +NW +  LL  +IF YVVI
Sbjct: 98  IDVLMSRTANRPIPRGRITRGEAMGFGLTLSFFSVMTLGALVNWYAGGLLAFTIFFYVVI 157

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIVIGG AGA+PP++ WA+ TG +S+  L++FLIIF WTPPHFW+LAL 
Sbjct: 158 YTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSMEPLLLFLIIFFWTPPHFWALALF 217

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG+    LG  
Sbjct: 218 RSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWVYGVTSLILGAG 277

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITY 277
             + A + +  +         ++LF  SI Y
Sbjct: 278 MLVLAIQVYRHRTGSQALRATRRLFAFSILY 308


>gi|160899498|ref|YP_001565080.1| protoheme IX farnesyltransferase [Delftia acidovorans SPH-1]
 gi|160365082|gb|ABX36695.1| protoheme IX farnesyltransferase [Delftia acidovorans SPH-1]
          Length = 301

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 166/292 (56%), Gaps = 7/292 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS----VLKSVISIFAIAMGAGASGALN 61
            R   F  L KPRV+ L ++ A +G+VLA          L   ++   I + AGA+ A N
Sbjct: 12  SRWTQFYALTKPRVVQLIVFCALIGMVLAVPGWPNADQWLHMALACLGIWLVAGAAAAFN 71

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RT+ RP   G++S  +A      L     +++ L  N ++  L   + 
Sbjct: 72  CLVERHIDARMKRTSWRPTARGELSSQQALAFSAILCTLGALVLLLCTNPLTMWLTLATF 131

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TG V   +L++FLIIFLWTPPHF
Sbjct: 132 VGYAVIYTVILKPATPQNIVIGGASGAMPPVLGWAAMTGQVGPEALILFLIIFLWTPPHF 191

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+++ +PMLP       T++ IL+YTV+     +LP M G +S  Y ++ 
Sbjct: 192 WALALYRVEDYRQSGLPMLPVTHGSEYTRLQILLYTVILFAACMLPFMYGMSSWLYLVVA 251

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             L   F  +A+  +    D   ++++K F  S+ +L VLF  L++DH + +
Sbjct: 252 VVLSVGFCAYAFALWRNYSD---QLSRKTFRFSLIHLSVLFLALLIDHYLWL 300


>gi|148261156|ref|YP_001235283.1| protoheme IX farnesyltransferase [Acidiphilium cryptum JF-5]
 gi|182637469|sp|A5G0I2|COXX_ACICJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|146402837|gb|ABQ31364.1| protoheme IX farnesyltransferase [Acidiphilium cryptum JF-5]
          Length = 317

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 136/288 (47%), Positives = 187/288 (64%), Gaps = 6/288 (2%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ LLKPRV+ L +YT   G+++APG I+ +    +I  IAM AGA+GA+NM+YD DID
Sbjct: 30  DWLALLKPRVLYLVVYTGAAGLLVAPGGINPILGFTAILCIAMAAGAAGAINMWYDRDID 89

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RTA RPIP G+ISP  A   GV+L+  S+++M LA N ++A LL  SI  YV IYT
Sbjct: 90  AVMRRTAGRPIPTGRISPDGALAYGVALSALSVLLMWLATNLLAAGLLAASIGFYVFIYT 149

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PP+IGWA+ TG V +  +++F IIF WTPPHFW+L+L   
Sbjct: 150 MWLKRRTPQNIVIGGAAGAFPPVIGWAAATGHVGLLPVLLFAIIFFWTPPHFWALSLFAS 209

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DYQKA +PMLP V   + T++ ++ YT+    + +LP +L  A   YG     LG  F 
Sbjct: 210 ADYQKAGVPMLPVVAGQKATRLAVMRYTLWLVPLSLLPYVLHLAGPVYGASAMVLGLAFV 269

Query: 250 LWAWRTFLCKEDKD------IRVTKKLFLESITYLFVLFTILMVDHLI 291
            ++WR    ++D +          K  F  SI YLF++F  L++DHL+
Sbjct: 270 WYSWRVLRDRQDGNGVSLTRDAPAKAAFKFSILYLFLIFGALVLDHLV 317


>gi|99082175|ref|YP_614329.1| protoheme IX farnesyltransferase [Ruegeria sp. TM1040]
 gi|122397649|sp|Q1GE49|COXX_SILST RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|99038455|gb|ABF65067.1| protoheme IX farnesyltransferase [Ruegeria sp. TM1040]
          Length = 313

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 124/288 (43%), Positives = 178/288 (61%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L  +  LLKPRVMSL ++TAFVG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  LGDYFALLKPRVMSLVVFTAFVGLMAAPIGVHPVIGFCAILFIAIGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT  RPIP G++   EA  LG++L+  S++++ LA N  +   L  +IF YVVI
Sbjct: 78  IDQVMKRTKGRPIPAGKVDKGEALSLGLALSGLSVIMLALATNVFAGAFLAFTIFFYVVI 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +S+   +MF + FLWTPPHFW+LAL 
Sbjct: 138 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGSMSVEPWLMFALTFLWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            ++DY  A +PML      R+T+ HIL+YTV+ +   +           Y      L   
Sbjct: 198 MRNDYDMADVPMLTVTHGRRSTRKHILVYTVILAAFALTTAFTSVGGPIYLTTAVVLNAL 257

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   A + +   E+     + ++ +  F  S+ YLF+ F  ++ + L+
Sbjct: 258 FLKGAVQIWRRDEEICESDNFKIERSFFKLSLLYLFLHFGAILAEALL 305


>gi|300692654|ref|YP_003753649.1| protoheme IX farnesyltransferase [Ralstonia solanacearum PSI07]
 gi|299079714|emb|CBJ52391.1| protoheme IX farnesyltransferase [Ralstonia solanacearum PSI07]
          Length = 310

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 105/286 (36%), Positives = 161/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  SQYAALTKPRVTQLAVFCAVIGMFLATPGMVPWPVLIGGAVGIWLFAGAAFAINCLVERK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RTA RP   G++   +  +  + L  + +  +    N ++  L F +   Y +I
Sbjct: 81  IDAMMRRTAWRPSASGELGTRQILLFSLVLGGAGMWTLHAFANDLTMWLTFATFIGYAII 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF WTPPHFW+LAL 
Sbjct: 141 YTLLLKPATPQNIVIGGLSGAMPPALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T +HIL+YT++     +LP + G +   Y  +   LG+ 
Sbjct: 201 RRADYAKSGLPMLPITHGEKFTLLHILLYTLIMVAATILPFVHGMSGYLYLAVALVLGFG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AW+ +    D    + +K F  SI YL +LF  L++DH    
Sbjct: 261 FLAYAWQMYRNYSD---MLAQKTFRYSIVYLSLLFAALLIDHYFKF 303


>gi|332141680|ref|YP_004427418.1| protoheme IX farnesyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|332143395|ref|YP_004429133.1| protoheme IX farnesyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551702|gb|AEA98420.1| protoheme IX farnesyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553417|gb|AEB00136.1| protoheme IX farnesyltransferase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 305

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 114/292 (39%), Positives = 168/292 (57%), Gaps = 4/292 (1%)

Query: 3   FQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALN 61
           +Q      +  + KP V+ L + TA VG+ LA P  +S    +  +  I M + ++  +N
Sbjct: 15  YQQVTWRDYYEMTKPNVVMLLLLTALVGMCLATPTWVSAEVLICGLLGIGMLSASAAVIN 74

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              D  ID +MART +RP+  G++S   A      L V    ++ L +N ++A L   S+
Sbjct: 75  HVVDHKIDSVMARTFNRPVAKGKVSINNALWFAGILGVVGFAVLALFVNMITAWLTLASL 134

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y  IYT++LKR TPQNIVIGG+AGA PP++GW +VTG++   +L++ LIIF WTPPHF
Sbjct: 135 VGYAFIYTMYLKRATPQNIVIGGLAGAAPPLLGWTAVTGEIHAHALLLVLIIFTWTPPHF 194

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LA+  + DY KA +PMLP       TK  +L+YTVL  +V +LP + G + + Y I  
Sbjct: 195 WALAIHREKDYAKAKVPMLPVTHGVSFTKTSVLLYTVLLGLVCLLPYLTGMSDLIYLIGA 254

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             L   F  +A +    K D D +   K F  SI +L VLF +L++DH I +
Sbjct: 255 SILNIGFLYYALKL---KFDADSQTAMKTFRFSIIHLMVLFVVLLLDHYIPL 303


>gi|158313910|ref|YP_001506418.1| protoheme IX farnesyltransferase [Frankia sp. EAN1pec]
 gi|205693316|sp|A8KYS6|COXX_FRASN RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|158109315|gb|ABW11512.1| protoheme IX farnesyltransferase [Frankia sp. EAN1pec]
          Length = 313

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 102/274 (37%), Positives = 151/274 (55%), Gaps = 1/274 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   +I L+K RV+ L + +    ++LA  G  S     +++ A  + AG++  +N Y D
Sbjct: 28  RARSYIALMKLRVVELLLVSTVPVMLLAERGMPSWWLIAVTLLAGTLSAGSANTINCYVD 87

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT  RP+    + P +A   G++L + S ++ GL +NW SA L   +I  YV
Sbjct: 88  RDIDQLMGRTKRRPLVREVVEPAQALRFGIALGIISTLMFGLLVNWTSAVLSVGAIAFYV 147

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +YT+ LKR +P NIVIGG AG  P +IGW++VTG V   ++++F ++F WTPPHFW+LA
Sbjct: 148 FVYTLGLKRRSPSNIVIGGAAGCFPVLIGWSAVTGTVGWPAVLLFAVVFFWTPPHFWALA 207

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY  A +PMLP V T       IL Y+ L   V +    +    + Y +    LG
Sbjct: 208 IRFKDDYAAAGVPMLPVVATLEVVTRRILAYSYLMVAVSLAVAPVADIGLVYLVPAVLLG 267

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLF 279
             F   A R     +  +     +LF  SITYL 
Sbjct: 268 AWFVAEAHRMAARAKRGEEIKPMRLFHMSITYLT 301


>gi|187424069|gb|ACD03844.1| CyoE [Thiobacillus prosperus]
          Length = 328

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 117/288 (40%), Positives = 172/288 (59%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           ++  +  L KPRV++L ++TA VG++LA PG I++   V     I +GA A+ A+N   D
Sbjct: 38  QVQAYYALTKPRVVALILFTAIVGMLLATPGIIAIGTLVFGTLGIGLGAAAAAAVNHVID 97

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             +D  M+RTA RPI  G +  ++       LA+ S+ ++   +N  +A L F+++  Y 
Sbjct: 98  QHMDAKMSRTAWRPIATGGLGTFQGLTFATILALLSMWVLVEWVNVETAVLTFLAMIGYA 157

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT +LKR TPQNIV GG AGA+PP++GW +V+G VS  S+V+F IIF WTPPHFW+LA
Sbjct: 158 VIYTGFLKRTTPQNIVWGGAAGAVPPVLGWCAVSGHVSYESIVLFSIIFFWTPPHFWALA 217

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  KDDY KA IPMLP    +  T+  IL+YTV+  +V +LP ++G A   Y        
Sbjct: 218 LHYKDDYAKAKIPMLPVTHGEEHTQTQILVYTVILVLVTLLPFIMGHAGWLYLAGAAACN 277

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F  +A +    K  +      ++F  SI YL  +F+ L++DH   +
Sbjct: 278 VGFLGYAVKL---KFRRKPHTAIRMFAFSIVYLMGIFSALLIDHYFTI 322


>gi|254439740|ref|ZP_05053234.1| protoheme IX farnesyltransferase [Octadecabacter antarcticus 307]
 gi|198255186|gb|EDY79500.1| protoheme IX farnesyltransferase [Octadecabacter antarcticus 307]
          Length = 313

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 127/286 (44%), Positives = 177/286 (61%), Gaps = 4/286 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  L+KPRVM L ++TA VG+V+AP  ++     +++  IA+GAGASGALNM++DADID
Sbjct: 17  DYFALMKPRVMQLVVFTALVGLVVAPVGVNPFIGFVAVLCIAVGAGASGALNMWWDADID 76

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT +RPIP G + P EA  +G++L+  +IV++ LA N ++A LL  +IF Y V+Y+
Sbjct: 77  AIMKRTVNRPIPSGAVQPGEALAIGLTLSGFAIVLLFLATNALAAGLLAFTIFFYAVVYS 136

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGWA  T  VS+ S++MF +IF+WTPPHFW+LAL  K
Sbjct: 137 MWLKRSTPQNIVIGGAAGAFPPMIGWAVATSGVSVESVLMFALIFMWTPPHFWALALFVK 196

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY  A +PML        T+ HIL Y V    V +           Y ++   L   F 
Sbjct: 197 SDYGDAGVPMLTETHGRTVTRKHILTYCVPLVAVALWLGFTSIGGPFYLVVAVVLNVWFL 256

Query: 250 LWAWRTFLC----KEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              +  +       E  +  V ++ F+ SI YLF  F  L+V+ L+
Sbjct: 257 RGCYAIWRRTDADSEADNHAVERRTFVVSIYYLFGHFGALLVEALL 302


>gi|257058167|ref|YP_003136055.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 8802]
 gi|256588333|gb|ACU99219.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 8802]
          Length = 323

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 163/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G + +    I++    + A A+  +N  YD 
Sbjct: 17  VKSYYQLTKPRIIPLLLITTAAAMWIASEGRVDLFTLFITLIGGTLAAAAAQVMNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++    A++  V LA+ S  +  L +N +S  L    I  Y++
Sbjct: 77  DIDYEMLRTRARPIPSGRVQSRHAFIFAVILAILSFSLFALFVNLLSGLLAMSGIVFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT  LKR +PQNIVIGG AG+IPP++GWA+VTGD+  A  ++F IIFLWTPPHFW+LAL
Sbjct: 137 VYTHLLKRNSPQNIVIGGAAGSIPPLVGWAAVTGDLGWAPWILFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + KDDY + ++PM+P V  + +T   I  YT+L      L     G +   YG I   LG
Sbjct: 197 MIKDDYAQVNVPMMPVVEGEESTVRQIWWYTLLMIPCTFLLVYPLGVSGAVYGGIAIVLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+    +   D  + + LF  SI YL +L T +++D L
Sbjct: 257 AMFIQKAWQL--KQAPFDQVLARSLFKFSIFYLMLLCTAMVIDSL 299


>gi|182641978|sp|Q6LVR2|CYOE_PHOPR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 316

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 161/285 (56%), Gaps = 5/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ + KP+V+++ + TA VG+ LA PG       ++ +  I   + A+ A N   D 
Sbjct: 31  WRDYLTMTKPKVVAMLLLTALVGMCLAVPGIPPAKAVILGLIGIGFQSAAAAAFNHVLDR 90

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            +D  MART +RP+  G+I  W+A V   +L V   VI+      ++A L   S+  Y V
Sbjct: 91  RLDTQMARTYNRPLAKGRIETWKAVVFASTLMVMGFVILLELNA-LTAWLTMASLVGYAV 149

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLK  TPQNIVIGGIAGA PP++GW +VTG +   +L++ +++F WTPPHFW+LA+
Sbjct: 150 VYTVWLKHATPQNIVIGGIAGAAPPLLGWTAVTGQLDPHALLLVMLVFTWTPPHFWALAI 209

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY KA IPMLP       TK  +L+YTV+  IVG+LP + G +   Y +    L  
Sbjct: 210 HRRDDYAKAGIPMLPVTHGIEFTKTMVLLYTVMLFIVGLLPWLTGMSGGVYLVGSSLLNL 269

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A +    K           F  SI +L  LF +L+ DH I
Sbjct: 270 GFIGYALKL---KFADSKGHAWATFKYSIWHLLALFVVLLGDHWI 311


>gi|307154860|ref|YP_003890244.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 7822]
 gi|306985088|gb|ADN16969.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 7822]
          Length = 323

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 114/285 (40%), Positives = 169/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  + +L KPR++ L + T    + +A  G +  L   +++    + A ++  LN  YD 
Sbjct: 17  IKSYYLLTKPRIIPLLLITTAAAMWIASHGQVDPLLLFVTLLGGTLAAASAQTLNCIYDQ 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++ P  A +  + LAV S  +  + +N  SA L    I  Y++
Sbjct: 77  DIDYAMLRTRARPIPSGRVRPLHALIFAIILAVLSFTLFVVFVNMASALLAMSGIAFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT  LKR +PQNIVIGG AG+IPP++GWA+VTG++S A+  +F IIFLWTPPHFW+LAL
Sbjct: 137 IYTHMLKRHSPQNIVIGGAAGSIPPLVGWAAVTGELSWAAWALFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVG-VLPTMLGFASVTYGIIVFFLG 245
           + KDDY + ++PM+P V  + +T   I IYT++      VL   L  + V Y +I   LG
Sbjct: 197 MIKDDYAQVNVPMMPVVEGEESTVRQIWIYTLIVVPFSLVLVYPLAASGVIYTLIALLLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+    +   D ++ + LF  SI Y+ +L T ++VD L
Sbjct: 257 GIFIYKAWQL--KQNPHDNQLARSLFKYSILYMMLLCTGMVVDSL 299


>gi|269795296|ref|YP_003314751.1| protoheme IX farnesyltransferase [Sanguibacter keddieii DSM 10542]
 gi|269097481|gb|ACZ21917.1| protoheme IX farnesyltransferase [Sanguibacter keddieii DSM 10542]
          Length = 294

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 111/290 (38%), Positives = 157/290 (54%), Gaps = 3/290 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  ++ L KPRV+ L + T    ++LA  G  S+   + ++   A  AGASG LN Y D
Sbjct: 5   RIGAYVALTKPRVIELLLVTTIPTMMLAERGFPSLWLVLATLVGGAGAAGASGVLNCYLD 64

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT  RPI  G++SP  A + G+ L   S+    + +N  SA L   +I  YV
Sbjct: 65  RDIDEVMNRTKRRPIVTGEVSPRNALIFGLVLGAVSLAWFAVFVNMASALLTAAAIAIYV 124

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V YT+ LKR TPQNIV GGIAG +P  IGW++VTG +S  ++ +FL+IF WTPPH+W L+
Sbjct: 125 VGYTMILKRRTPQNIVWGGIAGCMPVFIGWSAVTGGLSWGAVALFLVIFFWTPPHYWPLS 184

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  + DY  A +PMLP V  D      ++IYTV      +    L   +  Y ++   LG
Sbjct: 185 MKFRRDYADAGVPMLPVVADDLKVAREMIIYTVAMIACSLALVPLEGMTWVYAVVASLLG 244

Query: 246 YHFTLWAWRTFLCKEDKDIRV--TKKLFLESITYLFVLFTILMVDHLIDM 293
             F       +    D         K+F  SITYL +LF  + VD  +  
Sbjct: 245 AWFLGQCIGMYRRAADPSRGKLGAMKVFHGSITYLTLLFVAVAVDVFLPF 294


>gi|205696364|sp|A8LHT6|COXX_DINSH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 315

 Score =  152 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 131/296 (44%), Positives = 183/296 (61%), Gaps = 4/296 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TA VG+++AP  +  +    +I  IA+GAGASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTALVGLLVAPVSLHPMVGFCAILFIAVGAGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP+P G++ P EA  LG+ L+  S+V++ LA N ++A LL  +IF Y V+
Sbjct: 78  IDVIMKRTAGRPVPAGKVQPGEALALGLGLSGLSVVMLALATNLLAAGLLAFTIFFYAVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR TPQNIVIGG AGA PPMIGW + TG VS+ +++MF +IF+WTPPHFW+LAL 
Sbjct: 138 YSMWLKRSTPQNIVIGGAAGAFPPMIGWVAATGSVSLEAVLMFALIFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PML      ++T+ HIL+YTVL   V +   +   A   Y      L   
Sbjct: 198 MKSDYHDAGVPMLTVTHGRKSTRTHILVYTVLLVPVALGLALTPVAGPLYLATALVLNAI 257

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERY 299
           F   AW  +       E       K+ F  S+ YL + FT L+ + ++    +  +
Sbjct: 258 FLKGAWDIWRRDEAQAEADKYATEKRFFKFSLLYLALHFTALLAEAILTRSGLWTF 313


>gi|307293622|ref|ZP_07573466.1| protoheme IX farnesyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879773|gb|EFN10990.1| protoheme IX farnesyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 306

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 128/286 (44%), Positives = 178/286 (62%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F+ L KPRVM+L ++T   G++ APGHI  +    +I  IA+GAGA+ ALN +Y+AD
Sbjct: 19  WRDFVALTKPRVMTLVVFTGLCGLLAAPGHIHPVLGFTAILCIALGAGAAAALNQWYEAD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RP+P G++    A   GV L+  S+++MG+A NW++A +L +SI  YV I
Sbjct: 79  IDAKMKRTANRPLPAGRMDRQSALHFGVGLSFFSVLLMGVATNWLAAAVLAVSILFYVFI 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLK  T QNIVIGG AGA PP+IGWA+VTGD+    + +F++IF WTPPHFW+LAL 
Sbjct: 139 YTIWLKPRTAQNIVIGGAAGAFPPVIGWAAVTGDIGALPVALFMLIFFWTPPHFWALALF 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A IPMLP V  +  T+  I  YT + ++  + P +L      YG         
Sbjct: 199 VKTDYAAAGIPMLPVVSGEVATRRQIWFYTAIMAVAAMAPVLLRLTGPIYGTTALLGTAL 258

Query: 248 FTLWAWRTFLCKEDKDIRVT--KKLFLESITYLFVLFTILMVDHLI 291
           F   A++    +E    R+   ++LF  SI YLF+LF  ++VD  +
Sbjct: 259 FVAMAFQVLRRRESDPARMAPERRLFKYSILYLFLLFGAVVVDRWV 304


>gi|313126929|ref|YP_004037199.1| protoheme ix farnesyltransferase [Halogeometricum borinquense DSM
           11551]
 gi|312293294|gb|ADQ67754.1| protoheme IX farnesyltransferase [Halogeometricum borinquense DSM
           11551]
          Length = 468

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 93/284 (32%), Positives = 143/284 (50%), Gaps = 7/284 (2%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
            +  L+KPR+M L    A  G+ LA      ++    + ++    +  GASG  N   + 
Sbjct: 187 AYFRLMKPRLMWLLCLVASAGMALAATTSTGLTPEIVLATLGGGVLSIGASGTFNHVLER 246

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT+ RP+ +  +    A   G+ LA +S+  +   +N ++A L   +I  Y V
Sbjct: 247 DIDRRMERTSDRPLAVDLVPVRHAVAFGLVLAAASV-ALFAWVNTLAAVLGVGAILFYSV 305

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LK  T QN VIGG AGA+P +IGW +VTG++    L++  +IFLWTP HF++LAL
Sbjct: 306 VYTLILKPNTVQNTVIGGAAGALPALIGWVAVTGEIGFGGLLLAAVIFLWTPAHFYNLAL 365

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY +   PM+P V  +  T+ H L Y   T I       +    V Y +     G 
Sbjct: 366 AYKDDYARGGFPMMPVVRGETETRKHTLWYLGATLIAAGALAAMEALGVVYALTSVVFGA 425

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
            F  +  +      ++      + F  S  YL +L   ++VD L
Sbjct: 426 VFLYFVVQLHY---EQTESAAFRAFHASNAYLGMLLLAVVVDTL 466


>gi|218245141|ref|YP_002370512.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 8801]
 gi|226709216|sp|B7K336|COXX_CYAP8 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|218165619|gb|ACK64356.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 8801]
          Length = 323

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 163/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G + +    I++    + A A+  +N  YD 
Sbjct: 17  VKSYYQLTKPRIIPLLLITTAAAMWIASEGRVDLFTLFITLIGGTLAAAAAQVMNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++    A++  V LA+ S  +  L +N +S  L    I  Y++
Sbjct: 77  DIDYEMLRTRARPIPSGRVQSRHAFIFAVILAILSFSLFALFVNLLSGLLAMSGIVFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT  LKR +PQNIVIGG AG+IPP++GWA+VTGD+  A  ++F IIFLWTPPHFW+LAL
Sbjct: 137 VYTHLLKRNSPQNIVIGGAAGSIPPLVGWAAVTGDLGWAPWILFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + KDDY + ++PM+P V  + +T   I  YT+L      L     G +   YG I   LG
Sbjct: 197 MIKDDYAQVNVPMMPVVEGEESTVRQIWWYTLLMIPCTFLLVYPLGVSGAVYGGIAIILG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+    +   D  + + LF  SI YL +L T +++D L
Sbjct: 257 AMFIQKAWQL--KQAPFDQVLARSLFKFSIFYLMLLCTAMVIDSL 299


>gi|167648459|ref|YP_001686122.1| protoheme IX farnesyltransferase [Caulobacter sp. K31]
 gi|205693208|sp|B0T0X6|COXX_CAUSK RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|167350889|gb|ABZ73624.1| protoheme IX farnesyltransferase [Caulobacter sp. K31]
          Length = 345

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 121/252 (48%), Positives = 163/252 (64%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           R   +  L+KPRVMSL ++TA  G++ A   I  L   +++  IA+GAGASGALNM+YDA
Sbjct: 21  RWQDYFQLMKPRVMSLVVFTALTGLLAARTPIHPLLGAVAVLCIAIGAGASGALNMWYDA 80

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P+G +   EA  LGV L++ S+++MG+AINW++A LL  +I  Y V
Sbjct: 81  DIDAKMRRTRGRPVPMGLVKGEEAATLGVVLSLLSVMLMGMAINWLAAGLLAFTIVFYAV 140

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR+T QNIVIGG+AGA+PP IGWA+ TG   + + +M LIIFLWTPPHFW+L+L
Sbjct: 141 VYTMWLKRWTAQNIVIGGLAGALPPAIGWAAATGHAPLNAWLMVLIIFLWTPPHFWALSL 200

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA +PMLP V   + T+  IL+Y++    V + P   G     Y  +    G 
Sbjct: 201 YISTDYAKAGVPMLPVVKGAKETRKQILLYSLALIPVCLAPAFTGLGGWLYLAVSGLGGL 260

Query: 247 HFTLWAWRTFLC 258
            F   A R F  
Sbjct: 261 VFLTLAVRVFRS 272


>gi|254506026|ref|ZP_05118171.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus 16]
 gi|219551249|gb|EED28229.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus 16]
          Length = 298

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 113/286 (39%), Positives = 173/286 (60%), Gaps = 4/286 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
             + ++ L KP+V++L + T  VG+ LA P  + + ++   +  IA+ AG++ A N   D
Sbjct: 15  NWHVYLTLTKPKVVALMLLTTLVGMCLAVPDALPLQQASFGLIGIALMAGSAAAYNHLID 74

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART  RP+P G I      +   S+ +   VI+   +N ++A L F S+  Y 
Sbjct: 75  RRIDSIMARTYKRPLPSGDIKASHVMMFATSIGLIGFVILYALVNPLTAWLTFASLVGYA 134

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA
Sbjct: 135 VIYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWALA 194

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K+DY KA IPMLP       TK  IL+YT+L ++V ++P ++G +   Y I   FL 
Sbjct: 195 VHRKEDYAKADIPMLPVTHGVEYTKTSILLYTILLALVCLMPALVGMSGTIYWIGSVFLS 254

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F  +AW+    K + +     + F  SI +L  LF +L+ DH +
Sbjct: 255 LGFIGYAWKL---KFNPNEGSAIETFKFSIYHLMTLFVLLLFDHYL 297


>gi|323492217|ref|ZP_08097375.1| Protoheme IX farnesyltransferase [Vibrio brasiliensis LMG 20546]
 gi|323313530|gb|EGA66636.1| Protoheme IX farnesyltransferase [Vibrio brasiliensis LMG 20546]
          Length = 298

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 171/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA PG +    +++ +  I + AG++ A N   D 
Sbjct: 16  WRSYLALTKPKVVALMLLTALVGMCLAVPGTLPATYTILGLTGIGLMAGSAAAFNHLIDQ 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+P G+I     ++  +++ V    ++   +N ++A L F S+  Y V
Sbjct: 76  RIDAIMARTYQRPLPSGEIKSSHVFMFALAIGVVGFAVLYAGVNALTAWLTFASLLGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 136 VYTLYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWALAI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY KA IPMLP       TK  IL+YT+L  ++ +LP ++  A V Y      L  
Sbjct: 196 HRKEDYAKADIPMLPVTHGVEYTKTSILLYTILLFLICLLPVLVEMAGVFYLTASSILCS 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW+    K         K F+ SI +L +LF  L++DH +
Sbjct: 256 MFVWHAWKL---KFSDQPSRAIKTFVFSIYHLMLLFVALLIDHYL 297


>gi|114798218|ref|YP_759762.1| protoheme IX farnesyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|123028216|sp|Q0C3D1|COXX_HYPNA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|114738392|gb|ABI76517.1| protoheme IX farnesyltransferase [Hyphomonas neptunium ATCC 15444]
          Length = 318

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 128/296 (43%), Positives = 187/296 (63%), Gaps = 10/296 (3%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGH----ISVLKSVISIFAIAMGAGASGALNMYYD 65
            ++ L+KPR+M L ++TA  G+  A G     +    + I++ A+A+G+GA+GA+NM+YD
Sbjct: 18  DYVNLMKPRIMMLVVFTAVAGLAAASGMTGITMHPAMAAIAVLAVALGSGAAGAINMWYD 77

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           ADID +M+RT++RPIP G +   EA  +G+ ++  S+++M LA NW++A LL  SIF Y 
Sbjct: 78  ADIDAIMSRTSTRPIPSGAVPKEEALTMGLIMSGVSVMLMWLASNWLAAALLAFSIFYYG 137

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+WLKR TPQNIVIGG AGA PP+IGWA+VTG+  + + ++F IIF WTPPHFW+L+
Sbjct: 138 VIYTMWLKRATPQNIVIGGGAGAFPPVIGWAAVTGNTPLDAWILFAIIFFWTPPHFWALS 197

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           LL   +Y K S+PMLP     + T+  IL+YT++   V + P   G     YG +   LG
Sbjct: 198 LLAHKEYAKVSVPMLPVTHGAKATRFQILVYTLVLIPVSLAPLATGLGGWIYGAVAGGLG 257

Query: 246 YHFTLWAWRTFLCKEDK------DIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
             F  +A      K         D+++ +  FL SI YLF LF  ++V+H   +  
Sbjct: 258 LVFLAYAVAILRSKAGDDGAPAGDMKLARTAFLFSILYLFALFGAVLVEHAAGLHF 313


>gi|260220131|emb|CBA27363.1| Protoheme IX farnesyltransferase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 305

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 111/288 (38%), Positives = 166/288 (57%), Gaps = 7/288 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALNMY 63
           L  F  L KPRV+ L ++ A +G+VLA    P    V+ + I+   I + AGA+ A N  
Sbjct: 20  LAQFHALTKPRVIQLIVFCALIGMVLAVPGAPTGAQVMLAAIACLGIYLVAGAAAAFNCI 79

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            +  ID  M RT+ RP   G++S  +  +    L  +   I+ + +N ++  L F +   
Sbjct: 80  VEKGIDAKMKRTSWRPTARGELSDTQTLIFSAMLCAAGSAILYVWVNPLTMWLTFATFVG 139

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TGDV   +L++FLIIFLWTPPHFW+
Sbjct: 140 YAVIYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGDVGPEALILFLIIFLWTPPHFWA 199

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL   +DY+K+ +PMLP       T++ IL+YT +     +LP + G +   Y I+   
Sbjct: 200 LALYRVEDYRKSGLPMLPVTHGSEFTRLQILLYTFMLLAACLLPFVYGMSHWPYLIVAVA 259

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F  +A R      D+   + +  F  S+ +L VLF  L++DH +
Sbjct: 260 LCLGFCWYAVRLLRNYSDE---LARATFRFSLIHLSVLFAALLLDHYL 304


>gi|257068692|ref|YP_003154947.1| protoheme IX farnesyltransferase [Brachybacterium faecium DSM 4810]
 gi|256559510|gb|ACU85357.1| protoheme IX farnesyltransferase [Brachybacterium faecium DSM 4810]
          Length = 294

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 107/290 (36%), Positives = 153/290 (52%), Gaps = 4/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    + LA G        + ++    + AG + ALNMY D 
Sbjct: 5   VRGYVALTKPRIIELLLITTIPTMFLAAGGFPSPWLILTTMIGGYLAAGGANALNMYLDR 64

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+  G+ISP    + G+ L++ S + +GL +NW+SA L   +I  YVV
Sbjct: 65  DIDAKMKRTKRRPLVTGEISPRAGLIFGIVLSIVSALWLGLLVNWMSAALAAGAILLYVV 124

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT+ LKR T QNIV GGIAG +P +IGW++VTG VS  ++++FL+IF WTPPH+W LA 
Sbjct: 125 FYTMILKRRTSQNIVWGGIAGCMPVLIGWSAVTGTVSWTAVLLFLVIFFWTPPHYWPLAE 184

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY  A +PMLP V +       ++++T L     +    LG     YG      G 
Sbjct: 185 KFSKDYADAGVPMLPVVASRTNVARQMIMHTALMVAASLAIIPLGQTGWVYGAGAVASGL 244

Query: 247 HFTLWAWRTFLCKEDKDIRVT---KKLFLESITYLFVLFTILMVDHLIDM 293
            F     R  +               +F  SITYL VLF  L +D  + +
Sbjct: 245 WFGFLVVRYAVRVHRGLTGKALGPMAVFHGSITYLTVLFVALAIDPFVTL 294


>gi|119471373|ref|ZP_01613845.1| Polyprenyltransferase [Alteromonadales bacterium TW-7]
 gi|119445649|gb|EAW26933.1| Polyprenyltransferase [Alteromonadales bacterium TW-7]
          Length = 309

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ + K +V+++ + TA+VG+ LAP     +   +IS+  I + + A+  +N   D+
Sbjct: 26  LQDYLAISKFKVVAMLVLTAWVGLALAPDVGRGIGVQMISLLGIGLLSAAAAVINHVVDS 85

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  MART  RP+  G++S   A     S+ ++  +++ +  N ++A L   ++  Y  
Sbjct: 86  EIDSKMARTRHRPVAKGRLSKTHALTFAASIGIAGFIMLMVWANTLTAILTLFALVGYAF 145

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA+PP++GW S T  ++ A  ++ +IIF WTPPHFW+LA+
Sbjct: 146 IYTSFLKRATPQNIVIGGLAGAMPPLLGWVSETNQMAAAPWLLVMIIFTWTPPHFWALAI 205

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY++A IPMLP        K  ++ Y+VL ++V V+P ++G +   Y +    L  
Sbjct: 206 ARKSDYERAKIPMLPVTHGIDFCKTCVVAYSVLLALVCVMPYLIGMSGGIYLVGACALNS 265

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A +      +        LF  SI +L VLF IL +D  + +
Sbjct: 266 VFMYKAIKLKFAANND---KAMDLFRFSIVHLMVLFVILFIDKWLPL 309


>gi|256832497|ref|YP_003161224.1| protoheme IX farnesyltransferase [Jonesia denitrificans DSM 20603]
 gi|256686028|gb|ACV08921.1| protoheme IX farnesyltransferase [Jonesia denitrificans DSM 20603]
          Length = 332

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 108/295 (36%), Positives = 160/295 (54%), Gaps = 4/295 (1%)

Query: 3   FQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVI-SIFAIAMGAGASGALN 61
           F   +   ++ L KPRV+ L + T F  ++LA G +  L  V+ ++   A+ AGA+G LN
Sbjct: 38  FLAMKAGAYLALTKPRVIELLLVTTFPSMILAQGGLPNLVLVLHTLIGGALAAGAAGVLN 97

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
            Y D DID++M RT  RP+  G++SP EA V G  L   S+    + ++  +A L   +I
Sbjct: 98  CYIDRDIDEVMNRTKRRPLVTGEVSPREALVFGWVLTAISLAWFAVFVHIQAALLTAGAI 157

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             YVV YTI LKR T QNIV GG+AG +P  IGW++VT  +S  ++++FL+IF WTPPH+
Sbjct: 158 AIYVVGYTIILKRRTAQNIVWGGLAGCMPVFIGWSAVTETLSWGAVMLFLVIFFWTPPHY 217

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML--GFASVTYGI 239
           W L++  K DY  A +PMLP V   R     ++ YT+   I  +          +  Y +
Sbjct: 218 WPLSMKFKRDYANAGVPMLPVVAGTRRVAFEMIAYTIAMIIASLGVWFFERDKMTWVYPV 277

Query: 240 IVFFLGYHFTLWAWRTFLCKEDKDIRV-TKKLFLESITYLFVLFTILMVDHLIDM 293
           +   LG  F       +        +V   K+F  SITYL +LF  + VD  + +
Sbjct: 278 VALALGVWFLWMCIDMYRKARSGARKVGEMKVFHGSITYLTLLFVAVAVDVFLPL 332


>gi|163748818|ref|ZP_02156070.1| protoheme IX farnesyltransferase [Shewanella benthica KT99]
 gi|161331592|gb|EDQ02397.1| protoheme IX farnesyltransferase [Shewanella benthica KT99]
          Length = 304

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 115/286 (40%), Positives = 173/286 (60%), Gaps = 4/286 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   +  + KP+V++L + T  VG+ LA PG + +   +I +  I M AGA+ A N   D
Sbjct: 20  QWRAYYEMTKPKVVALMLLTVLVGMCLAVPGAVPLQALIIGMLGIGMMAGAAAAFNHLID 79

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART +RP+P G+IS  +A    +SLA+    ++   +N ++A L F S+  Y 
Sbjct: 80  RRIDGLMARTYNRPLPKGRISITKALTFSISLALLGFTLLYTLVNELTAWLTFASLVGYA 139

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT +LKR TPQNIV+GG+AGA+PP++GW ++TG+    +L++ +IIF WTPPHFW+LA
Sbjct: 140 IIYTAYLKRATPQNIVVGGLAGAMPPLLGWTAITGEFHGNALLLVIIIFTWTPPHFWALA 199

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KD+Y K  IPMLP       TK  IL+YT+L +I  +LP ++G     Y +    L 
Sbjct: 200 IHRKDEYAKVDIPMLPVTHGVEFTKTCILLYTLLLAIACLLPVIVGMCGPIYLVGSTILS 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F   AW     K D    +  ++F  SI +L +LF +L+VDH +
Sbjct: 260 CGFIYKAWEL---KYDDKPGLAMQVFRFSIYHLMILFIVLLVDHYL 302


>gi|76801866|ref|YP_326874.1| heme O oxidase N-terminal domain-containing protein [Natronomonas
           pharaonis DSM 2160]
 gi|121695518|sp|Q3IRC9|COXX1_NATPD RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|76557731|emb|CAI49314.1| heme O oxidase N-terminal domain homolog / protoheme IX
           farnesyltransferase [Natronomonas pharaonis DSM 2160]
          Length = 454

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 138/282 (48%), Gaps = 5/282 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  L KPR+M L    A  G+V+A G  +V   V ++    +  GASG  N   + DI
Sbjct: 176 RAYFELTKPRLMWLLCLVAGAGMVIA-GTPTVRTVVFTLGGGVLAIGASGTFNHVLERDI 234

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D+ M RT+ RPI   ++    A   G  LAV+S+          +A     +I  Y V+Y
Sbjct: 235 DRRMERTSDRPIATHEVPVANALAFGGLLAVASLWAFLSVNLLAAAL-GLAAIAFYSVVY 293

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LK  T QN VIGG AGA+P +IG+A+VTG + I  LV+  +IFLWTP HF++LAL  
Sbjct: 294 TLILKPNTVQNTVIGGAAGALPALIGYAAVTGTIGIGGLVLAAVIFLWTPAHFYNLALAY 353

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY++   PM+P V  +  T+ HI+ Y   T +       +      Y          F
Sbjct: 354 KDDYERGGFPMMPVVRGETETRKHIVFYLGATLLGAGALAAVTDLGWLYAATAVLAAGVF 413

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
                     + D+      + F  S  YL ++   +++D L
Sbjct: 414 LWAVVELHYEQTDR---AAFRSFHASNAYLGLVLVAILIDSL 452


>gi|294084687|ref|YP_003551445.1| putative protoheme IX farnesyltransferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664260|gb|ADE39361.1| putative protoheme IX farnesyltransferase (heme o synthase)
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 306

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 149/284 (52%), Positives = 198/284 (69%), Gaps = 3/284 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  F  LLKPRVMSL I+T F G+ LAPG +  L   IS+FAIA GAGASGA+N +YD D
Sbjct: 21  VGDFWALLKPRVMSLVIFTGFAGMYLAPGTLHPLVFGISLFAIAAGAGASGAINQWYDRD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RT SRPIP G + P EA  LG+ ++  S++++GLA NW++A LL  +IF Y VI
Sbjct: 81  IDAVMSRTKSRPIPAGVMIPAEALTLGLVVSAFSVLLLGLAANWLAAGLLAFTIFFYAVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA+PP+IGWA+VTG VSI  +++F IIF+WTPPHFW+LAL+
Sbjct: 141 YTVWLKRSTPQNIVIGGAAGALPPVIGWAAVTGGVSIEPILLFAIIFIWTPPHFWALALV 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY+ A +PMLP V  +  T+  ILIY VL + + V+P+ +G AS  YG      G  
Sbjct: 201 KNDDYKAAGVPMLPVVAGEDETRKQILIYAVLLAPLAVIPSFIGMASWVYGAFAAVAGAI 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   +WR +  K +    +  +LF  SI YLF++F  L++DH +
Sbjct: 261 FIAMSWRIWASKSN---VLAMRLFAYSIIYLFLIFLGLVLDHFV 301


>gi|158299520|ref|XP_319631.4| AGAP008884-PA [Anopheles gambiae str. PEST]
 gi|157013557|gb|EAA14890.4| AGAP008884-PA [Anopheles gambiae str. PEST]
          Length = 488

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/268 (25%), Positives = 128/268 (47%), Gaps = 6/268 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +++L K R+ SL + TA  G  +APG   +   ++      + +GA+ ++N   +  
Sbjct: 125 IYHYLMLSKIRLTSLVVMTAMAGYAMAPGSFELGTFLLCSAGTTLVSGAANSINQVIETS 184

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M RT +R +  G +S   A    +  +     ++   +N ++A L   ++  Y  I
Sbjct: 185 FDAQMPRTRNRVLVKGHLSRLHAVGFALGASTIGCSMLYYGVNEMTAALGAANLILYTSI 244

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVT-GDVSIASLVMFLIIFLWTPPHFWSLAL 186
           YT  +KR++  N  +G + GAIPP++GWA+ T GD+   + ++  +++ W  PHF +L+ 
Sbjct: 245 YTP-MKRYSILNTWVGSVVGAIPPLMGWAACTGGDLGAGAWILAGLLYCWQFPHFNALSW 303

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + +Y KA   M+ N           L +T   + + +L   L   +V + +    L  
Sbjct: 304 NIRPEYLKAGYKMMANS-HPALCTRVSLRHTGFIAGLSLLAPALDVTNVWFALESLPLNA 362

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLES 274
           +F   A+      +  D + ++KLF  S
Sbjct: 363 YFAYLAYDFH---QKADSKSSRKLFRFS 387


>gi|149186004|ref|ZP_01864319.1| heme O synthase [Erythrobacter sp. SD-21]
 gi|148830565|gb|EDL49001.1| heme O synthase [Erythrobacter sp. SD-21]
          Length = 307

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 132/289 (45%), Positives = 186/289 (64%), Gaps = 2/289 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  L KP VM L I+T   G++ APG+I  +    +I  IA+GAG + ALN ++++D
Sbjct: 15  WRDFFALTKPGVMRLVIFTGLCGLLAAPGNIHPILGFTAILCIALGAGGAAALNQWWESD 74

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT++RP+P G++   EA   G+ ++ +S+VIMGLAINW+SA +L  SIF Y VI
Sbjct: 75  IDAIMKRTSARPLPAGRMKRTEARDFGLFISGASVVIMGLAINWLSAAILAFSIFYYAVI 134

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLK  TPQNIVIGG AGA PP+IGW +VTGD+++  +++FLIIF+WTPPHFW+LAL 
Sbjct: 135 YTIWLKPRTPQNIVIGGGAGAFPPLIGWVAVTGDITLMPVLLFLIIFMWTPPHFWALALF 194

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY KA IPM+P V   R+T+  +++Y++L     + P  +G     YG+    L   
Sbjct: 195 VETDYAKAGIPMMPVVKGHRSTRRQVMVYSLLMLPTVLAPWAIGGTGWIYGVTALALTLL 254

Query: 248 FTLWAWRTFLCK--EDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
           F             E   +R  K+LFL SI YLF+LF  L+VD ++  +
Sbjct: 255 FIALTVPVATRDPAEGDAMRAEKRLFLYSIAYLFILFGALVVDRVLHYQ 303


>gi|330469148|ref|YP_004406891.1| protoheme IX farnesyltransferase [Verrucosispora maris AB-18-032]
 gi|328812119|gb|AEB46291.1| protoheme IX farnesyltransferase [Verrucosispora maris AB-18-032]
          Length = 318

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 99/276 (35%), Positives = 151/276 (54%), Gaps = 2/276 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    ++LA G   S+    + +   ++ AGA+  LN Y D 
Sbjct: 35  VAAYVSLTKPRIVELLLVTTVPAMMLAHGGLPSLWLVAVVLVGGSLAAGAASVLNCYIDR 94

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+P   ++P  A + G+ LAV S+V+M    N ++A L   +I  Y +
Sbjct: 95  DIDQVMRRTKRRPLPAHTVTPRNALIFGLVLAVVSVVLMAAFTNLLAAGLTLAAIVYYDL 154

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR T  N   GG  GA P +IGWA+VTG +S  +  +F ++F W  PHF+ LA+
Sbjct: 155 VYTLWLKRTTTANTFWGGACGAAPVLIGWAAVTGSLSPVAWALFAVVFFWQMPHFYPLAM 214

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY +A IPMLP V + R     I+ +  LT +  +    LG  S  YG+    +G 
Sbjct: 215 KYKDDYARAGIPMLPVVASVRRVNAEIVFFAWLTVLSSLAVWALG-LSPVYGVPTLVVGA 273

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLF 282
            F + A +        +     +LF  S TYL ++F
Sbjct: 274 IFIVEAHKLAGRARRGEAVKPMRLFHWSTTYLTIVF 309


>gi|315499610|ref|YP_004088413.1| protoheme ix farnesyltransferase [Asticcacaulis excentricus CB 48]
 gi|315417622|gb|ADU14262.1| protoheme IX farnesyltransferase [Asticcacaulis excentricus CB 48]
          Length = 339

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 126/294 (42%), Positives = 173/294 (58%), Gaps = 14/294 (4%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  LLKPRVMSL ++T   G+V+AP  I    + I++  IA+GAGA+GALNM  + + D
Sbjct: 41  DYFQLLKPRVMSLVVFTGLTGLVVAPQKIDPFLAFIAVLCIALGAGAAGALNMAIEGETD 100

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RP+  G++S  +A   G  LA  S+ +M LAIN V+A LL ++I  YVV YT
Sbjct: 101 ALMRRTRGRPVASGRVSKSDAMAFGGVLAFLSVAMMWLAINVVAAGLLALTILYYVVFYT 160

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           I LKR TPQNIVIGG AGA PP+IGWA+ TG   + + ++F IIFLWTPPH W+LAL   
Sbjct: 161 IVLKRRTPQNIVIGGAAGAFPPVIGWAAATGHAPLEAWLLFAIIFLWTPPHSWALALYTA 220

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY KA IPM+P     ++T++ ILIY+++ + +  LP       + Y  +    G  F 
Sbjct: 221 EDYAKAGIPMMPVAKGAKSTRLQILIYSLIMAPMACLPVAFSMGGMIYAAVSVLGGAFFI 280

Query: 250 LWAWRTFLCKE--------------DKDIRVTKKLFLESITYLFVLFTILMVDH 289
             A R FL +                K+    + LF  SI YL  LF  L++ H
Sbjct: 281 FLAVRLFLSRAGDHPEGGENSLYDVKKEALAARNLFAFSILYLTALFAALLIHH 334


>gi|195578137|ref|XP_002078922.1| GD23677 [Drosophila simulans]
 gi|194190931|gb|EDX04507.1| GD23677 [Drosophila simulans]
          Length = 391

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/282 (24%), Positives = 133/282 (47%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
            + +  L K R+ SL + T   G  +AP         +      + + A+ A+N Y++  
Sbjct: 73  FSQYKKLSKFRLTSLVVITTMGGYAMAPAAFDPTTFAMCTLGTGLVSAAANAINQYHEVP 132

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQ++P  A       A + + ++   +N ++A L   ++F Y  I
Sbjct: 133 FDSQMSRTKNRVLVTGQMTPLHAVTFAAVSATAGLSMLYFGVNGLTAALGAGNLFLYTTI 192

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GWA   G +   ++++  +++ W  PHF +L+  
Sbjct: 193 YTP-MKRISIVNTWVGSIVGAIPPLMGWAGCAGTLDAGAMILAGVLYAWQFPHFNALSWN 251

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L Y+V  + +  +  +L   +  + +    L  +
Sbjct: 252 LRPDYSRAGYRMMAVTNPG-LCRRTALRYSVAIAGLSAMAPVLDVTNYWFALETLPLNAY 310

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   A++ +   E  D   ++KLF  S+ +L  L  + + + 
Sbjct: 311 FAYLAYKFY---EKSDSGSSRKLFRFSLIHLPALMLLFLANK 349


>gi|152979776|ref|YP_001354834.1| protoheme IX farnesyltransferase [Janthinobacterium sp. Marseille]
 gi|182639203|sp|A6T2T7|COXX_JANMA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|151279853|gb|ABR88263.1| protoheme IX farnesyltransferase [Janthinobacterium sp. Marseille]
          Length = 294

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 168/288 (58%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  +  L KPRV  LA++ A +G+ LA P   S    V +   I + AGA+ A+N   +
Sbjct: 10  RIAQYWALTKPRVTQLAVFCAVIGMFLATPELPSWKIVVAATIGIWLLAGAAFAINCLVE 69

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            +ID  MARTA RP+  G+I+  +  V    +  + + ++   +N ++  L F +   Y 
Sbjct: 70  REIDSRMARTARRPMARGEITVPQTLVFSGLIGGAGMWVLYNFVNPLTMWLTFATFVGYA 129

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYTI LK  TPQNIVIGG++GA+PP +GWA+V  D+ + + ++ LIIF+WTPPHFW+LA
Sbjct: 130 VIYTIILKPATPQNIVIGGLSGAMPPALGWAAVANDLPMQAWILVLIIFIWTPPHFWALA 189

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  +D+Y K+ +PMLP       T+ HI +YT+      +LP  +G + + Y + V  L 
Sbjct: 190 LYRRDEYAKSGLPMLPVTHGTEFTQFHIWLYTIALVATTMLPFAVGMSGLIYLVSVAILD 249

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F  +AW+ +    D    + +K+F  SI YL +LF  L+VDH +  
Sbjct: 250 IIFVWYAWQVYRHYTD---MIARKMFAYSIIYLSLLFAALLVDHYLRF 294


>gi|33594594|ref|NP_882238.1| protoheme IX farnesyltransferase [Bordetella pertussis Tohama I]
 gi|81424240|sp|Q7VT22|COXX_BORPE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|33564670|emb|CAE43992.1| UbiA prenyltransferase family protein [Bordetella pertussis Tohama
           I]
 gi|332384005|gb|AEE68852.1| protoheme IX farnesyltransferase [Bordetella pertussis CS]
          Length = 297

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 108/287 (37%), Positives = 162/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++VL KPRV  LA++ A +G+ LA PG   +   V     I + A A+ A+N   + 
Sbjct: 12  LRQYLVLTKPRVTQLAVFCAVIGMFLAAPGMPDLSHVVFGTLGIWLLAAAAFAINCLIEQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  M RTA R    G IS  +   L   L  + ++++   +N ++  L F +   Y +
Sbjct: 72  EVDARMLRTARRATARGTISDIQVLSLSGLLGGAGMLVLYHLVNPLTMWLTFATFVGYAI 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + V+ LIIF+WTPPHFW+LAL
Sbjct: 132 IYTVILKPRTPQNIVIGGLSGAMPPALGWAAVADSVPAEAWVLVLIIFIWTPPHFWALAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              +DY KA +PMLP     + T++HIL+Y+       +LP  +  +   Y      LG 
Sbjct: 192 YRNNDYIKAGLPMLPVTRGQQFTRLHILLYSFALLATTLLPYAIRMSGALYLASALALGG 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +AWR +    D    + ++LF  SI YL +LF  L++DH + +
Sbjct: 252 MFVWYAWRLYREYSD---ALARRLFRFSILYLALLFGALLIDHWVGL 295


>gi|259417610|ref|ZP_05741529.1| protoheme IX farnesyltransferase [Silicibacter sp. TrichCH4B]
 gi|259346516|gb|EEW58330.1| protoheme IX farnesyltransferase [Silicibacter sp. TrichCH4B]
          Length = 313

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 128/288 (44%), Positives = 182/288 (63%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TAFVG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTAFVGLMAAPMGVHPVVGFAAILFIAIGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT SRPIP G++   EA  LG++L+  S++++ LA N  +   L  +IF YVV+
Sbjct: 78  IDQVMKRTKSRPIPAGKVDKGEALSLGLALSGLSVIMLALATNVFAGAFLAFTIFFYVVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGW + TG +SI   +MF + FLWTPPHFW+LAL 
Sbjct: 138 YTMWLKRATPQNIVIGGAAGAFPPVIGWIAATGSMSIEPWLMFALTFLWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            ++DY  A +PML      R+T+ HIL+YTV+ +I  +     G     Y  +   L   
Sbjct: 198 MRNDYDMADVPMLTVTHGRRSTRKHILVYTVILAIFALATAFTGVGGPIYLAVALVLNAL 257

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   A + +   ED     + +V +  F  S+ YLF+ F  ++++ L+
Sbjct: 258 FLKGAVQIWRRDEDICEMDNFKVERTFFKLSLLYLFLHFGAILMEALL 305


>gi|120612538|ref|YP_972216.1| protoheme IX farnesyltransferase [Acidovorax citrulli AAC00-1]
 gi|182637466|sp|A1TU04|COXX_ACIAC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|120591002|gb|ABM34442.1| protoheme IX farnesyltransferase [Acidovorax citrulli AAC00-1]
          Length = 302

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 112/290 (38%), Positives = 169/290 (58%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS----VLKSVISIFAIAMGAGASGALN 61
            R + F  L KPRV+ L ++ AF+G+VLA   +      L   I+ F I + AGA+ A N
Sbjct: 15  SRFSQFYALTKPRVVQLIVFCAFIGMVLAVPGLPSGEQWLHMAIACFGIWLVAGAAAAFN 74

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +       L ++  +++ + +N ++  L F + 
Sbjct: 75  CLVEQHIDARMNRTAWRPTAKGELSNAQTLAFSALLCLAGSLVLFVWVNALTMWLTFATF 134

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWAS+TGDV    L++FLIIFLWTPPHF
Sbjct: 135 VGYAVIYTVVLKPRTPQNIVIGGASGAMPPVLGWASMTGDVGPEPLILFLIIFLWTPPHF 194

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+K+ +PMLP    +  T++ +L+YT +     ++P + G +S  Y    
Sbjct: 195 WALALYRVEDYRKSGLPMLPVTHGNEFTRLQVLLYTFILFAGCLMPFVYGMSSWIYLAAA 254

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             L   F  +A+R +    D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 255 VVLCTGFCAYAFRLWRNYSD---ALARKTFRFSLIHLSLLFAALLVDHYV 301


>gi|126654889|ref|ZP_01726423.1| protoheme IX farnesyltransferase [Cyanothece sp. CCY0110]
 gi|126623624|gb|EAZ94328.1| protoheme IX farnesyltransferase [Cyanothece sp. CCY0110]
          Length = 314

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 113/285 (39%), Positives = 164/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +   K  I++    + A ++  +N  YD 
Sbjct: 17  VRSYYQLTKPRIIPLLLITTAASMWIASKGEVDSFKLFITLIGGTLAAASAQVMNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++    A +  + LAV S  +  + IN +S  L    I  Y++
Sbjct: 77  DIDYEMLRTRARPIPSGRVQSSHALIFALVLAVISFSLFLIYINLLSGLLAMSGIAFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG AG+IPP++GWA+VTGD+S A  ++F IIFLWTPPHFW+LAL
Sbjct: 137 VYTHFLKRNTPQNIVIGGAAGSIPPLVGWAAVTGDLSWAPWILFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + KDDY + ++PM+P +  + +T   I  YT+L      L     G +   YG++   LG
Sbjct: 197 MIKDDYAQVNVPMMPVIEGEESTVRQIWWYTLLVIPCTFLLVYPLGVSGWLYGVMAVLLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F    W       +KD+   K LF  SI YL +L T ++VD L
Sbjct: 257 AMFIKKTWLLKQNPFNKDM--AKSLFKFSILYLMLLCTAMVVDSL 299


>gi|118462366|ref|YP_882508.1| protoheme IX farnesyltransferase [Mycobacterium avium 104]
 gi|118163653|gb|ABK64550.1| protoheme IX farnesyltransferase [Mycobacterium avium 104]
          Length = 289

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 111/288 (38%), Positives = 157/288 (54%), Gaps = 3/288 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L KPRV+ L + TA   ++LA  G ++ L  V ++    + AG + ALN   DADI
Sbjct: 3   AYLALTKPRVIELLLVTAIPAMLLAQRGTVNPLLIVNTLIGGMLAAGGANALNCVADADI 62

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           DK+M RTA RP+    +    A V G+ L   S + +    N +S  L   +I  YV IY
Sbjct: 63  DKVMKRTARRPLARAAVPTRNALVFGLVLTAGSFLWLWWTTNLLSGLLALATIAFYVFIY 122

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QN+V GG AG +P MIGW++VTG +   +LVMF IIF WTPPH W+LA+  
Sbjct: 123 TLLLKRRTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFAIIFFWTPPHTWALAMRY 182

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY+ A +PMLP V T+R     IL+YT LT +  +   +       Y  +    G  F
Sbjct: 183 KDDYKAAGVPMLPAVATERQVTKQILVYTWLTVLATLALAL--ATGWLYAAVAVVAGVWF 240

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
              A + +      +     +LFL+S  YL V+F  L +D  I +  +
Sbjct: 241 LAMAHQLYAGVRAGEPVKPLRLFLQSNNYLAVVFCALAIDSAIGLPHL 288


>gi|194859795|ref|XP_001969452.1| GG10107 [Drosophila erecta]
 gi|190661319|gb|EDV58511.1| GG10107 [Drosophila erecta]
          Length = 391

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/282 (24%), Positives = 134/282 (47%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L+ +  L K R+ SL + T   G  +AP         +      + + A+ A+N Y++  
Sbjct: 73  LSQYKKLSKFRLTSLVVITTMGGYAMAPAAFEPTTFAMCTLGTGLVSAAANAINQYHEVP 132

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQ++P  A       A + + ++   +N ++A L   ++F Y  I
Sbjct: 133 FDSQMSRTKNRVLVTGQMTPLHAVTFATVSATAGLSMLYFGVNGLTAALGAGNLFLYTTI 192

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GWA   G +   ++++  +++ W  PHF +L+  
Sbjct: 193 YTP-MKRISIVNTWVGSIVGAIPPLMGWAGCAGTLDAGAMILAGVLYAWQFPHFNALSWN 251

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L Y+V  + +  +  +L   +  + +    L  +
Sbjct: 252 LRPDYSRAGYRMMAVTNPG-LCRRTALRYSVAIAGLSAMAPVLDVTNYWFALETLPLNAY 310

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   A++ +   E  D   ++KLF  S+ +L  L  + + + 
Sbjct: 311 FAYLAYKFY---EKSDSGSSRKLFRFSLIHLPALMLLFLANK 349


>gi|241764413|ref|ZP_04762438.1| protoheme IX farnesyltransferase [Acidovorax delafieldii 2AN]
 gi|241366203|gb|EER60774.1| protoheme IX farnesyltransferase [Acidovorax delafieldii 2AN]
          Length = 298

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 164/290 (56%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLK----SVISIFAIAMGAGASGALN 61
            R + F  L KPRV+ L ++ A +G+VLA   +  L+      ++   + + AGA+ A N
Sbjct: 11  SRFSQFYALTKPRVVQLIVFCALIGMVLAVPGLPTLQQVGQMALASAGVWLVAGAAAAFN 70

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RT+ RP   G++S  +  +    L      ++   +N ++  L F + 
Sbjct: 71  CIVEQGIDAKMKRTSWRPTAKGELSNTQTLLFSALLCAVGSGVLYFWVNPLTMWLTFATF 130

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y V+YT+ LK  TPQNIVIGG +GA+PP++GWAS+TG+V   +L++FLIIFLWTPPHF
Sbjct: 131 VGYAVVYTVILKPLTPQNIVIGGASGAMPPVLGWASMTGEVGPEALILFLIIFLWTPPHF 190

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+K+ +PMLP    +  T++ + +YT++     ++P + G +S  Y +  
Sbjct: 191 WALALYRVEDYRKSGLPMLPVTHGNEFTRLQVFLYTLILFAGCLMPFIYGMSSWIYLVAA 250

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             L   F  + +  +    D    + +K F  S+ +L  LF  L+VDH +
Sbjct: 251 VALSAGFCGYGFALWRNYSD---TLARKTFRFSLIHLSALFAALLVDHYV 297


>gi|33598720|ref|NP_886363.1| protoheme IX farnesyltransferase [Bordetella parapertussis 12822]
 gi|33603795|ref|NP_891355.1| protoheme IX farnesyltransferase [Bordetella bronchiseptica RB50]
 gi|81425993|sp|Q7W316|COXX_BORPA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|81579601|sp|Q7WE16|COXX_BORBR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|33574850|emb|CAE39513.1| UbiA prenyltransferase family protein [Bordetella parapertussis]
 gi|33577920|emb|CAE35185.1| UbiA prenyltransferase family protein [Bordetella bronchiseptica
           RB50]
          Length = 297

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 108/287 (37%), Positives = 162/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++VL KPRV  LA++ A +G+ LA PG   +   V     I + A A+ A+N   + 
Sbjct: 12  LRQYLVLTKPRVTQLAVFCAVIGMFLAAPGMPDLSHVVFGTLGIWLLAAAAFAINCLIEQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  M RTA R    G IS  +   L   L  + ++++   +N ++  L F +   Y +
Sbjct: 72  EVDARMLRTARRATARGTISDIQVLSLSGLLGGAGMLVLYHLVNPLTMWLTFATFVGYAI 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + V+ LIIF+WTPPHFW+LAL
Sbjct: 132 IYTVILKPRTPQNIVIGGLSGAMPPALGWAAVADSVPAEAWVLVLIIFIWTPPHFWALAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              +DY KA +PMLP     + T++HIL+Y+       +LP  +  +   Y      LG 
Sbjct: 192 YRNNDYIKAGLPMLPVTHGQQFTRLHILLYSFALLATTLLPYAIRMSGALYLASALALGG 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +AWR +    D    + ++LF  SI YL +LF  L++DH + +
Sbjct: 252 MFVWYAWRLYREYSD---ALARRLFRFSILYLALLFGALLIDHWVGL 295


>gi|284990565|ref|YP_003409119.1| protoheme IX farnesyltransferase [Geodermatophilus obscurus DSM
           43160]
 gi|284063810|gb|ADB74748.1| protoheme IX farnesyltransferase [Geodermatophilus obscurus DSM
           43160]
          Length = 306

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 91/288 (31%), Positives = 154/288 (53%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIF-AIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T    ++LA G +   + +++      + A A+   N +YD 
Sbjct: 19  IRAYVALTKPRIIELLLITTLPAMMLAVGGLPSWELLLATMAGGTLAAAAANVFNCWYDR 78

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  RP+  G+I+P  A V G+ L V S+ ++ +    ++A L   +I  Y V
Sbjct: 79  DIDRLMHRTERRPLATGEITPRAALVFGLVLTVLSVALLYVTTTPLAAVLALGAIAYYAV 138

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T  + + GG+ GA P +IGWA+VTG ++  ++V F ++F W  PHFW+LA+
Sbjct: 139 VYTMVLKRHTRHSTLFGGVPGAAPVLIGWAAVTGTLAWPAVVFFGVVFCWQLPHFWALAM 198

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFA---SVTYGIIVFF 243
             + DY +A +PMLP V +  +     ++++ LT  V +L   +         Y      
Sbjct: 199 RFRADYARADVPMLPVVASPLSVGRQTVVWSWLTVAVSLLLWPVADGYGIGWVYTGAAAA 258

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           LG  F + A R              +LF  SI+Y+ +L   ++VD L+
Sbjct: 259 LGLWFVVEAHRLLRRIRSGAETKPMQLFHVSISYMALLSVAIIVDVLV 306


>gi|94496061|ref|ZP_01302640.1| protoheme IX farnesyltransferase [Sphingomonas sp. SKA58]
 gi|94424753|gb|EAT09775.1| protoheme IX farnesyltransferase [Sphingomonas sp. SKA58]
          Length = 306

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 129/286 (45%), Positives = 184/286 (64%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F+ L KPRVM+L ++T   G++ APGHI  + +  +I  IA+GAGA+ +LN +++AD
Sbjct: 19  WRDFVALTKPRVMTLVVFTGLCGLLAAPGHIHPVLAFTAILCIALGAGAAASLNQWWEAD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTASRP+P G++    A   GV L+  S+++MG+A NW+++ +L +SI  YV +
Sbjct: 79  IDAKMKRTASRPLPAGRMDRQAALHFGVGLSFFSVILMGMATNWLASAVLAVSILFYVFV 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLK  T QNIVIGG AGA PP+IGWA+VTGDVS   + +F++IF WTPPHFW+LAL 
Sbjct: 139 YTIWLKPRTAQNIVIGGAAGAFPPVIGWAAVTGDVSALPIALFMLIFFWTPPHFWALALF 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A IPMLP V  +  T+  I  YT + ++  + P +L    V YG         
Sbjct: 199 VKTDYAAAGIPMLPVVSGEVATRRQIWFYTAIMAVAALAPVLLNLTGVIYGTTALLGTAL 258

Query: 248 FTLWAWRTFLCKEDK--DIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F L+A++ +  +E     ++  K+LF  SI YLF+LF  ++VD  +
Sbjct: 259 FALFAFQVYRRRESDPARMKPEKRLFKYSILYLFLLFGAVVVDRWL 304


>gi|294010657|ref|YP_003544117.1| protoheme IX farnesyltransferase [Sphingobium japonicum UT26S]
 gi|292673987|dbj|BAI95505.1| protoheme IX farnesyltransferase [Sphingobium japonicum UT26S]
          Length = 306

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 126/286 (44%), Positives = 178/286 (62%), Gaps = 2/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F+ L KPRVM+L ++T   G++ APGHI  + +  +I  IA+GAGA+ ALN +Y+AD
Sbjct: 19  WRDFVALTKPRVMTLVVFTGLCGLLAAPGHIHPVLAFTAILCIALGAGAAAALNQWYEAD 78

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RP+P G++    A   GV L+  S+++MG+A NW++A +L +SI  YV +
Sbjct: 79  IDAKMKRTANRPLPAGRMDRQSALHFGVGLSFFSVLLMGVATNWLAAAVLAVSILFYVFV 138

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLK  T QNIVIGG AGA PP+IGWA+VTGD+    + +F++IF WTPPHFW+LAL 
Sbjct: 139 YTIWLKPRTAQNIVIGGAAGAFPPVIGWAAVTGDIGALPVALFMLIFFWTPPHFWALALF 198

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A IPMLP V  +  T+  I  YT + ++  + P +L      YG         
Sbjct: 199 VKTDYAAAGIPMLPVVSGEVATRRQIWFYTAIMAVAAMAPVLLRLTGPIYGTTALLGTAL 258

Query: 248 FTLWAWRTFLCKEDKDIRVT--KKLFLESITYLFVLFTILMVDHLI 291
           F   A++    +E     +   ++LF  SI YLF+LF  ++VD  +
Sbjct: 259 FVAMAFQVLRRRESDPAHMAPERRLFKYSILYLFLLFGAVVVDRWV 304


>gi|84516621|ref|ZP_01003980.1| protoheme IX farnesyltransferase [Loktanella vestfoldensis SKA53]
 gi|84509657|gb|EAQ06115.1| protoheme IX farnesyltransferase [Loktanella vestfoldensis SKA53]
          Length = 317

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 131/292 (44%), Positives = 185/292 (63%), Gaps = 4/292 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  LLKPRVMSL ++TA VG+++AP  +      ++I  IA+GAGASGALNM++DADID
Sbjct: 22  DYFALLKPRVMSLVVFTALVGLLVAPVPVHPFIGFVAILCIAVGAGASGALNMWWDADID 81

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RPIP G+++P EA  +G +L+  +IV++GLA N+++A LL  +IF Y+V+Y+
Sbjct: 82  AVMKRTVGRPIPSGRVAPGEALGIGAALSGFAIVLLGLATNFLAAGLLAFTIFFYLVVYS 141

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGWA  TG VSI SL+MF +IF+WTPPHFW+LAL  K
Sbjct: 142 MWLKRATPQNIVIGGAAGAFPPMIGWAVATGGVSIESLLMFALIFMWTPPHFWALALFVK 201

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY +A +PML        T+ H+L+YT+L   V +   +       Y  +   +   F 
Sbjct: 202 SDYGRAGVPMLTETHGRDVTRRHVLVYTLLLVPVALGLGLTSIGGPFYMAVAVVMNVWFL 261

Query: 250 LWAWRTFLCKE----DKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             A+  +   +         V  K+F  S+ YLF  F  L+V+  + +  + 
Sbjct: 262 KGAYDIWQRDDAACEADKHAVEIKVFKVSLYYLFAHFGALLVEAALRLYGLG 313


>gi|300934496|ref|ZP_07149752.1| protoheme IX farnesyltransferase [Corynebacterium resistens DSM
           45100]
          Length = 317

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 96/306 (31%), Positives = 164/306 (53%), Gaps = 14/306 (4%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIV-LAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  +I L KPRV+ L +      ++  A G++ +   ++++    MGA ++   NM  D
Sbjct: 13  RVKAYIALTKPRVIELLLVATIPAMLQAARGNVDIGLILLTLVGGWMGAASANTFNMVAD 72

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLA-INWVSATLLFMSIFCY 124
            DID++M RT  RP+    ++  +A +    + ++S++ +GL   +W++A  + ++I+ Y
Sbjct: 73  YDIDQLMRRTRRRPLAKDTVTVNQARIFAWVMMIASVLFLGLLAHSWLAAGFVVLTIWFY 132

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV----------SIASLVMFLIIF 174
           + +YT WLKR T QN++ GG AG +P ++GWA+ T +            I ++++F+IIF
Sbjct: 133 IYVYTKWLKRRTWQNVIWGGAAGCMPVIVGWAATTDNHGGALHAGWSSWIQAIILFMIIF 192

Query: 175 LWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFAS 234
            WTPPH W+L +  ++DY+ A +PM+P V         IL YT  T I  +L  ++  A 
Sbjct: 193 FWTPPHTWALGMRYREDYEAAGVPMMPVVKPPLEVTRQILAYTWATVITSLL--LVPAAG 250

Query: 235 VTYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
             Y ++    G  F L A R  +  ++       KLF  S  YL +LF  L VD ++   
Sbjct: 251 WIYAVVAVASGAWFILMAHRLHIGVKNGTPVKPMKLFFLSNNYLSILFVALSVDAVLGWD 310

Query: 295 TVERYF 300
           TV +  
Sbjct: 311 TVAQML 316


>gi|195473607|ref|XP_002089084.1| GE18922 [Drosophila yakuba]
 gi|194175185|gb|EDW88796.1| GE18922 [Drosophila yakuba]
          Length = 391

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 70/282 (24%), Positives = 134/282 (47%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
            + +  L K R+ SL + T   G  +AP         +      + + A+ A+N Y++  
Sbjct: 73  FSQYKKLSKFRLTSLVVITTMGGYAMAPAAFDPTTFAMCTLGTGLVSAAANAINQYHEVP 132

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQ++P  A     + A + + ++   +N ++A L   ++F Y  I
Sbjct: 133 FDSQMSRTKNRVLVTGQMTPLHAVTFAAASATAGLSMLYFGVNGLTAALGAGNLFLYTTI 192

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GWA   G +   ++++  I++ W  PHF +L+  
Sbjct: 193 YTP-MKRISIVNTWVGSIVGAIPPLMGWAGCAGTLDAGAMILAGILYAWQFPHFNALSWN 251

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L Y+V  + +  +  +L   +  + +    L  +
Sbjct: 252 LRPDYSRAGYRMMAVTNPG-LCRRTALRYSVAIAGLSAMAPVLDVTNYWFALETLPLNAY 310

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   A++ +   E  D   ++KLF  S+ +L  L  + + + 
Sbjct: 311 FAYLAYKFY---EKSDSGSSRKLFRFSLIHLPALMLLFLANK 349


>gi|269926610|ref|YP_003323233.1| protoheme IX farnesyltransferase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790270|gb|ACZ42411.1| protoheme IX farnesyltransferase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 622

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 103/292 (35%), Positives = 163/292 (55%), Gaps = 8/292 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVL-----KSVISIFAIAMGAGASGALNM 62
           +  +  L+KPR++ L +      +++A                ++    +  G + ++N 
Sbjct: 334 VRAYFALMKPRIIPLLLVPTIAAMLIAAVQHPPQGSLLGLMFWTVLGGILATGGAHSINN 393

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           + D DID  M RT +RP+  G++SP  A   G+ L++ ++V M + +N V+A L  +   
Sbjct: 394 FLDRDIDAKMRRTRNRPVVTGRVSPERALWFGIFLSILALVEMWVFVNPVAAVLAILGNL 453

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            YV +YT WLKR T QNIVIGG AGA+PP++GWA+VTGDV + +++ F IIF WTP HFW
Sbjct: 454 FYVFVYTAWLKRTTTQNIVIGGAAGAVPPLVGWAAVTGDVGLPAILFFAIIFFWTPAHFW 513

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           SLAL+ ++DY+ A IPMLP V     T   IL Y VL  +  +LP +       Y ++  
Sbjct: 514 SLALVRQEDYKAAGIPMLPVVKGQEATMNGILKYAVLLLLSTILPFLTHSLGYIYLVVAI 573

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
            LG    + A +    K   +I +  ++F  S  YL +L+  +++D LI ++
Sbjct: 574 SLGLLLVIRAIQL---KLHPEIALAWRVFKYSNIYLAMLYAAMVIDRLIALR 622


>gi|294138953|ref|YP_003554931.1| protoheme IX farnesyltransferase [Shewanella violacea DSS12]
 gi|293325422|dbj|BAJ00153.1| protoheme IX farnesyltransferase [Shewanella violacea DSS12]
          Length = 304

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 113/286 (39%), Positives = 172/286 (60%), Gaps = 4/286 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   +  + KP+V++L + T  VG+ LA PG + +   +I +  I M AGA+ A N   D
Sbjct: 20  QWRAYYEMTKPKVVALMLLTVLVGMCLAVPGSVPLQPLIIGMLGIGMMAGAAAAFNHLID 79

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART +RP+P G+IS  +A +   SLA+    ++   +N ++A L F S+  Y 
Sbjct: 80  RRIDGLMARTYNRPLPKGRISITKALIFSFSLALLGFALLYTLVNELTAWLTFASLVGYA 139

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYT +LKR TPQNIV+GG+AGA+PP++GW ++TG+    +L++ +IIF WTPPHFW+LA
Sbjct: 140 IIYTTYLKRATPQNIVVGGLAGAMPPLLGWTAITGEFHGHALLLVIIIFTWTPPHFWALA 199

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  + +Y K  IPMLP       TK  IL+YT+L +I  +LP ++G     Y +    L 
Sbjct: 200 IHRRAEYAKVDIPMLPVTHGVEFTKTCILLYTLLLAIACLLPVIVGMCGPIYLVGSTILS 259

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F   AW     K D    +  ++F  SI +L +LF +L+VDH +
Sbjct: 260 CGFIYKAWEL---KYDDKPGLAMQVFRFSIYHLMILFIVLLVDHYL 302


>gi|320449197|ref|YP_004201293.1| protoheme IX farnesyltransferase [Thermus scotoductus SA-01]
 gi|320149366|gb|ADW20744.1| protoheme IX farnesyltransferase [Thermus scotoductus SA-01]
          Length = 607

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 108/285 (37%), Positives = 168/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+SL ++T  + +++A  G       ++      M AGA+ A+NM  D 
Sbjct: 326 WKDYLALTKPRVISLLLFTTLLAMLIAAKGWPGTGLFLVVALGGYMMAGAANAINMVVDR 385

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RTA RP    +IS  +A +    LA+ + +++    N +SATL  M +  YV+
Sbjct: 386 DIDARMRRTAKRPTVTQRISSRDALLFAFGLALFAFLLLWWGANLLSATLALMGLIWYVL 445

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR T QNIVIGG AGA PP++GWA+VTG++S+ +  +F +IF WTP HFW+LAL
Sbjct: 446 VYTLYLKRRTWQNIVIGGAAGAFPPLVGWAAVTGELSLFAWYLFALIFFWTPVHFWALAL 505

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + +DDY+   +PMLP V+ +R T M I +Y VLT+++ ++P +LG   + Y      L  
Sbjct: 506 MIQDDYRAVGVPMLPVVLGERVTVMQIALYAVLTALISLMPLLLGELGLVYFFFSLTLNA 565

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              L +   +      + R    L+  S+ YL +LF  + VD ++
Sbjct: 566 LLILKSLALYRQ---PERRTAVSLYKYSMLYLALLFVAMAVDRVL 607


>gi|221199945|ref|ZP_03572988.1| protoheme IX farnesyltransferase [Burkholderia multivorans CGD2M]
 gi|221207386|ref|ZP_03580395.1| protoheme IX farnesyltransferase [Burkholderia multivorans CGD2]
 gi|221211156|ref|ZP_03584135.1| protoheme IX farnesyltransferase [Burkholderia multivorans CGD1]
 gi|221168517|gb|EEE00985.1| protoheme IX farnesyltransferase [Burkholderia multivorans CGD1]
 gi|221172589|gb|EEE05027.1| protoheme IX farnesyltransferase [Burkholderia multivorans CGD2]
 gi|221180184|gb|EEE12588.1| protoheme IX farnesyltransferase [Burkholderia multivorans CGD2M]
          Length = 304

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 103/273 (37%), Positives = 152/273 (55%), Gaps = 4/273 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 15  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTVGIWLLAGAAFAINCLV 74

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  +D MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 75  EQKVDAMMRRTAWRPSARGEITTPQILLFSAVLGSLGAWTLYTFTNALTMWLTIATFVGY 134

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 135 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 194

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 195 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 254

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
           G  F  +AW+ +    D    + +K F  SI Y
Sbjct: 255 GAVFLAYAWKIY---RDYSDELARKAFRYSIVY 284


>gi|218531517|ref|YP_002422333.1| protoheme IX farnesyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|240140009|ref|YP_002964486.1| heme O synthase [Methylobacterium extorquens AM1]
 gi|254562436|ref|YP_003069531.1| heme O synthase [Methylobacterium extorquens DM4]
 gi|254765941|sp|B7KVJ7|COXX_METC4 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|218523820|gb|ACK84405.1| protoheme IX farnesyltransferase [Methylobacterium chloromethanicum
           CM4]
 gi|240009983|gb|ACS41209.1| heme O synthase [Methylobacterium extorquens AM1]
 gi|254269714|emb|CAX25686.1| heme O synthase [Methylobacterium extorquens DM4]
          Length = 317

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 129/269 (47%), Positives = 183/269 (68%), Gaps = 1/269 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ F  LLKPRVM L I+TA VG+V++   ++ + + IS+  IA+GAGASG LNM++DAD
Sbjct: 25  VSDFFALLKPRVMVLVIFTALVGMVVSDATVNPVIAAISLLMIAVGAGASGCLNMWWDAD 84

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RPIP G+I P EA   G+ L+V S++I+GLA NW++A LL  +I  Y VI
Sbjct: 85  IDALMTRTAKRPIPDGRIRPDEALAFGIVLSVGSVLILGLASNWLAAGLLAFTIVFYAVI 144

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR T QNIVIGG AGA+PP++G A+VTG V I SLV+F IIF+WTPPHFW+LAL+
Sbjct: 145 YSMWLKRATAQNIVIGGAAGALPPVVGQAAVTGHVGIESLVLFAIIFIWTPPHFWALALV 204

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              +Y +A IPM+PNV    +T+  I+ Y+++ + + +LP  LGF    Y ++    G  
Sbjct: 205 KSGEYARAGIPMMPNVAGPDSTRRQIIWYSLVLAPLALLPVWLGFGGWLYAVVGVLGGLG 264

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESI 275
               A + +  +E + + +    LF  SI
Sbjct: 265 MLAGAVQVYRLREGEPERKAAMGLFAFSI 293


>gi|188582698|ref|YP_001926143.1| protoheme IX farnesyltransferase [Methylobacterium populi BJ001]
 gi|205693527|sp|B1ZKN8|COXX_METPB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|179346196|gb|ACB81608.1| protoheme IX farnesyltransferase [Methylobacterium populi BJ001]
          Length = 317

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 129/269 (47%), Positives = 183/269 (68%), Gaps = 1/269 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ F  LLKPRVM L I+TA VG+V++   ++ + + IS+  IA+GAGASG LNM++DAD
Sbjct: 25  VSDFFALLKPRVMVLVIFTALVGMVVSDATVNPVIAAISLLMIAVGAGASGCLNMWWDAD 84

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RPIP G+I P EA   G+ L+V S++I+GLA NW++A LL  +I  Y VI
Sbjct: 85  IDALMTRTAKRPIPDGRIRPDEALAFGIVLSVGSVLILGLASNWLAAGLLAFTIVFYAVI 144

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR T QNIVIGG AGA+PP++G A+VTG V I SLV+F IIF+WTPPHFW+LAL+
Sbjct: 145 YSMWLKRATAQNIVIGGAAGALPPVVGQAAVTGHVGIESLVLFAIIFIWTPPHFWALALV 204

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              +Y +A IPM+PNV    +T+  I+ Y++L + + ++P  LGF    Y ++    G  
Sbjct: 205 KSGEYARAGIPMMPNVAGPDSTRRQIVWYSLLLAPLALVPVWLGFGGWLYAVVGVLGGLG 264

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESI 275
               A + +  +E + + +    LF  SI
Sbjct: 265 MLAGAVQVYRLREGEPERKAAMGLFAFSI 293


>gi|71061954|gb|AAZ20957.1| cytochrome c oxidase assembly factor [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 288

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 122/288 (42%), Positives = 190/288 (65%), Gaps = 1/288 (0%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYY 64
           +F  +    L+KPRVMSL I+T  VG+++AP  +S   ++I+I  +++GAGA+GALNM+Y
Sbjct: 1   MFNFSELFKLMKPRVMSLVIFTCAVGLLMAPSTVSTKDAMIAILLVSIGAGAAGALNMWY 60

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           ++D+D +M RT  RPIP+G+++  +A + G SL+  S++ +    N +SA LL  +I  Y
Sbjct: 61  ESDLDALMTRTCLRPIPMGKVNKNQALIFGTSLSFFSVIALDYFANTISAVLLLFTILFY 120

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YTIWLKR TPQNIVIGG AGA+PP+IGW   T  +S+  +  FLIIF WTP HFW+L
Sbjct: 121 VFVYTIWLKRKTPQNIVIGGAAGALPPVIGWTIATNSLSLEPITFFLIIFFWTPSHFWAL 180

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           +L   DDY+KA IPMLP      +TK++IL+Y++L   + +LP  + F  + + +    L
Sbjct: 181 SLYKSDDYKKAKIPMLPLTNGIESTKINILVYSLLMLPMVILPYAIDFVGLVFLVPALML 240

Query: 245 GYHFTLWAWRTFLCKEDK-DIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++ +  +  +  K +K + +  K +F  SI YLF++F I ++D ++
Sbjct: 241 TLYYNILCFELYKFKINKFNPKKAKTIFGYSILYLFLIFVIFLIDKIL 288


>gi|239931973|ref|ZP_04688926.1| protoheme IX farnesyltransferase [Streptomyces ghanaensis ATCC
           14672]
          Length = 288

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 164/286 (57%), Gaps = 4/286 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D DI
Sbjct: 2   AFVALTKPRIIELLLITTVPVMFLAQQGVPDLKLVLLTCVGGYLSAGGANALNMYIDRDI 61

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT+ RP+  G +SP E    G++LAV S ++ GL +NW+SA L   ++  YVV+Y
Sbjct: 62  DALMDRTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGLTVNWLSAWLALGALLFYVVVY 121

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QNIV GGIAG +P +IGW+SVT  +S A LV+F++IF WTPPH+W L++  
Sbjct: 122 TMILKRRTAQNIVWGGIAGCMPVLIGWSSVTNSLSWAPLVLFMVIFFWTPPHYWPLSMKV 181

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY +  +PMLP +  ++     I+IY+ +   V +L T LG+    Y  +    G  +
Sbjct: 182 KDDYARVGVPMLPVIAGNKAVAKQIVIYSWVMVGVSLLLTPLGYTGWFYTAVALAAGGWW 241

Query: 249 TLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
              A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 242 LWEAHALLNRAKAEVTGAKLKEMRLFHWSITYVSLLFVAIAVDPFL 287


>gi|26986855|ref|NP_742280.1| protoheme IX farnesyltransferase [Pseudomonas putida KT2440]
 gi|81442474|sp|Q88RL9|CYOE1_PSEPK RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|24981455|gb|AAN65744.1|AE016200_8 protoheme IX farnesyltransferase [Pseudomonas putida KT2440]
          Length = 297

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 106/272 (38%), Positives = 156/272 (57%), Gaps = 4/272 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   ++ L KP+V+ L + T+  G+ LA    +S    +     I + AG +  +N   D
Sbjct: 11  RWRDYLELTKPKVVVLMLITSLAGMFLATRAGVSWSVLLFGNLGIGLCAGGAAVVNHVVD 70

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART  RP+  G++ P  A +  ++LA+  +V++ +  N ++A L   S+  Y 
Sbjct: 71  RRIDALMARTHKRPLAQGRVEPLPALLFALALALLGMVLLLVFTNALTAWLTLASLLGYA 130

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA
Sbjct: 131 VLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALA 190

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K++Y KA IPMLP    +R TK+HIL+YT++   V +LP  +  +   Y +    LG
Sbjct: 191 IHRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVSLLPYAIHMSGPLYLVCALALG 250

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
             F  WAW  +              F  SI Y
Sbjct: 251 LRFLQWAWVLYRSSR---PHAAIGTFKYSIGY 279


>gi|83950052|ref|ZP_00958785.1| protoheme IX farnesyltransferase [Roseovarius nubinhibens ISM]
 gi|83837951|gb|EAP77247.1| protoheme IX farnesyltransferase [Roseovarius nubinhibens ISM]
          Length = 313

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 132/289 (45%), Positives = 188/289 (65%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVMSL ++TAFVG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMSLVVFTAFVGLLAAPVPVHPVVGFAAILFIAVGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID++M RT SRPIP G++S  EA+  G++LAV S++++ LA N ++A +L  +IF YVVI
Sbjct: 78  IDRVMKRTQSRPIPAGKVSEGEAFGFGITLAVMSVIMLALAANLMAAAILAFTIFFYVVI 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR+TPQNIVIGG AGA PPMIGWA  TG +S+ S++MF +IF+WTPPHFW+LAL 
Sbjct: 138 YSMWLKRWTPQNIVIGGAAGAFPPMIGWAVATGGISVESVLMFALIFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY+ A +PML      ++T+ HIL+YT+L   V +   +       Y  +   L   
Sbjct: 198 MKSDYENAGVPMLTVTHGRKSTRKHILVYTLLLVPVALAVGVTSIGGPIYMAVAVLLNLA 257

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           F   AW  +   E+       R  K++F  S+ YLF  F  ++ + ++ 
Sbjct: 258 FLKGAWDIWRRDEEAAQSDQYRTEKRVFALSLLYLFGHFLAILAEAMLG 306


>gi|254468995|ref|ZP_05082401.1| protoheme IX farnesyltransferase [beta proteobacterium KB13]
 gi|207087805|gb|EDZ65088.1| protoheme IX farnesyltransferase [beta proteobacterium KB13]
          Length = 296

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 115/295 (38%), Positives = 178/295 (60%), Gaps = 4/295 (1%)

Query: 3   FQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALN 61
           F +  L  F  L KPRV +L ++TA +G+ LA PG + V   + +   IA  +GA+ A N
Sbjct: 5   FSLDALKSFYALTKPRVCALIVFTAIIGMFLATPGMVPVEILLFASIGIAFVSGAAAAFN 64

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID MMART  RP+PLGQ+S  E  +    L    + ++ + +N ++A L  ++ 
Sbjct: 65  CLIEEKIDAMMARTRGRPLPLGQVSQRETIIFSSLLGGLGLYLLYVFVNPLTAWLTLLTF 124

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
           F Y VIYT++LK  TP NIVIGG +GA+PP++GWA+VT  V+  SL++FLIIF WTPPHF
Sbjct: 125 FAYAVIYTVFLKPATPMNIVIGGASGAMPPVLGWAAVTNQVTPESLILFLIIFCWTPPHF 184

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL  + +Y+K  +PMLP    ++ T++ I++YT++  IV ++P  +G A + Y I  
Sbjct: 185 WALALYRRKEYEKVGMPMLPVTHGEKYTRLQIVLYTIILVIVTMMPFSVGMAGLIYIIFA 244

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
             L  +F  +    +    D   +++ K+F  SI YL ++F   ++DH    K +
Sbjct: 245 TLLNAYFLFYTVMLYREYSD---KLSMKIFRYSIWYLGLIFLAFLIDHYFKFKFI 296


>gi|161523646|ref|YP_001578658.1| protoheme IX farnesyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189351586|ref|YP_001947214.1| protoheme IX farnesyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|160341075|gb|ABX14161.1| protoheme IX farnesyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189335608|dbj|BAG44678.1| protoheme IX farnesyltransferase [Burkholderia multivorans ATCC
           17616]
          Length = 300

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 103/273 (37%), Positives = 152/273 (55%), Gaps = 4/273 (1%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYY 64
            R + ++ L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   
Sbjct: 11  SRFSQYMALTKPRVTQLAVFCAVIGMFLATPGMVPWHVLIGGTVGIWLLAGAAFAINCLV 70

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  +D MM RTA RP   G+I+  +  +    L       +    N ++  L   +   Y
Sbjct: 71  EQKVDAMMRRTAWRPSARGEITTPQILLFSAVLGSLGAWTLYTFTNALTMWLTIATFVGY 130

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT+ LK  TPQNIVIGG +GA+PP +GWA+VTG V   + ++ LIIF+WTPPHFW L
Sbjct: 131 AVIYTLLLKPMTPQNIVIGGASGAMPPALGWAAVTGAVPGDAWILVLIIFVWTPPHFWVL 190

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  + DY+ A +PMLP    ++ T++HIL+YTV+   V ++P + G +   Y      L
Sbjct: 191 ALYRRKDYENAGLPMLPVTHGEKFTRLHILLYTVILFAVTMMPFISGMSGAVYLTSAVLL 250

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
           G  F  +AW+ +    D    + +K F  SI Y
Sbjct: 251 GAVFLAYAWKIY---RDYSDELARKAFRYSIVY 280


>gi|86751684|ref|YP_488180.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris HaA2]
 gi|123003601|sp|Q2IR91|COXX_RHOP2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|86574712|gb|ABD09269.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 313

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 137/294 (46%), Positives = 195/294 (66%), Gaps = 3/294 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL ++TA VG++LAPG    + ++ ++  IA+G GA+GALNM+Y+ D
Sbjct: 21  VADYIALLKPRVMSLVVFTALVGMLLAPGDFHPVLAITAMLCIAVGGGAAGALNMWYEDD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RPIP G+++  EA   G++L+  S++ +G+ +NWV+  LL  +IF YVVI
Sbjct: 81  IDGQMTRTANRPIPRGRVTRPEALTFGITLSFFSVMTLGILVNWVAGALLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR T QNIVIGG AGA+PP++ WA+VTG +++  L++F IIF WTPPHFW+LAL 
Sbjct: 141 YTMWLKRSTAQNIVIGGAAGALPPVVAWAAVTGSLAVEPLLLFAIIFFWTPPHFWALALF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   V   P  LG+ S  YG+    LG  
Sbjct: 201 RNDDYARAGVPMLPVVAGQDHTRLQILLYTIVLVAVAAAPWPLGYFSAIYGVASLALGGW 260

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             + A R +  +         + LF  SI YLF LF+IL+++  +  K V R F
Sbjct: 261 MLVLALRVYRHRTGSAALRATRNLFKFSILYLFALFSILLLE--VVAKAVWRLF 312


>gi|163852676|ref|YP_001640719.1| protoheme IX farnesyltransferase [Methylobacterium extorquens PA1]
 gi|163664281|gb|ABY31648.1| protoheme IX farnesyltransferase [Methylobacterium extorquens PA1]
          Length = 317

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 129/269 (47%), Positives = 183/269 (68%), Gaps = 1/269 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ F  LLKPRVM L I+TA VG+V++   ++ + + IS+  IA+GAGASG LNM++DAD
Sbjct: 25  VSDFFALLKPRVMVLVIFTALVGMVVSDATVNPVIAAISLLMIAVGAGASGCLNMWWDAD 84

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RPIP G+I P EA   G+ L+V S++I+GLA NW++A LL  +I  Y VI
Sbjct: 85  IDALMTRTAKRPIPDGRIRPDEALAFGIVLSVGSVLILGLASNWLAAGLLAFTIAFYAVI 144

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR T QNIVIGG AGA+PP++G A+VTG V I SLV+F IIF+WTPPHFW+LAL+
Sbjct: 145 YSMWLKRATAQNIVIGGAAGALPPVVGQAAVTGHVGIESLVLFAIIFIWTPPHFWALALV 204

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              +Y +A IPM+PNV    +T+  I+ Y+++ + + +LP  LGF    Y ++    G  
Sbjct: 205 KSGEYARAGIPMMPNVAGPDSTRRQIIWYSLVLAPLALLPVWLGFGGWLYAVVGVLGGLG 264

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESI 275
               A + +  +E + + +    LF  SI
Sbjct: 265 MLAGAVQVYRLREGEPERKAAMGLFAFSI 293


>gi|156544307|ref|XP_001607154.1| PREDICTED: similar to GA18613-PA [Nasonia vitripennis]
          Length = 420

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 73/286 (25%), Positives = 139/286 (48%), Gaps = 7/286 (2%)

Query: 6   FRLNFF-IVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYY 64
            +L+ + ++L K R+ SL + TA  G  +AP    ++  +       + + A+ A+N   
Sbjct: 103 TKLHKYCLMLSKIRLTSLVVITAMGGYAIAPAPFDLVTFLACSVGTGLVSAAANAVNQSM 162

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +   D  MART +R +  G ++P  A        ++ + ++   +N ++A L   ++  Y
Sbjct: 163 EVPYDAQMARTKNRVLVRGLLAPEHAIAFAAISGIAGVTLLATQVNTLTAVLGGANLILY 222

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV-SIASLVMFLIIFLWTPPHFWS 183
             IYT  +KR +  N  +G + GAIPP++GWA   G + +  + +M  +++ W  PHF +
Sbjct: 223 TSIYTP-MKRVSILNTWVGSVVGAIPPLMGWAGCVGSIAAPGAWIMSGMLYAWQFPHFNA 281

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           L+   + DY KA   M+     D   +     YTV+ + +  L   L   +  + I    
Sbjct: 282 LSWNLRPDYSKAGYRMMAVSNPD-LCRKTSFRYTVVLTALSYLAPALDVTNWWFAIASTP 340

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           L  +F   AW     ++  D R +++LF  S+ +L +L T++++  
Sbjct: 341 LNAYFLYLAWEF---RQHGDARTSRRLFRFSLLHLPILMTLMLISK 383


>gi|256788454|ref|ZP_05526885.1| protoheme IX farnesyltransferase [Streptomyces lividans TK24]
          Length = 285

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 103/284 (36%), Positives = 164/284 (57%), Gaps = 4/284 (1%)

Query: 12  IVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           + L KPR++ L + T    + LA  G  ++   +++     + AG + ALNMY D DID 
Sbjct: 1   MALTKPRIIELLLITTVPVMFLAEQGVPNLKLVLLTCVGGYLSAGGANALNMYIDRDIDA 60

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
           +M RT+ RP+  G +SP E  V G++LA+ S ++ G  +NW+SA L   ++  YVV+YT+
Sbjct: 61  LMDRTSQRPLVTGMVSPVECLVFGITLAIVSTLLFGFTVNWLSAWLSLGALLFYVVVYTM 120

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR T QNIV GGIAG +P +IGW++VT  +S A +++F ++F WTPPH+W L++  K+
Sbjct: 121 ILKRRTSQNIVWGGIAGCLPVLIGWSAVTNSMSWAPVILFGVMFFWTPPHYWPLSMKVKE 180

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +  +PMLP + +++     I+IY+ +  +V +L   LG+    Y  +    G  +  
Sbjct: 181 DYARVGVPMLPVIASNKVVARQIVIYSWVMVVVSLLLQPLGYTGWFYTAVALAAGGMWLW 240

Query: 251 WAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A       + +         +LF  SITY+ VLF  + VD  +
Sbjct: 241 EAHGLQNRAKAEVTGGKLKEMRLFHWSITYVSVLFLAIAVDPFL 284


>gi|182639247|sp|Q476H8|COXX_RALEJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 304

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 104/286 (36%), Positives = 160/286 (55%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 18  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWRVLIGGGAGIWLLAGAAFAINCLVEQK 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  +    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 78  IDALMRRTAWRPSATGEITTTQTLIFSAVLGGAGMWLLHVFANDLTMWLTFATFLGYAVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GWA+V  DV   +  + LIIF WTPPHFW+LAL 
Sbjct: 138 YTILLKPATPQNIVIGGLSGAMPPALGWAAVANDVPAEAWFLVLIIFTWTPPHFWALALY 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    ++ T ++IL+YT++     +LP + G +   Y      LG  
Sbjct: 198 RRADYAKSGLPMLPITHGEKYTLLNILLYTLVMIAATLLPFVYGMSGYIYLASALVLGAW 257

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  ++W  +    D   ++ ++ F  SI YL +LF  L++DH    
Sbjct: 258 FLKYSWTMYRNYSD---QLAQRAFRFSILYLSLLFAALLIDHYFKF 300


>gi|29832858|ref|NP_827492.1| protoheme IX farnesyltransferase [Streptomyces avermitilis MA-4680]
 gi|29609979|dbj|BAC74027.1| putative protoheme IX farnesyltransferase (complex IV)
           [Streptomyces avermitilis MA-4680]
          Length = 285

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 166/284 (58%), Gaps = 4/284 (1%)

Query: 12  IVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           + L KPR++ L + T    + LA  G  S+   +++     + AG + ALNMY D DID 
Sbjct: 1   MALTKPRIIELLLITTVPVMFLAEQGVPSLRLVLLTCLGGYLSAGGANALNMYIDRDIDA 60

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
           +M RT+ RP+  G +SP E    G++LAV S ++ GL +NW+SA L   ++  YVV+YT+
Sbjct: 61  LMERTSQRPLVTGMVSPRECLAFGITLAVVSTLLFGLTVNWLSAWLSLGALLFYVVVYTM 120

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR T QNIV GGIAG +P +IGW+SVT  +S A +++FL++F WTPPH+W L++  KD
Sbjct: 121 ILKRRTSQNIVWGGIAGCLPVLIGWSSVTDSMSWAPVILFLVMFFWTPPHYWPLSMKVKD 180

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +  +PMLP V +++     I+IY+ +   V +L T LG+    Y ++    G  +  
Sbjct: 181 DYARVGVPMLPVVASNKVVARQIVIYSWVMVGVSLLLTPLGYTGWFYTLVALLAGGFWLW 240

Query: 251 WAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A       + +         +LF  SITY+ +LF  + VD  +
Sbjct: 241 EAHGLQNRAKAEVTGGKLKEMRLFHWSITYVSILFVAVAVDPFL 284


>gi|330501080|ref|YP_004377949.1| protoheme IX farnesyltransferase [Pseudomonas mendocina NK-01]
 gi|328915366|gb|AEB56197.1| protoheme IX farnesyltransferase [Pseudomonas mendocina NK-01]
          Length = 299

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 116/287 (40%), Positives = 167/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T+ VG+ LA    +     +     I + AGA+ A+N   D 
Sbjct: 14  WRDYLELTKPRVVMLMLITSLVGMFLATRAGVPWTVLLFGNLGIGLCAGAAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    ++LA++ + ++ +  N ++A L   S+  Y V
Sbjct: 74  RIDSIMARTHKRPVTAGRVSPVAALTFALALAIAGMSLLMVFTNELAAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW +VTG +S   L++ LIIF WTPPHFW+LA+
Sbjct: 134 IYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGHLSAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT++   V +LP  +  +   Y      LG 
Sbjct: 194 HRKEEYAKADIPMLPVTHGEHYTKVHILLYTLVMFAVTLLPYAIHMSGPLYLACAVLLGG 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +    D         F  SI YLF+LF  L+ DH + +
Sbjct: 254 RFLHWAWVLY---RDSKPHAAINTFKYSIWYLFLLFIALLADHYLLL 297


>gi|134096069|ref|YP_001101144.1| protoheme IX farnesyltransferase [Herminiimonas arsenicoxydans]
 gi|182639202|sp|A4G936|COXX_HERAR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|133739972|emb|CAL63023.1| Putative protoheme IX farnesyltransferase [Herminiimonas
           arsenicoxydans]
          Length = 294

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 167/291 (57%), Gaps = 4/291 (1%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNM 62
              R+  +  L KPRV  LA++ A +G+ LA P        + +   I + AGA+ A+N 
Sbjct: 7   SSNRIAQYWALTKPRVTQLAVFCAVIGMFLATPDLPDWKIVIAATIGIWLLAGAAFAINC 66

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             + +ID  MARTA RP+  G+I+  +  V    +  + + ++   +N ++  L F +  
Sbjct: 67  LVEREIDSRMARTARRPMAQGEITVPQTLVFSGVIGGAGMWVLYNFVNPLTMWLTFATFV 126

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y VIYTI LK  TPQNIVIGG++GA+PP +GWA+V  D+ + + ++ LIIF+WTPPHFW
Sbjct: 127 GYAVIYTIILKPATPQNIVIGGLSGAMPPALGWAAVANDLPMQAWILVLIIFIWTPPHFW 186

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LAL  +D+Y K+ +PMLP       T+ HI +YT+      +LP  +G + + Y ++  
Sbjct: 187 ALALYRRDEYAKSGLPMLPITHGTAFTQFHIWLYTIALVATTMLPFAVGMSGLIYLVVAA 246

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            L   F  +AW+ +    D    + +K+F  SI YL +LF  L+VDH +  
Sbjct: 247 VLDVIFMWYAWQVYRHYTD---MIARKMFTYSIIYLSLLFAALLVDHYLRF 294


>gi|288917098|ref|ZP_06411468.1| protoheme IX farnesyltransferase [Frankia sp. EUN1f]
 gi|288351467|gb|EFC85674.1| protoheme IX farnesyltransferase [Frankia sp. EUN1f]
          Length = 336

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 103/274 (37%), Positives = 153/274 (55%), Gaps = 1/274 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   +I L+K RV+ L + +    ++LA  G  S    V+++ A  + AG++  +N Y D
Sbjct: 51  RTRSYIALMKLRVVELLLVSTVPVMLLAERGMPSWWLIVVTLVAGTLSAGSANTINCYVD 110

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID++M RT  RP+    + P +A   G+ L + S ++ GL +NW+SA L   +I  YV
Sbjct: 111 RDIDQLMGRTKRRPLVRETVEPAQALRFGIVLGIVSTLMFGLLVNWISAALSVGAIAFYV 170

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
            +YT+ LKR +P NIVIGG AG  P +IGW++VTG V  A++++F +IF WTPPHFW+LA
Sbjct: 171 FVYTLGLKRRSPSNIVIGGAAGCFPVLIGWSAVTGTVGWAAVLLFAVIFFWTPPHFWALA 230

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  KDDY  A +PMLP V T       IL+Y+ +   V +    +    + Y +    LG
Sbjct: 231 IRYKDDYAAAGVPMLPVVATTEVVTRRILLYSYVMVAVSLAVGPVADIGLVYTVPAALLG 290

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLF 279
             F   A R        +     +LF  SI+YL 
Sbjct: 291 AWFVAEAHRMVARAHRGEDIRPMRLFHMSISYLT 324


>gi|171464211|ref|YP_001798324.1| protoheme IX farnesyltransferase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|226709217|sp|B1XS75|COXX_POLNS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|171193749|gb|ACB44710.1| protoheme IX farnesyltransferase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 297

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           + R   + VL KPRV  LA++ A +G+ LA PG +        I  I + AGA+ A+N  
Sbjct: 12  MPRWRQYWVLTKPRVTQLAVFCAVIGMFLATPGMVPYPVLFGGIVGIWLLAGAAFAVNCL 71

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            +  +D  M RT+ RP   G+++P    +  + L    ++I+    N ++  L   +   
Sbjct: 72  IEQAVDAKMKRTSWRPSATGEVTPLHIIIFSIILGSLGMIILWNFCNPLTMWLTLATFVG 131

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y VIYT  LK  TPQNIVIGG++GA+PP +GWA+VT  +S  +  + LIIF+WTPPHFW+
Sbjct: 132 YAVIYTWLLKPATPQNIVIGGLSGAMPPALGWAAVTNTLSAEAWHLVLIIFVWTPPHFWA 191

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL  +DDY ++ +PMLP    +R T ++I++YT++     +LP + G + + Y I    
Sbjct: 192 LALYRRDDYVQSGLPMLPVTHGERFTLLNIVLYTLILIAATMLPYIYGMSGMVYLISAII 251

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           LG  F  +    F+   D    + KK F  SITYL +LF  L+VDH 
Sbjct: 252 LGLLFLAYVVALFISYSD---ALAKKTFRFSITYLSLLFAALLVDHY 295


>gi|332308537|ref|YP_004436388.1| protoheme IX farnesyltransferase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175866|gb|AEE25120.1| protoheme IX farnesyltransferase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 307

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 110/271 (40%), Positives = 156/271 (57%), Gaps = 4/271 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  + KP+V+ L + TA VG+ LA    IS    +  +  I   + A+  +N   D 
Sbjct: 22  WRDYYEMTKPKVVMLLLLTALVGMCLASETWISWKILLAGLTGIGFLSSAAAVINHVVDR 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART++RP+P G++SP  A V    L V   VI+ L +N ++A L   S+  Y  
Sbjct: 82  KIDAQMARTSNRPLPKGKVSPKRALVFAGLLTVVGYVILELWVNRLTALLTLASLVGYAF 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA PP++GW +VT D+   +L++ LIIF+WTPPHFW+LA+
Sbjct: 142 VYTMYLKRATPQNIVIGGLAGAAPPLLGWTAVTNDIHAHALLLVLIIFIWTPPHFWALAI 201

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY +A IPMLP       TK  IL+YTVL +++ VLP ++G     Y I    L  
Sbjct: 202 HREKDYARAQIPMLPCTHGIEFTKTSILLYTVLLALICVLPYLIGMTGAIYLIGSSALNA 261

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
            F  +AW+    K   D     K F  SI +
Sbjct: 262 GFLYYAWKL---KFASDEHTAMKTFKFSIIH 289


>gi|310643841|ref|YP_003948599.1| protoheme ix farnesyltransferase [Paenibacillus polymyxa SC2]
 gi|309248791|gb|ADO58358.1| Protoheme IX farnesyltransferase [Paenibacillus polymyxa SC2]
          Length = 314

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 85/282 (30%), Positives = 155/282 (54%), Gaps = 1/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
              FI + KP ++   +  AF G  LA    +  +K ++++    +   +S   N Y+D 
Sbjct: 28  WKDFITVTKPGILRTNLVAAFGGFWLASQWDVDYIKLILTLLGTMLVMASSCVFNNYFDR 87

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  M RT +R +P G+++P       + L +  + ++       +  L  + +  YV 
Sbjct: 88  ELDLKMERTRNRSLPTGRLTPTTVLSYAIILGIVGLAVLFSFSGVKAGLLGILGMIVYVG 147

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR +  +  IGGI+GA+PP+IG+ + +G + + + ++F ++FLW PPHFW+LA+
Sbjct: 148 IYTLWLKRSSTWSTSIGGISGAMPPVIGYVAASGRIDMGAWLLFALLFLWQPPHFWALAI 207

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              ++Y+ A  P+LP V     TK+ ++ Y VL   V +L    G+A + + I+   L  
Sbjct: 208 RRVEEYRAAGFPLLPVVKGIHRTKIQMIPYIVLLIPVPILMYAYGYAGMIFMIVSVLLSV 267

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            +  +A++ F  KE++     KK+F  SI +L + F +++VD
Sbjct: 268 LWAFYAFKGFTIKEEETDSWAKKVFFFSINHLTLSFLLMIVD 309


>gi|260946263|ref|XP_002617429.1| hypothetical protein CLUG_02873 [Clavispora lusitaniae ATCC 42720]
 gi|238849283|gb|EEQ38747.1| hypothetical protein CLUG_02873 [Clavispora lusitaniae ATCC 42720]
          Length = 440

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 71/307 (23%), Positives = 133/307 (43%), Gaps = 16/307 (5%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           LN ++ L KP +  L   ++     ++P  +S+ +        A+ +G++ A+NM  + +
Sbjct: 121 LNPYVKLTKPNLTVLVTLSSICSYAISPNSVSITELAFLTLGTALCSGSANAINMGREPE 180

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            DK M RT+ RP+  G ++P +A+   +        I+   +N   + L F++I  Y  I
Sbjct: 181 FDKRMMRTSMRPVVTGLVTPRQAYQFALVTGAIGCTILCFGVNPTVSLLGFLNIGLYAWI 240

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  LKR +  N  +G + GAIPP++GWA+ +      S  +  +++ W  PHF +L+  
Sbjct: 241 YTS-LKRRSIVNTWVGAVVGAIPPLMGWAASSSLTHPGSWCLAALLYAWQFPHFNALSHN 299

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             + Y+ A   ++      +      L Y++L   +    +  G     + I        
Sbjct: 300 IAEQYKSAGY-VMAAAENPKLNARVALRYSLLMFPICFGLSYYGVTDWYFQIDSAIANAW 358

Query: 248 FTLWAWRTFLCKEDKDIR--------------VTKKLFLESITYLFVLFTILMVDHLIDM 293
            T+ A+R +  +     R                KKLF  S+  L  +  + M+      
Sbjct: 359 MTVLAYRFWNQQRKNHARGNHPTPEAIQMANFHAKKLFWCSVWQLPAVLILAMLHKKGQW 418

Query: 294 KTVERYF 300
             +E+Y 
Sbjct: 419 DRLEKYL 425


>gi|156977477|ref|YP_001448383.1| protoheme IX farnesyltransferase [Vibrio harveyi ATCC BAA-1116]
 gi|182639296|sp|A7N6I9|CYOE2_VIBHB RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|156529071|gb|ABU74156.1| hypothetical protein VIBHAR_06264 [Vibrio harveyi ATCC BAA-1116]
          Length = 304

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 167/286 (58%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + ++ L KP+V++L + TA VG+ LAP      L++   +  I + AG++ A N   D  
Sbjct: 18  STYLKLTKPKVVALMLITAVVGMSLAPVVDFPWLQAAFGLVGIGLMAGSAAAFNHLIDRR 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART  RP+P G  +P    +   +L V   V++   +N ++A + F+S+  Y V+
Sbjct: 78  IDARMARTHKRPLPSGDTNPISVAIFSTALGVIGFVLLYALVNPLTAWMTFLSLLGYAVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW++A+ 
Sbjct: 138 YTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWAIAIH 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K  IPMLP       TK  IL+YT+L ++V +LP ++G     Y      L   
Sbjct: 198 RVEDYRKVDIPMLPVTHGIEYTKTSILLYTILLTLVCILPVLVGMVGSVYLFSSLLLNAG 257

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AW+  L  E        + F  SI +L  LF  L+ DH + +
Sbjct: 258 FMYHAWKLKLSPEQNS---AMETFKFSIYHLLALFVALLADHYLGL 300


>gi|148545384|ref|YP_001265486.1| protoheme IX farnesyltransferase [Pseudomonas putida F1]
 gi|205716275|sp|A5VWP2|CYOE1_PSEP1 RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|148509442|gb|ABQ76302.1| protoheme IX farnesyltransferase [Pseudomonas putida F1]
          Length = 297

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 106/272 (38%), Positives = 155/272 (56%), Gaps = 4/272 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   ++ L KP+V+ L + T+  G+ LA    +S    +     I + AG +  +N   D
Sbjct: 11  RWRDYLELTKPKVVVLMLITSLAGMFLATRAGVSWSVLLFGNLGIGLCAGGAAVVNHVVD 70

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART  RP+  G++ P  A +  ++LA+  +V++ +  N ++A L   S+  Y 
Sbjct: 71  RRIDALMARTHKRPLAQGRVEPLPALLFALALALLGMVLLLVFTNALTAWLTLASLLGYA 130

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA
Sbjct: 131 VLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALA 190

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K++Y KA IPMLP    +R TK+HIL+YT++   V +LP  +  +   Y      LG
Sbjct: 191 IHRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVSLLPYAIHMSGPLYLACALGLG 250

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
             F  WAW  +              F  SI Y
Sbjct: 251 LRFLHWAWVLYRSSR---PHAAIGTFKYSIGY 279


>gi|163745859|ref|ZP_02153218.1| protoheme IX farnesyltransferase [Oceanibulbus indolifex HEL-45]
 gi|161380604|gb|EDQ05014.1| protoheme IX farnesyltransferase [Oceanibulbus indolifex HEL-45]
          Length = 312

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 130/284 (45%), Positives = 180/284 (63%), Gaps = 4/284 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +L  +  LLKPRVMSL ++TAFVG++ AP  ++ +    +I  IA+G GASGALNM++DA
Sbjct: 15  QLGDYFALLKPRVMSLVVFTAFVGLLAAPVSVNPIVGFCAILFIAIGGGASGALNMWWDA 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT  RPIP G++ P EA  LGV+L+  S++++GLA N ++A +L  +I  Y V
Sbjct: 75  DIDAVMRRTRGRPIPSGRVQPGEALTLGVALSGLSVMMLGLATNLLAAGMLLFTILFYAV 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT+WLKR TPQNIVIGG AGA PP+IGW + TG  S+ + +MF +IF+WTPPHFW+LAL
Sbjct: 135 FYTMWLKRLTPQNIVIGGAAGAFPPVIGWVAATGSFSVEAWLMFALIFMWTPPHFWALAL 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY  A +PML        T++HILIYTVL + + +         + Y  +   L  
Sbjct: 195 FMRSDYDDAKVPMLTVTHGRPATRLHILIYTVLLAALAIGTAFTAIGGIFYFAVALVLNA 254

Query: 247 HFTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILM 286
            F L AWR +       E  D    +K F  S+ YLF+ F  ++
Sbjct: 255 AFLLGAWRIWNRDEVMAEADDYAEERKFFRLSLAYLFLHFGAIL 298


>gi|332188220|ref|ZP_08389948.1| protoheme IX farnesyltransferase [Sphingomonas sp. S17]
 gi|332011719|gb|EGI53796.1| protoheme IX farnesyltransferase [Sphingomonas sp. S17]
          Length = 292

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 134/285 (47%), Positives = 186/285 (65%), Gaps = 2/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F+ L KPRVM+L ++T   G++ AP  I  +    +I  IA+GAGA+GALN +Y+AD
Sbjct: 7   WRDFLALTKPRVMTLVVFTGLCGMLAAPVGIDPVIGFTAILCIALGAGAAGALNQWYEAD 66

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           +D +M RTA RP+P G++S   A   GV LA  S+++MGLA+N+V+A +L +SI  YV++
Sbjct: 67  LDALMRRTAKRPLPAGRMSRESALHFGVGLACFSVLLMGLAVNYVAAGILTVSILFYVLV 126

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA PP+IGWA+ TG++++   ++F ++FLWTPPHFW+LAL 
Sbjct: 127 YTVWLKRRTPQNIVIGGAAGAFPPLIGWAAATGEIALLPFLLFSLVFLWTPPHFWALALF 186

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY  A +PMLP V  +R T+  I +YT+  +I  V P  LG     YGII       
Sbjct: 187 VKTDYANAGVPMLPVVAGERVTRAQIGLYTIPMAIAAVAPWPLGLTGPIYGIIATAGTAL 246

Query: 248 FTLWA--WRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F L+A        + D  ++  K+LF  SI YLF+LF  L+VD  
Sbjct: 247 FGLYAAIVAFRHTQPDDAMKPEKRLFKYSILYLFLLFGALVVDRW 291


>gi|308070657|ref|YP_003872262.1| Protoheme IX farnesyltransferase (Heme O synthase) [Paenibacillus
           polymyxa E681]
 gi|305859936|gb|ADM71724.1| Protoheme IX farnesyltransferase (Heme O synthase) [Paenibacillus
           polymyxa E681]
          Length = 314

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 87/282 (30%), Positives = 156/282 (55%), Gaps = 1/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
              FI + KP ++   +  AF G  LA    +  +K ++++    +   +S   N Y+D 
Sbjct: 28  WKDFITVTKPGILRTNLVAAFGGFWLASQWDVDYIKLILTLLGTMLVMASSCVFNNYFDR 87

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  M RT +R +P G+++P       + L V  + ++       +  L  + +F YV 
Sbjct: 88  ELDLKMERTRNRSLPTGRLTPTTVLSYAIILGVVGLAVLFFFSGVKAGLLGLLGMFVYVG 147

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+WLKR +  +  IGGI+GA+PP+IG+ + +G + + + ++F ++FLW PPHFW+LA+
Sbjct: 148 IYTLWLKRSSTWSTSIGGISGAMPPVIGYVAASGRIDMGAWLLFALLFLWQPPHFWALAI 207

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              ++Y+ A  P+LP V     TK+ ++ Y VL   V +L    G+A + + I+   L  
Sbjct: 208 RRVEEYRAAGFPLLPVVKGIHRTKIQMIPYIVLLIPVPILMYAYGYAGMIFMIVSVLLSV 267

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            +  +A++ F  KE++     KK+F  SI +L + F +++VD
Sbjct: 268 LWAFYAFKGFTIKEEETDSWAKKVFFFSINHLTLSFLLMIVD 309


>gi|91975296|ref|YP_567955.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris BisB5]
 gi|123722146|sp|Q13CY5|COXX_RHOPS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|91681752|gb|ABE38054.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 313

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 137/294 (46%), Positives = 196/294 (66%), Gaps = 3/294 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ LLKPRVMSL ++TA VG++LAPG    + +V ++  IA+G GA+GALNM+Y+ D
Sbjct: 21  VADYVALLKPRVMSLVVFTALVGMLLAPGDFHPVLAVTAMLCIAVGGGAAGALNMWYEND 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA+RPIP G+++  EA   G++L+  S+V +G+ +NW++A LL  +IF YVVI
Sbjct: 81  IDALMTRTANRPIPRGRVTRPEALTFGMTLSFFSVVTLGVLVNWIAAALLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR T QNIVIGG AGA+PP++ WA+VTG +++  L++F IIF WTPPHFW+LAL 
Sbjct: 141 YTMWLKRSTAQNIVIGGAAGALPPVVAWAAVTGSLAVEPLLLFAIIFFWTPPHFWALALF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   V   P  LG+    YGI    LG  
Sbjct: 201 RNDDYARAGVPMLPVVAGPDHTRLQILLYTIVLVAVAAAPWPLGYFDAVYGIASLALGGW 260

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
             + A R +  +         + LF  SI YLF LF+IL+++  +  K V + F
Sbjct: 261 MLVLAIRVYRHRSGSAALRATRNLFKFSILYLFALFSILLIE--VVAKAVWQLF 312


>gi|182641982|sp|Q0ABY1|CYOE_ALHEH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 302

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 118/287 (41%), Positives = 169/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L ++TA VG+ LA PG +  +   +    IA+ AG++ ALN   D 
Sbjct: 15  WRDYLTLTKPRVVVLMVFTAIVGMFLASPGQVPWVALTVGSLGIALAAGSAAALNHLADQ 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+P G + P +       L V+ + ++ L IN ++A L F S+  Y +
Sbjct: 75  RIDAIMARTRRRPLPSGHLRPLQVLGFSSLLGVAGLGMLALWINPLTAALTFASLIGYAL 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG AGA PP++GW +VTG V   +L++FLI+F+WTPPHFW+LA+
Sbjct: 135 VYTLYLKRATPQNIVIGGAAGAAPPLLGWTAVTGSVDAHALLLFLIVFVWTPPHFWALAV 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY++A +PMLP V  +R T+  IL+YTVL   V +LP         Y      LG 
Sbjct: 195 ARLKDYERADVPMLPVVYGERFTRWQILLYTVLLLAVSLLPWATFMGGWLYLAAAVGLGG 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            + +   R  L       R+  + F  SI YLF LF  L+VD  + +
Sbjct: 255 WYLMLNVRLLLT---PGPRLPMRSFRFSIIYLFGLFAALLVDRQLPV 298


>gi|317403155|gb|EFV83681.1| protoheme IX farnesyltransferase [Achromobacter xylosoxidans C54]
          Length = 297

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 107/287 (37%), Positives = 162/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  + VL KPRV  LA++ A +G+ LA PG   + + +     I + A A+ A+N   + 
Sbjct: 13  LRQYFVLTKPRVTQLAVFCAVIGMFLAVPGVPDMRRVLFGTLGIWLLAAAAFAINCLIEQ 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  M RTA R    G IS ++   L   L  + + ++   +N ++  L F +   Y V
Sbjct: 73  EVDARMLRTARRATARGTISAYQVLGLSGLLGGAGMFVLYTLVNPLTMWLTFATFVGYAV 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + ++ LIIF+WTPPHFW+LAL
Sbjct: 133 IYTVILKPRTPQNIVIGGLSGAMPPALGWAAVADSVPAEAWLLVLIIFIWTPPHFWALAL 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA +PMLP     + T++ IL+Y++      +LPT +  +   Y      LG 
Sbjct: 193 YRNHDYVKAGLPMLPVTHGQQFTRLQILLYSIALVATTLLPTAIRMSGALYLASALVLGG 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +AWR +    D+   + + +F  SI YL +LF  L+VDH + +
Sbjct: 253 MFVSYAWRLYRNYSDE---LARSMFRFSILYLALLFGALLVDHWVAL 296


>gi|253995919|ref|YP_003047983.1| protoheme IX farnesyltransferase [Methylotenera mobilis JLW8]
 gi|253982598|gb|ACT47456.1| protoheme IX farnesyltransferase [Methylotenera mobilis JLW8]
          Length = 310

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 171/288 (59%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           RL  F  L KPRV SL ++TA +G+ LA P  + +L  + +   IA  +GA+ A N   +
Sbjct: 26  RLKNFFPLCKPRVTSLIVFTALIGMFLATPSMVPLLLLIATTLGIAFASGAAAAFNCLIE 85

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID  MART +RP+P GQ+S  E  +    L  + + I+   +N ++  L   +   Y 
Sbjct: 86  HKIDANMARTRARPLPTGQVSSNETMIFATLLGSAGLAILYFYVNPLTMWLTLATFVGYA 145

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYTI+LK  TP NIVIGG +GA+PP++GWA+VT  VS  SL+MFLIIF WTPPHFW+LA
Sbjct: 146 VIYTIFLKPATPMNIVIGGASGAMPPILGWAAVTNTVSPESLIMFLIIFAWTPPHFWALA 205

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  +++Y K  +PMLP    +  T +HIL+YTV+   V ++P  LG + V Y   V  L 
Sbjct: 206 LYRREEYAKVGMPMLPVTHGENFTLLHILLYTVILVAVSLMPYGLGMSGVIYLCSVLLLD 265

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F  +  + +L   D    + K+ F  SI YL +LF  L++DH + +
Sbjct: 266 AIFMAYVIKLYLHYSD---ALAKRTFRYSIIYLTLLFAGLLIDHYLPL 310


>gi|307825706|ref|ZP_07655923.1| protoheme IX farnesyltransferase [Methylobacter tundripaludum SV96]
 gi|307733283|gb|EFO04143.1| protoheme IX farnesyltransferase [Methylobacter tundripaludum SV96]
          Length = 295

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 172/287 (59%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L ++TA  G++LA PG   +   + S   IA+ A ++ A+N Y D 
Sbjct: 10  WKSYLELCKPKVVALIVFTAIAGMLLAVPGMPPIGLFIYSSLGIALAAASAAAINHYIDR 69

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           + D +M R  +RP+P G++S        ++L V S+ ++ + +N ++A L F+S   Y +
Sbjct: 70  EADALMDRNKNRPLPKGELSSTNVITFALALGVISMALLLVMVNALTALLTFLSALGYAI 129

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVI G  GA PPM+GW ++TG++   SL++FLIIF WTPPHFW L++
Sbjct: 130 IYTVYLKRATPQNIVIAGAFGATPPMLGWCAMTGELHPYSLLLFLIIFAWTPPHFWPLSI 189

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + ++ K  IPMLP       T++HIL+Y++L  IV +LP + G + + Y   V  LG 
Sbjct: 190 AKRKEFAKVGIPMLPVTHGVEYTRLHILLYSLLLFIVTLLPYLTGMSGLIYLSAVVPLGL 249

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +A      K+D   +   + F  S+ YL VLF  L++DH    
Sbjct: 250 GFIYFAILMMRRKDD---KTAMRTFFYSLMYLTVLFIALLIDHYFKF 293


>gi|146294871|ref|YP_001185295.1| protoheme IX farnesyltransferase [Shewanella putrefaciens CN-32]
 gi|182639286|sp|A4YC13|CYOE1_SHEPC RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|145566561|gb|ABP77496.1| protoheme IX farnesyltransferase [Shewanella putrefaciens CN-32]
 gi|319424549|gb|ADV52623.1| protoheme IX farnesyltransferase [Shewanella putrefaciens 200]
          Length = 301

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  + KP+V++L + T  VG+ LA P  + V   +  +F IA+ AG++ ALN   D 
Sbjct: 18  WRAYFEMTKPKVVALMLLTVLVGMCLAVPTAVPVQPLIAGMFGIALMAGSAAALNHLIDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID MMART +RP+P G++S   A +   S+     V++ + +N ++A L F S+  Y +
Sbjct: 78  RIDGMMARTYNRPLPKGRVSAKRALIFAASIGGLGFVVLYVLVNPLTAWLTFASLIGYAL 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR T QNIVIGG+AGA+PP++GW +VT      +L++ +IIF WTPPHFW+LA+
Sbjct: 138 VYTAYLKRATSQNIVIGGLAGAMPPLLGWTAVTNQFHGHALLLVIIIFTWTPPHFWALAI 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + +Y K  IPMLP       TK  IL+YTVL +I  +LP ++G     Y +    L  
Sbjct: 198 HRRAEYAKVDIPMLPVTHGVEFTKTCILLYTVLLAIACLLPVLVGMCGPMYFVCSSLLSS 257

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW+      D    +  ++F  SI +L +LF  L++DH +
Sbjct: 258 VFIYKAWQLKYRDRDG---LAMQVFRFSIYHLMLLFMALLIDHYL 299


>gi|292655173|ref|YP_003535070.1| heme synthase [Haloferax volcanii DS2]
 gi|291370227|gb|ADE02454.1| heme synthase [Haloferax volcanii DS2]
          Length = 468

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 95/286 (33%), Positives = 151/286 (52%), Gaps = 7/286 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYY 64
           +N +  L+KPR+M L    A   + LA      ++      ++    +  GASG  N   
Sbjct: 185 VNAYFRLMKPRLMWLLCLVASAAMALAGTVSPGLTPEVIAATLGGGVLSIGASGTFNHVL 244

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           + D+D+ M RT+ RP+ +  +    A   G+ L V+S+  +  ++NW++A L  ++I  Y
Sbjct: 245 ERDVDRRMQRTSDRPLAVDLVPVRNAVAFGLLLTVASV-ALFASVNWLAAVLGVVAIAFY 303

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LK  T QN VIGG AGA+P +IGW +VTGDV +  +V+ ++IF+WTP HF++L
Sbjct: 304 SVVYTLILKPNTVQNTVIGGAAGALPALIGWVAVTGDVGLGGVVLAVVIFMWTPAHFYNL 363

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  KDDY +   PM+P V  +  T+ HIL +   T +      ++    V Y +     
Sbjct: 364 ALAYKDDYARGGFPMMPVVRGETETRKHILWWLGATLVAAAGLAVMDALGVVYLVTSILF 423

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           G  F  +  R      ++D     + F  S  YL +L   ++VD L
Sbjct: 424 GGAFLYFVVRLHY---ERDDTAAFRAFHASNAYLGMLLLAIVVDTL 466


>gi|313496481|gb|ADR57847.1| Protoheme IX farnesyltransferase 1 [Pseudomonas putida BIRD-1]
          Length = 297

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 106/272 (38%), Positives = 155/272 (56%), Gaps = 4/272 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   ++ L KP+V+ L + T+  G+ LA    +S    +     I + AG +  +N   D
Sbjct: 11  RWRDYLELTKPKVVVLMLITSLAGMFLATRAGVSWSVLLFGNLGIGLCAGGAAVVNHVVD 70

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART  RP+  G++ P  A +  ++LA+  +V++ +  N ++A L   S+  Y 
Sbjct: 71  RRIDALMARTHKRPLAQGRVEPLPALLFALALALLGMVLLLVFTNALTAWLTLASLLGYA 130

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA
Sbjct: 131 VLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALA 190

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K++Y KA IPMLP    +R TK+HIL+YT++   V +LP  +  +   Y      LG
Sbjct: 191 IHRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVSLLPYAIHMSGPLYLACALGLG 250

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
             F  WAW  +              F  SI Y
Sbjct: 251 LRFLRWAWVLYRSSR---PHAAIGTFKYSIGY 279


>gi|188591089|ref|YP_001795689.1| protoheme ix farnesyltransferase [Cupriavidus taiwanensis LMG
           19424]
 gi|170937983|emb|CAP62967.1| PROTOHEME IX FARNESYLTRANSFERASE (HEME O SYNTHASE) TRANSMEMBRANE
           PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 314

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 28  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWPVLIGGAAGIWLLAGAAFAINCLVEQK 87

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  V    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 88  IDALMRRTAWRPSATGEITTRQTLVFSAILGGAGMWLLHVYANDLTMWLTFATFLGYAVV 147

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GWA+V G+V   +  + LIIF WTPPHFW+LAL 
Sbjct: 148 YTILLKPATPQNIVIGGLSGAMPPALGWAAVAGEVPAEAWFLVLIIFTWTPPHFWALALY 207

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    +R T +HIL+YT++     +LP + G +   Y      LG  
Sbjct: 208 RRADYAKSGLPMLPVTHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLAAALALGAG 267

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AW+ +    D+   + ++ F  SI YL +LF  L+VDH    
Sbjct: 268 FLAYAWKLYRNYSDE---LAQRTFRFSILYLSLLFAALLVDHYFKF 310


>gi|156842063|ref|XP_001644401.1| hypothetical protein Kpol_1064p24 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115043|gb|EDO16543.1| hypothetical protein Kpol_1064p24 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 458

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 71/312 (22%), Positives = 135/312 (43%), Gaps = 24/312 (7%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   S+ + +      ++ +GA+ A+NM  + D
Sbjct: 140 IQPYLQLTKPRLTMLVMLSAICSYALSPYSASISELMCLTIGTSLCSGAANAINMGREPD 199

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +++    +L ++ + I+ + +N   A L   +I  Y  I
Sbjct: 200 FDRQMVRTQARPVVSGVVTPIQSFKFATALGIAGVSILNIGVNPTVAILGASNIALYSWI 259

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  LKR    N  +G + GAIPP++GWA+ +      S  +  +++ W  PHF +L+  
Sbjct: 260 YTS-LKRKHIINTWVGALVGAIPPLMGWAAASPLTHPGSWCLAGLLYAWQFPHFNTLSHN 318

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K++Y+ A   M              L Y++L   +    +        Y +        
Sbjct: 319 IKNEYKNAGYIMTAWKN-PLLNARVSLRYSLLMFPLCFGLSYFNVTDWYYQVDSGIFNAW 377

Query: 248 FTLWAWRTFLCKEDKDIR------------------VTKKLFLESITYLFVLFTILMVDH 289
            + WA++ +L +     +                    +K F  SI +L  +  + ++  
Sbjct: 378 MSFWAFKFYLQQRSNYSKEIFGDKTKFNKGIALANVYARKTFWVSIFHLPAVLILAILHK 437

Query: 290 LIDMKTVERYFF 301
               K     FF
Sbjct: 438 ----KGRWDSFF 445


>gi|77361768|ref|YP_341343.1| polyprenyltransferase [Pseudoalteromonas haloplanktis TAC125]
 gi|123589023|sp|Q3IJQ0|CYOE2_PSEHT RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|76876679|emb|CAI87901.1| Polyprenyltransferase [Pseudoalteromonas haloplanktis TAC125]
          Length = 309

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 105/287 (36%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ + K +V+++ + TA+VG+ LAP     +    IS+  I + + A+  +N   D+
Sbjct: 26  LQDYLAISKFKVVAMLVLTAWVGLALAPDVGRGMGVQFISLLGIGLLSAAAAVINHVVDS 85

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  MART  RP+  G++S   A      + V+  +++ L  N ++A L   ++  Y  
Sbjct: 86  EIDSKMARTRHRPVAKGRLSKAHALSFAAIIGVAGFIMLMLWANTLTAILTLFALVGYAF 145

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA+PP++GW S TG ++ A  ++ +IIF WTPPHFW+LA+
Sbjct: 146 VYTSFLKRATPQNIVIGGLAGAMPPLLGWVSETGQMAAAPWLLVMIIFTWTPPHFWALAI 205

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY +A IPMLP       +K  ++ Y+VL +IV + P ++G + + Y I    L  
Sbjct: 206 ARKSDYARAKIPMLPVTHGIDFSKTCVVAYSVLLAIVCIFPYLIGMSGLIYLIGASGLNA 265

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A +  L   D        LF  SI +L VLF IL +D  + +
Sbjct: 266 VFIYKAIKLKLAANDDT---AMDLFRFSIIHLMVLFIILFIDKWLLL 309


>gi|329940804|ref|ZP_08290084.1| protoheme IX farnesyltransferase [Streptomyces griseoaurantiacus
           M045]
 gi|329300098|gb|EGG43996.1| protoheme IX farnesyltransferase [Streptomyces griseoaurantiacus
           M045]
          Length = 289

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 108/287 (37%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             F+ L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D D
Sbjct: 2   KAFVALTKPRIIELLLITTVPVMFLAQQGVPDLGLVLLTCLGGYLSAGGANALNMYIDRD 61

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT+ RP+  G + PWE  V G+ LAV S ++ GL +NW+SA L   ++  YVV+
Sbjct: 62  IDALMERTSKRPLVTGIVRPWECLVFGIGLAVVSTLLFGLTVNWLSAWLALGALLFYVVV 121

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIV GGIAG +P +IGW+SVT  VS A +V+FL++F WTPPH+W L++ 
Sbjct: 122 YTMILKRRTSQNIVWGGIAGCMPVLIGWSSVTNTVSYAPIVLFLVMFFWTPPHYWPLSMK 181

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            KDDY +  +PMLP + +++     I++Y+ +     +L T LG+    Y  +    G  
Sbjct: 182 VKDDYARVGVPMLPVIASNKVVARQIVLYSWVMVGASLLLTPLGYTGWFYFAVALAAGGM 241

Query: 248 FTLWAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
           +   A       + +         +LF  SITY+ ++F  + VD  +
Sbjct: 242 WLWEAHALMNRAKAEVTGAKLKEMRLFHWSITYVSIVFVAVAVDPFL 288


>gi|170724540|ref|YP_001758566.1| protoheme IX farnesyltransferase [Shewanella woodyi ATCC 51908]
 gi|205716317|sp|B1KM58|CYOE1_SHEWM RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|169809887|gb|ACA84471.1| protoheme IX farnesyltransferase [Shewanella woodyi ATCC 51908]
          Length = 302

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 115/286 (40%), Positives = 172/286 (60%), Gaps = 4/286 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   +  + KP+V++L + T  VG+ LA PG + +   +  +  I M AGA+ A N   D
Sbjct: 18  QWRAYYEMTKPKVVALMLLTVLVGMCLALPGAVPLQPLIFGLLGIGMMAGAAAAFNHLID 77

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +MART +RP+P G++S  +A    +SLAV   V++   +N ++A L F S+  Y 
Sbjct: 78  RRIDGLMARTYNRPLPKGRVSITKALTFSISLAVLGFVLLYTLVNELTAWLTFASLLGYA 137

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT +LKR TPQNIV+GG+AGA+PP++GW SVTG+    +L++ +IIF WTPPHFW+LA
Sbjct: 138 VVYTAYLKRATPQNIVVGGLAGAMPPLLGWTSVTGEFHGNALLLVIIIFAWTPPHFWALA 197

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  K +Y K  IPMLP       TK  IL+YT+L +I  +LP ++G     Y +    L 
Sbjct: 198 IHRKAEYAKVDIPMLPVTHGTEFTKTCILLYTILLAIACLLPVLVGMCGPLYLVGSTLLS 257

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F   +W     K D    +  ++F  SI +L +LF +L+VDH +
Sbjct: 258 CGFIYKSWEL---KFDDKPGLAMQVFRFSIYHLMLLFIVLLVDHYL 300


>gi|146305191|ref|YP_001185656.1| protoheme IX farnesyltransferase [Pseudomonas mendocina ymp]
 gi|205716426|sp|A4XNK8|CYOE_PSEMY RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|145573392|gb|ABP82924.1| protoheme IX farnesyltransferase [Pseudomonas mendocina ymp]
          Length = 299

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 117/287 (40%), Positives = 165/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T+ VG+ LA    +     +     I + AGA+ A+N   D 
Sbjct: 14  WRDYLELTKPRVVLLMLITSLVGMFLATRAGVPWTVLLFGNLGIGLCAGAAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    + LA + + ++ L  N ++A L   S+  Y V
Sbjct: 74  RIDSIMARTHKRPVTAGRVSPAAAIAFALLLATAGMGLLLLFTNQLAAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW +VTG +S   L++ LIIF WTPPHFW+LA+
Sbjct: 134 IYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGHLSAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K +Y KA IPMLP    +  TK+HIL+YT++   V +LP  +  +   Y +    LG 
Sbjct: 194 HRKAEYAKADIPMLPVTHGEHYTKVHILLYTLVMFAVTLLPYAIHMSGPLYLVCALLLGA 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +    D         F  SI YLF+LF  L+ DH + +
Sbjct: 254 RFLHWAWVLY---RDSKPHAAINTFKYSIWYLFLLFIALLADHYLLL 297


>gi|292490238|ref|YP_003525677.1| protoheme IX farnesyltransferase [Nitrosococcus halophilus Nc4]
 gi|291578833|gb|ADE13290.1| protoheme IX farnesyltransferase [Nitrosococcus halophilus Nc4]
          Length = 299

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 109/289 (37%), Positives = 168/289 (58%), Gaps = 4/289 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           +     ++VL KPR++SL ++TA VG+ L+ P        ++    I +GA ++ A+N  
Sbjct: 11  LTNWREYLVLCKPRIVSLIVFTAIVGMFLSVPELAPWQVFLLGSLGIGLGAASAAAINHL 70

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D   D +MART  RP+P G+I   +A    + L + S+ I+   +N ++A L   S+F 
Sbjct: 71  IDEKADALMARTQGRPLPSGKIDREQALAFAIMLGLLSMAILYFLVNPLTAWLTLASMFG 130

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y +IYT +LKR TPQNIV+GG AGA+PP++GW +VTG++ + + ++FLIIF+WTPPHFW+
Sbjct: 131 YGIIYTAFLKRATPQNIVLGGAAGAMPPVLGWTAVTGELHVHAFLLFLIIFVWTPPHFWA 190

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL  +++Y +A+ PMLP       TK  +++YT L   V +LP +   + + Y +    
Sbjct: 191 LALARREEYSRANFPMLPVTHGIDFTKQQVVLYTFLLFAVSLLPFVSQMSGLVYLVGAVG 250

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           LG  F   A   +         +  K F  SI YL  LF  L+VDH + 
Sbjct: 251 LGGRFLYLALALY---RHTSNELAMKTFGYSIFYLAALFAFLLVDHYLP 296


>gi|269126449|ref|YP_003299819.1| protoheme IX farnesyltransferase [Thermomonospora curvata DSM
           43183]
 gi|268311407|gb|ACY97781.1| protoheme IX farnesyltransferase [Thermomonospora curvata DSM
           43183]
          Length = 328

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 106/288 (36%), Positives = 158/288 (54%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFA-IAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L + T    + LA G +  + + ++  A   M AGA+ A+N + D 
Sbjct: 39  VGAYVALTKPRVIELLLITTLPAMFLAAGGLPPVGTALATLAFGTMSAGAANAINCFIDR 98

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+   Q+SP  A   G+ LA++S     LA+N ++A L   +I  YV 
Sbjct: 99  DIDAKMRRTRRRPLARAQVSPAGALTFGIVLAIASTAGFVLAVNALAAALSAGAIVYYVF 158

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR T QN+V GGIAG +P +IGWA+VT  ++ A  V+F+++F WTPPH W+LA+
Sbjct: 159 VYSLLLKRRTAQNVVWGGIAGCMPVLIGWAAVTESLAAAPFVLFMVVFWWTPPHTWTLAM 218

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PMLP V  +R   +  L+YT  T I  +L   +   SV YG +   LG 
Sbjct: 219 RYREDYAVAGVPMLPVVAGERRVVIESLLYTWATVIFSLLLWPVAGMSVAYGAVAAVLGG 278

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F     R                 + F  S  YL +LFT + +D L+
Sbjct: 279 VFLAEGHRLLRDVRAGVSGVKLRPMRFFHLSNVYLALLFTAVALDPLL 326


>gi|153833249|ref|ZP_01985916.1| protoheme IX farnesyltransferase [Vibrio harveyi HY01]
 gi|148870520|gb|EDL69435.1| protoheme IX farnesyltransferase [Vibrio harveyi HY01]
          Length = 304

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 110/286 (38%), Positives = 168/286 (58%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + ++ L KP+V++L + TA VG+ LAP      L++V  +  I + AG++ A N   D  
Sbjct: 18  STYLKLTKPKVVALMLITAVVGMSLAPVVDFPWLQAVNGLIGIGLMAGSAAAFNHLIDRR 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART  RP+P G  +P    +   +L V   V++   +N ++A + F+S+  Y V+
Sbjct: 78  IDARMARTHKRPLPSGDTNPISVAIFSTALGVIGFVLLYALVNPLTAWMTFLSLLGYAVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+ 
Sbjct: 138 YTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWALAIH 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K  IPMLP       TK  IL+YT+L ++V +LP ++G     Y      L   
Sbjct: 198 RVEDYRKVDIPMLPVTHGIEYTKTSILLYTILLTLVCILPVLVGMVGSVYLFSSLLLNAG 257

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AW+    K   +     + F  SI +L  LF  L+ DH + +
Sbjct: 258 FMYHAWKL---KFSPEQNSAMETFKFSIYHLLALFVALLADHYLGL 300


>gi|109900536|ref|YP_663791.1| protoheme IX farnesyltransferase [Pseudoalteromonas atlantica T6c]
 gi|123064015|sp|Q15N01|CYOE2_PSEA6 RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|109702817|gb|ABG42737.1| protoheme IX farnesyltransferase [Pseudoalteromonas atlantica T6c]
          Length = 305

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 156/271 (57%), Gaps = 4/271 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  + KP+V+ L + TA VG+ LA    IS    +  +  I   + A+  +N   D 
Sbjct: 20  WRDYYEMTKPKVVMLLLLTALVGMCLASETWISWKILLAGLTGIGFLSSAAAVINHVVDR 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART++RP+P G++SP  A V    L V   +I+ L +N ++A L   S+  Y  
Sbjct: 80  KIDAQMARTSNRPMPKGKVSPQRALVFAGVLTVVGYLILELWVNRLTALLTLASLVGYAF 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG+AGA PP++GW +VT D+   +L++ LIIF+WTPPHFW+LA+
Sbjct: 140 IYTMYLKRATPQNIVIGGLAGAAPPLLGWTAVTNDIHAHALLLVLIIFIWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY +A IPMLP       TK  IL+YTVL +++ VLP ++G     Y +    L  
Sbjct: 200 HREKDYARAKIPMLPCTHGIEFTKTSILLYTVLLALISVLPYLIGMTGAIYLLGSSALNA 259

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
            F  +AW+    K   D     K F  SI +
Sbjct: 260 GFLYYAWKL---KFASDEHTAMKTFKFSIIH 287


>gi|186685582|ref|YP_001868778.1| protoheme IX farnesyltransferase [Nostoc punctiforme PCC 73102]
 gi|186468034|gb|ACC83835.1| protoheme IX farnesyltransferase [Nostoc punctiforme PCC 73102]
          Length = 317

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 169/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +  L  ++++    + A ++  +N  YD 
Sbjct: 17  IQSYYQLTKPRIIPLLLITTAGSMWIAAKGEVDPLLLLVTLTGGTLAAASAQTINCVYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RPIP G++ P +A +  ++LA  S  ++ +  N ++A L F  I  Y++
Sbjct: 77  DIDYDMERTRHRPIPSGKVQPRDALIFAIALATISFTLLAVFANLLAALLAFSGIVFYIL 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR TPQNIV+GG AGAIP ++GWA+VTG +S ++ ++F I+FLWTPPHFW+LAL
Sbjct: 137 VYTHWLKRHTPQNIVVGGAAGAIPALVGWAAVTGTLSWSAWLIFAIVFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVL-TSIVGVLPTMLGFASVTYGIIVFFLG 245
           + KDDY K  IPMLP +     T   I  YT++      +L   LG + + Y  I   LG
Sbjct: 197 MIKDDYAKVGIPMLPVIEGTTATVKQIWYYTLVTVFATVLLVYPLGASGILYAAIALILG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   +WR    +  +D  V K+LFL SI+Y+ +L   ++VD L
Sbjct: 257 GLFIHKSWRL--LQNPEDRAVAKELFLFSISYMMLLCLGMVVDSL 299


>gi|239993291|ref|ZP_04713815.1| protoheme IX farnesyltransferase [Alteromonas macleodii ATCC 27126]
          Length = 305

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 112/287 (39%), Positives = 167/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  + KP V+ L + TA VG+ LA P  ++    +  +  I M + ++  +N   D 
Sbjct: 20  WRDYYEMTKPNVVMLLLLTALVGMCLATPSWVNATVLICGLLGIGMLSASAAVINHVVDH 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART +RP+  G++S   A      L V   V++ L +N ++A L   S+  Y  
Sbjct: 80  KIDSVMARTFNRPVAKGKVSVNNALWFAGVLGVVGFVVLALFVNMLTAWLTLASLVGYAF 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG+AGA PP++GW +VTG++   +L++ LIIF WTPPHFW+LA+
Sbjct: 140 IYTMYLKRATPQNIVIGGLAGAAPPLLGWTAVTGEIHAHALLLVLIIFTWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY KA +PMLP       TK  +L+YTVL  +V +LP + G + + Y I    L  
Sbjct: 200 HREKDYAKAKVPMLPVTHGVSFTKTSVLLYTVLLGLVCLLPYLTGMSDLIYLIGSSVLNI 259

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +A +    K D + +   K F  SI +L VLF +L++DH I +
Sbjct: 260 GFLYYALKL---KFDAEPQTAMKTFRFSIIHLMVLFVVLLLDHYIPL 303


>gi|15605727|ref|NP_213104.1| cytochrome c oxidase assembly factor [Aquifex aeolicus VF5]
 gi|6225197|sp|O66544|COXX_AQUAE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|2982886|gb|AAC06505.1| cytochrome c oxidase assembly factor [Aquifex aeolicus VF5]
          Length = 292

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 102/282 (36%), Positives = 162/282 (57%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++VL KP ++SL + T   G+ L   G +       ++    + A  S  LNM  D 
Sbjct: 12  IKEYLVLTKPGIVSLVLITTLGGMYLGSRGELQPELVFWTLLGTGLAAAGSAVLNMVIDK 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DIDK+M RT+ RP+P G + P +A++ G++L V S+VIM   +  + A L+ ++ F YV+
Sbjct: 72  DIDKLMVRTSERPLPKGTVDPTKAFIFGITLQVFSLVIMLTFVGVLPALLVALASFSYVI 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++ LKR +P    IGGI+GA+PP+IG+ + +G V I ++ +FL++F+W PPHFW LAL
Sbjct: 132 LYSLLLKRKSPVATEIGGISGALPPVIGYVAASGSVDINAIALFLLMFMWQPPHFWVLAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              DDY++A IP LP       TK+  L+YT     V ++P + G     Y ++   +  
Sbjct: 192 KYADDYKRAGIPTLPVARGVFITKLKTLLYTASLFPVSLIPYLTGLVENLYFVVAVVMNL 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            +     + F  K+++      KLF  SI YL VLF  ++VD
Sbjct: 252 IYLGLTLKFFFSKKEES----MKLFFFSIIYLAVLFGTMIVD 289


>gi|331005454|ref|ZP_08328833.1| Heme O synthase, protoheme IX farnesyltransferase [gamma
           proteobacterium IMCC1989]
 gi|330420730|gb|EGG95017.1| Heme O synthase, protoheme IX farnesyltransferase [gamma
           proteobacterium IMCC1989]
          Length = 302

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 114/284 (40%), Positives = 173/284 (60%), Gaps = 4/284 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + T+ +G++LA PG + +         IA+ AG++ A+N   D 
Sbjct: 15  WRDYLELCKPKVVALMLLTSLIGMLLAVPGFVPLDIVFWGNLGIALCAGSAAAINHLVDR 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID+ M RT +RPI  G++ P  A +    + ++ + I+ + +N ++A L   S+  Y +
Sbjct: 75  QIDQKMKRTLNRPIAKGRVEPMNAVIFAFLIGLAGMAILLIFVNALTAWLTLASLVGYAL 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG+AGA PP++GW +VT  +   +L++ LIIF WTPPHFW+LA+
Sbjct: 135 IYTLFLKRATPQNIVIGGLAGAAPPLLGWTAVTNSIDGHALLLVLIIFAWTPPHFWALAV 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY KA IPMLP    ++ TK+HI++YT++  +V VLP + G     Y      LG 
Sbjct: 195 HRKDDYAKADIPMLPVTHGEQYTKVHIVLYTIIMILVTVLPYITGMFHELYLAGALLLGA 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
            F  W+    L   +K      K F  SITYL VLF ++++DH 
Sbjct: 255 GFLYWSVVMLL---NKHPDAPMKTFKYSITYLMVLFVVMLLDHY 295


>gi|269959950|ref|ZP_06174327.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835249|gb|EEZ89331.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 304

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 169/286 (59%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + ++ L KP+V++L + TA VG+ LAP      L++ I +  I + AG++ A N   D  
Sbjct: 18  STYLKLTKPKVVALMLITAIVGMSLAPVASFPWLQAAIGLIGIGLMAGSAAAFNHLIDRR 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART  RP+P G  +P    +  V+L V   V++   +N ++A + F+S+  Y V+
Sbjct: 78  IDARMARTHRRPLPSGDTNPLSVALFAVTLGVVGFVLLYGLVNPLTAWMTFLSLLGYAVV 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+ 
Sbjct: 138 YTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWALAIH 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K  IPMLP       TK  IL+YTVL ++V +LP ++G     Y      L   
Sbjct: 198 RVEDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCILPVLVGMVGSVYLFSSLLLNIG 257

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AW+    K   +     + F  SI +L  LF  L+ DH + +
Sbjct: 258 FMYHAWKL---KFSPEQNSAMETFKFSIYHLLALFVALLADHYLGL 300


>gi|332995775|gb|AEF05830.1| protoheme IX farnesyltransferase [Alteromonas sp. SN2]
          Length = 311

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 111/287 (38%), Positives = 168/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  + KP V+ L + TA VG+ LA PG +     +  +  I M + ++  +N   D 
Sbjct: 26  WRDYYEMTKPNVVMLLLLTAVVGMCLASPGWVDATALICGLLGIGMLSASAAVINHVVDH 85

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART +RP+  G++S  +A      L V   V++ L +N ++A L   S+  Y V
Sbjct: 86  KIDSQMARTFNRPVAKGKVSIAKASWFAAGLGVMGFVVLSLWVNMLTAWLTLASLVGYAV 145

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGGIAGA PP++GW +VTG++   +L++ LI+F WTPPHFW+LA+
Sbjct: 146 VYTMFLKRATPQNIVIGGIAGAAPPLLGWTAVTGEIHAHALLLVLIVFTWTPPHFWALAI 205

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY KA +PMLP       TK  +L+YTVL S+V +LP ++G + + Y +    L  
Sbjct: 206 HREKDYAKAKVPMLPVTHGVEFTKTSVLLYTVLLSLVCLLPYLVGMSDLIYLVGSSLLNI 265

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +A +    K     +   K F  SI +L VLF +L++DH + +
Sbjct: 266 GFMYYAVKL---KFAATSQTAMKTFKFSIVHLMVLFVVLLLDHYVPL 309


>gi|1177575|emb|CAA61745.1| heme O synthase [Nitrobacter winogradskyi]
          Length = 329

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 127/271 (46%), Positives = 177/271 (65%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVMSL I+TA VG+++APGH+  +   I+I  IA+GAGASGALNM  + D
Sbjct: 37  VADYFALLKPRVMSLVIFTALVGLMIAPGHVHPVLGFIAILCIAVGAGASGALNMALEGD 96

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G++L+  S++ +G  +NW +  LL  +IF YVVI
Sbjct: 97  IDVLMSRTANRPIPRGRITRGEAMGFGLTLSFFSVMTLGTLVNWYAGGLLAFTIFFYVVI 156

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIVIGG AGA+PP++ WA+ TG +S+  L++FLIIF WTPPHFW+LAL 
Sbjct: 157 YTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSVEPLLLFLIIFFWTPPHFWALALF 216

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG+    LG  
Sbjct: 217 RSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWIYGVTSLILGAG 276

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITY 277
             + A   +  +         ++LF  SI Y
Sbjct: 277 MLVLAIEVYRHRTGSQALRATRRLFAFSIFY 307


>gi|162451170|ref|YP_001613537.1| Protoheme IX farnesyltransferase [Sorangium cellulosum 'So ce 56']
 gi|161161752|emb|CAN93057.1| Protoheme IX farnesyltransferase [Sorangium cellulosum 'So ce 56']
          Length = 332

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 91/297 (30%), Positives = 152/297 (51%), Gaps = 18/297 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH---------------ISVLKSVISIFAIAM 52
           +   + L KPR+  + + T   G+ +A  +               +   +  +++    +
Sbjct: 39  VADLVSLTKPRITRMVVATMLGGMWVASRYLRAGLAGDAAIERAAVPPAQLALALLGTVL 98

Query: 53  GAGASGALNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWV 112
               + ALNMY + D D +M RT SRP+P  ++SP  A   G++L+ +SI ++ + +N  
Sbjct: 99  VVSGANALNMYIERDTDLLMERTRSRPLPARRLSPELALWFGIALSAASIPVLLVGVNAT 158

Query: 113 SATLLFMSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLI 172
           +  L   ++  YV++YT  LKR T  ++ IG I GAIPP++GW SVTG +     ++F +
Sbjct: 159 TGVLAAAALLSYVLVYTP-LKRRTTLSLPIGAIPGAIPPLLGWTSVTGQIDAPGFLLFAV 217

Query: 173 IFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGF 232
           +FLW  PHF +++L  +D+YQ+A + +LP    D TT+ HI+ Y  L  +  VL   LG 
Sbjct: 218 MFLWQIPHFLAISLFRQDEYQRAGLKVLPLEKGDLTTRRHIVGYLALLVLSSVLFVPLGV 277

Query: 233 ASVTYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           A   Y      LG  F       +  +     R  +++F  S+ YL +LF  LM+  
Sbjct: 278 AGPVYLGAAILLGGAFFGLGV--YGLRAGTGARWARQVFFASMVYLVLLFAALMIGA 332


>gi|329902642|ref|ZP_08273201.1| Heme O synthase, protoheme IX farnesyltransferase [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548700|gb|EGF33345.1| Heme O synthase, protoheme IX farnesyltransferase [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 295

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 162/285 (56%), Gaps = 4/285 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R   +  L KPRV  LA++ A +G+ LA P       ++ +   I + AGA+ A+N   +
Sbjct: 11  RFAQYWALTKPRVTQLAVFCAVIGMFLATPDLPDWRVALPATIGIWLLAGAAFAVNCLVE 70

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            +ID  MARTA RP+  G I+  +  V    +      ++   +N ++  L F +   Y 
Sbjct: 71  REIDARMARTARRPMARGDITVPQTLVFSAVIGGLGTGVLYYFVNPLTMWLTFATFVGYA 130

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYTI LK  TPQNIVIGG+AGA+PP +GWA++  DV + + ++ LIIF+WTPPHFWSLA
Sbjct: 131 IIYTIILKPATPQNIVIGGLAGAMPPALGWAAIANDVPMQAWILVLIIFIWTPPHFWSLA 190

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  +DDY K+ +PMLP       T+ HI +YT+       LP  +  + + Y + V  L 
Sbjct: 191 LYRRDDYAKSGLPMLPITHGMVFTQFHIWLYTIALVATTFLPYAVNMSGLIYLVSVILLD 250

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW+ +    D   +V++K+F  SI YL +LF  L+VDH 
Sbjct: 251 IVFMWHAWQVYKHYTD---QVSRKMFAYSILYLGLLFAALLVDHY 292


>gi|149915656|ref|ZP_01904182.1| protoheme IX farnesyltransferase [Roseobacter sp. AzwK-3b]
 gi|149810548|gb|EDM70391.1| protoheme IX farnesyltransferase [Roseobacter sp. AzwK-3b]
          Length = 313

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 132/286 (46%), Positives = 186/286 (65%), Gaps = 4/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              +  LLKPRVM+L ++TA VG++ AP  +  +    +I  IA+G GASGALNM++DAD
Sbjct: 18  FGDYFALLKPRVMTLVVFTALVGLLAAPVSVHPVVGFAAILFIAVGGGASGALNMWWDAD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RPIP G+++  EA+ +G++L+  S++ + LA NWV+A LL  +IF YVVI
Sbjct: 78  IDAVMKRTARRPIPSGKVTGDEAFAIGMTLSAFSVIFLALATNWVAAGLLAFTIFFYVVI 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++WLKR+TPQNIVIGG AGA PPMIGWA+ TG VSI S++MF +IF+WTPPHFW+LAL 
Sbjct: 138 YSMWLKRWTPQNIVIGGAAGAFPPMIGWAAATGTVSIESVLMFALIFMWTPPHFWALALF 197

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A +PML      R T++HIL+YT+L + + +           Y  +   L   
Sbjct: 198 MRSDYDEAGVPMLTVTHGRRATRVHILVYTILLAALAIGTGFTAVGGPIYLAVAVVLNVM 257

Query: 248 FTLWAWRTFLCK----EDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F + A R +       E  +  V KK+F  S+ YLF  F  + ++ 
Sbjct: 258 FLIGAVRIWRRDEVMAEADNYAVEKKVFRLSLYYLFAHFGAIALEA 303


>gi|298245961|ref|ZP_06969767.1| protoheme IX farnesyltransferase [Ktedonobacter racemifer DSM
           44963]
 gi|297553442|gb|EFH87307.1| protoheme IX farnesyltransferase [Ktedonobacter racemifer DSM
           44963]
          Length = 302

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 103/287 (35%), Positives = 166/287 (57%), Gaps = 3/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L+ +I L+KP V  L +      + +A  G   +  ++ ++    M AG++  +N Y D 
Sbjct: 18  LSAYINLIKPHVTVLLLGVTAATMAIAVRGLPPLGITLATLLGGFMSAGSANCINCYIDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT  R +P G++ P +A + G+ L V S  ++   +N +SA L   +I  YV 
Sbjct: 78  DIDQIMGRTQRRSLPAGRVQPQQALIFGILLGVGSFFLLWGLVNLLSAVLATSAILFYVF 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LKR T QNIVIGG AGA+P ++GWA+VT  VS++++ +F IIF WTPPHFW+L+L
Sbjct: 138 IYTLGLKRTTAQNIVIGGAAGAVPVLVGWAAVTNSVSLSAIWLFAIIFYWTPPHFWALSL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           L + DY+KA +PMLP ++ +  T+  IL+Y++L   V  +  ++G     +      LG 
Sbjct: 198 LIQKDYEKAKVPMLPVLMGETETRKQILLYSLLLVAVTTILFLMGAMGYIFLFSSLILGG 257

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
                A R     +D   +  + +F  S  YL ++F + ++D +I  
Sbjct: 258 ILVYMAVRL--LNDDASRKWARTVFWYSNCYLALIFAVAVIDRVIHF 302


>gi|19921064|ref|NP_609382.1| CG5037 [Drosophila melanogaster]
 gi|7297663|gb|AAF52915.1| CG5037 [Drosophila melanogaster]
 gi|16198131|gb|AAL13868.1| LD33876p [Drosophila melanogaster]
 gi|220946010|gb|ACL85548.1| CG5037-PA [synthetic construct]
 gi|220955756|gb|ACL90421.1| CG5037-PA [synthetic construct]
          Length = 391

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 69/279 (24%), Positives = 130/279 (46%), Gaps = 5/279 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L+ +  L K R+ SL + T   G  +AP         +      + + A+ A+N Y++  
Sbjct: 73  LSQYKKLSKFRLTSLVVITTMGGYAMAPAAFDPTTFAMCTLGTGLVSAAANAINQYHEVP 132

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQ++P  A       A + + ++   +N ++A L   ++F Y  I
Sbjct: 133 FDSQMSRTKNRVLVTGQMTPLHAVTFAAVSATAGLSMLYFGVNGLTAALGAGNLFLYTTI 192

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GWA     +   ++++  +++ W  PHF +L+  
Sbjct: 193 YTP-MKRISIVNTWVGSIVGAIPPLMGWAGCAATLDAGAMILAGVLYAWQFPHFNALSWN 251

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L Y+V    +  +  +L   +  + +    L  +
Sbjct: 252 LRPDYSRAGYRMMAVTNPG-LCRRTALRYSVAIVGLSAMAPVLDVTNYWFALETLPLNAY 310

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILM 286
           F   A++     E  D   ++KLF  S+ +L  L  + +
Sbjct: 311 FAYLAYKFH---EKSDSGSSRKLFRFSLIHLPALMLLFL 346


>gi|297565083|ref|YP_003684055.1| protoheme IX farnesyltransferase [Meiothermus silvanus DSM 9946]
 gi|296849532|gb|ADH62547.1| protoheme IX farnesyltransferase [Meiothermus silvanus DSM 9946]
          Length = 624

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 161/283 (56%), Gaps = 4/283 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISV-LKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+SL ++T    +++A G        +         AGA+ A+NM  D 
Sbjct: 343 WRDYLWLTKPRVISLLLFTTLAAMLIAAGGWPGGWLFLWVAVGGYAMAGAANAINMVIDR 402

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RTA RP    +IS  +A +    L V + V++  A N ++A L    +  YV+
Sbjct: 403 DIDARMNRTAKRPTVTHKISSRDALIFASVLMVGAFVLLWWAANLLTALLALSGLLWYVL 462

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+++KR    NIVIGG AGA PP++GWA+VT D+S+ ++ +F IIF WTP HFW+L+L
Sbjct: 463 VYTLYMKRRYWNNIVIGGAAGAFPPLVGWAAVTNDLSLFAIYLFAIIFFWTPVHFWALSL 522

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           L KDDY +  +PMLP V+ +R T + I +Y +LT+++ ++P ++G   + Y +    L  
Sbjct: 523 LIKDDYARVGVPMLPVVLGERVTVVQIGLYAILTTVISLIPLLMGELRMVYLVSSLVLNG 582

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
              + + + +L   +        L+  S+ YL +LF  + VD 
Sbjct: 583 LLLVRSVQLYL---EPVRPRAVSLYKYSMLYLALLFVAMAVDR 622


>gi|269929069|ref|YP_003321390.1| protoheme IX farnesyltransferase [Sphaerobacter thermophilus DSM
           20745]
 gi|269788426|gb|ACZ40568.1| protoheme IX farnesyltransferase [Sphaerobacter thermophilus DSM
           20745]
          Length = 599

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 112/288 (38%), Positives = 171/288 (59%), Gaps = 5/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              + VL KP VM+L + T    ++ A  G   +   + ++   A+ +G + A+N Y D 
Sbjct: 311 WRDYFVLTKPGVMALLLTTTLGAMLFAKAGLPPLRILIWTLIGGALASGGAAAINHYLDR 370

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RT +RP+  G+++P +A + GV+L+V S+ +M + +N ++A L       YV+
Sbjct: 371 DIDRIMTRTRNRPVAGGRVTPVQALIFGVTLSVLSVYLMAVFVNPLAAILSLAGNLFYVI 430

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR TPQNIVIGG AGAIPP++GWA+VTG+V + +++MF+I+F WTPPHFW+LAL
Sbjct: 431 VYTMWLKRATPQNIVIGGAAGAIPPLVGWAAVTGNVGLPAIIMFIIVFAWTPPHFWALAL 490

Query: 187 LC--KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFF 243
                 DY  A +PM P V  D  T+  I IYT+L  I  +L     G   + Y  +   
Sbjct: 491 FRSKTRDYAAAGVPMYPAVYGDAKTRQQIFIYTLLLVITSLLLVFPLGANGLLYFAVAAV 550

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           LG  F   A +       +   + + LF+ S  YL +LF  ++VD L+
Sbjct: 551 LGGLFVHKAVQLLRRPAQQ-PLLARSLFMYSNYYLALLFLAMVVDRLV 597


>gi|163840985|ref|YP_001625390.1| protoheme IX farnesyltransferase [Renibacterium salmoninarum ATCC
           33209]
 gi|205693512|sp|A9WT38|COXX_RENSM RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|162954461|gb|ABY23976.1| protoheme IX farnesyltransferase [Renibacterium salmoninarum ATCC
           33209]
          Length = 318

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 163/294 (55%), Gaps = 3/294 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGI-VLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +   +I L KPRVM L + T    +   A G  ++   + ++   A  AG++GA N Y D
Sbjct: 25  KTKAYIALTKPRVMELLLVTTLPTMIFAARGLPNIWLILATMIGGAFAAGSAGAFNCYID 84

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DIDK+M RT  RP+  G ++P EA V   +L + SI I+    N ++  L   +IF YV
Sbjct: 85  RDIDKIMHRTEDRPLVTGAVTPREALVFSWALGILSIAILWFGANPLAGLLGIAAIFFYV 144

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V+YT+ LKR T QNIV GG+AG +P +I WA+VT  V   ++++F++IFLWTPPH+W L+
Sbjct: 145 VVYTLILKRRTAQNIVWGGVAGCMPVLIAWAAVTNKVEWPAIILFMVIFLWTPPHYWPLS 204

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A++PML  V   R   + +++YT    +  +L   LG A + Y ++    G
Sbjct: 205 MRYSEDYKAANVPMLGAVAGARIVSVQVVLYTWAMVVCSLLLIPLGHACIVYTVVAGAAG 264

Query: 246 YHFTLWAWRTFLCKEDK--DIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             F L A R            +   K+F  SI+YL +LF  L VD  + M  + 
Sbjct: 265 LWFLLEAHRLHSKASHDTVTNKSAMKVFHGSISYLTLLFVALAVDPFVGMPLMG 318


>gi|220936161|ref|YP_002515060.1| protoheme IX farnesyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|259586083|sp|B8GPF3|CYOE_THISH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|219997471|gb|ACL74073.1| protoheme IX farnesyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 302

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 110/287 (38%), Positives = 178/287 (62%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KP+V++L ++TA VG++L+ PG +     +  +  I + A +  ALN   D 
Sbjct: 16  WRRYYELGKPKVVALILFTALVGMLLSVPGMVPWHTMLFGLLGIGLAAASGAALNHVIDR 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +M RT +RP+P GQ+   +A V  +++ V ++ I+ LA+N ++A L F ++  Y V
Sbjct: 76  RIDAVMDRTRNRPLPTGQLETQKALVFAIAMGVVAMGILVLAVNVLTAVLTFFALIGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIV GG+AGA+PP++GW +VTG +++  L++ L+IF+WTPPHFW+LA+
Sbjct: 136 IYTVFLKRTTPQNIVWGGLAGALPPLLGWVAVTGQITVEPLLLVLLIFVWTPPHFWALAI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY +A IPMLP       TK+ +L+YT++   V ++P ++    + Y +    LG 
Sbjct: 196 RRREDYARAGIPMLPVTHGVAFTKLQVLLYTLMLLTVSLVPFIIHMTGLIYLVGALALGI 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A+R +   +D+        F  SI YL  +F +L+VDH + M
Sbjct: 256 GFVFHAYRLWRSPDDR---YAMPTFGYSIFYLTAMFALLLVDHYVRM 299


>gi|121595820|ref|YP_987716.1| protoheme IX farnesyltransferase [Acidovorax sp. JS42]
 gi|222112020|ref|YP_002554284.1| protoheme ix farnesyltransferase [Acidovorax ebreus TPSY]
 gi|182637470|sp|A1WBL5|COXX_ACISJ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|254765938|sp|B9MF14|COXX_ACIET RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|120607900|gb|ABM43640.1| protoheme IX farnesyltransferase [Acidovorax sp. JS42]
 gi|221731464|gb|ACM34284.1| protoheme IX farnesyltransferase [Acidovorax ebreus TPSY]
          Length = 306

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 108/290 (37%), Positives = 167/290 (57%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALN 61
            RL+ F  L KPRV+ L ++ AF+G+VLA    P         ++   I + AGA+ A N
Sbjct: 19  SRLSQFYALTKPRVVQLIVFCAFIGMVLAVPGMPSGAQWALMAVASAGIWLVAGAAAAFN 78

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +  +    L  +   ++   +N ++  L F + 
Sbjct: 79  CIVEQGIDAKMKRTAWRPTAKGELSNTQTLLFSALLCAAGSALLYWWVNPLTMWLTFATF 138

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TG+V   +L++FLIIFLWTPPHF
Sbjct: 139 VGYAVIYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGEVGPEALILFLIIFLWTPPHF 198

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+K+ +PMLP    +  T++ + +YT++     ++P + G +S  Y    
Sbjct: 199 WALALYRVEDYRKSGLPMLPVTHGNEFTRLQVFLYTLILFAGCLMPFVYGMSSWIYLAAA 258

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             L   F L+ +R +    D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 259 VVLSAGFCLYGFRLW---RDYSDTLARKTFRFSLIHLSLLFAALLVDHYL 305


>gi|229587644|ref|YP_002869763.1| protoheme IX farnesyltransferase [Pseudomonas fluorescens SBW25]
 gi|229359510|emb|CAY46351.1| putative protoheme IX farnesyltransferase [Pseudomonas fluorescens
           SBW25]
          Length = 299

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 115/287 (40%), Positives = 165/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+ VG+ LA    +     V     IA+ AG + A+N   D 
Sbjct: 14  WRDYLELTKPKVVVLMLITSLVGMFLATRAGVPWTVLVFGNLGIALCAGGAAAVNHVVDR 73

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++SP  A    + LAV+ + ++    N ++A L   S+  Y V
Sbjct: 74  RIDAVMARTHKRPLAEGRVSPLAALAFALFLAVAGLALLLAFTNPLAAWLTLASLLGYAV 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA PP++GW +VTG +S   L++ LIIF WTPPHFW+LA+
Sbjct: 134 IYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGHISAEPLLLVLIIFAWTPPHFWALAI 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +  TK+HIL+YT     V ++P ++  + + Y      LG 
Sbjct: 194 HRKEEYAKADIPMLPVTHGEHYTKVHILLYTFALLAVSLMPYVIHMSGLLYLACALVLGG 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WAW  +   +          F  SI YL +LF  L+VDH + +
Sbjct: 254 RFLQWAWVLYRGAQ---PHAAINTFKYSIWYLLLLFIALLVDHYLLL 297


>gi|332286011|ref|YP_004417922.1| protoheme IX farnesyltransferase [Pusillimonas sp. T7-7]
 gi|330429964|gb|AEC21298.1| protoheme IX farnesyltransferase [Pusillimonas sp. T7-7]
          Length = 296

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 109/287 (37%), Positives = 165/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++VL KPRV  LA++ A +G+ LA PG   +   V +   I + A A+ A+N   + 
Sbjct: 12  FRQYLVLTKPRVTQLAVFCAVIGMFLASPGLPDLGVVVAATVGIWLLAAAAFAVNCLIEQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  M RTA R    G IS  +   L   L    +V++   +N ++  L F +   Y +
Sbjct: 72  EIDARMLRTARRATARGTISNTQVITLSGLLGGLGMVVLHQLVNPLTMWLTFATFVGYAI 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  TPQNIVIGG++GA+PP +GWA+V   V   + V+ LIIF+WTPPHFW+LAL
Sbjct: 132 IYTMILKPLTPQNIVIGGLSGAMPPALGWAAVANAVPAEAWVLVLIIFIWTPPHFWALAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              +DY K+ +PMLP     + T++HIL+Y+       +LP ++  + + Y      L  
Sbjct: 192 YRNNDYAKSGLPMLPVTHGKQFTRLHILLYSFALFASTLLPYIVRMSGLFYLCAAVVLSG 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F ++AWR +    D+   +++KLF  SI YL +LF  L++DH I +
Sbjct: 252 MFIMYAWRLYKAYSDE---LSRKLFRFSILYLALLFGALLIDHWIRL 295


>gi|110667536|ref|YP_657347.1| protoheme IX farnesyltransferase [Haloquadratum walsbyi DSM 16790]
 gi|121689846|sp|Q18JU9|COXX_HALWD RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|109625283|emb|CAJ51705.1| protoheme IX farnesyltransferase [Haloquadratum walsbyi DSM 16790]
          Length = 479

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 92/287 (32%), Positives = 147/287 (51%), Gaps = 7/287 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP---GHISVLKSVISIFAIAMGAGASGALNMYY 64
           L  +I L KPR+M L    A  G+ L     G ++   ++ ++    +  GASG  N   
Sbjct: 196 LRAYIRLTKPRLMWLLCLVASAGMTLGATTTGQLTPGIALATLGGGVLSIGASGTFNHVL 255

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           + D+D+ M RT+ RP+    +  W A   G+ L V SI ++   +N ++A L  ++I  Y
Sbjct: 256 ERDVDRRMQRTSDRPLATDLVPVWNAIAFGILLTVISI-VLFSWVNMLAAILGGVAIVFY 314

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LK  T QN VIGG AGA+P +IGW +VTGD+    L +  +IFLWTP HF++L
Sbjct: 315 SVVYTLLLKPNTVQNTVIGGAAGALPALIGWVAVTGDIGFGGLALATVIFLWTPAHFYNL 374

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  K+DY++   PM+P V  +  T+ H++ +  LT +       +    + Y +     
Sbjct: 375 ALAYKEDYERGGFPMMPVVRGETETRKHVIWWLALTLVAAGGLATIEALGIVYAVASIVF 434

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           G  F  +A +      ++        F  S  YL  +   ++ D L+
Sbjct: 435 GAVFLYFAIKLHY---EQTKAAAFHSFHASNAYLGAVLIAIVFDTLV 478


>gi|15604214|ref|NP_220729.1| protoheme IX farnesyltransferase [Rickettsia prowazekii str. Madrid
           E]
 gi|6225198|sp|Q9ZDI2|COXX_RICPR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|3860906|emb|CAA14806.1| CYTOCHROME C OXIDASE ASSEMBLY FACTOR (ctaB) [Rickettsia prowazekii]
          Length = 310

 Score =  148 bits (374), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 128/278 (46%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL I+T FVG+ LAP  I  L + I++  IA+GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMSLVIFTGFVGMWLAPDSIHPLIAGIAVICIALGAGSAGAMNMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT +RPI  G I P EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDILMKRTQNRPIVRGVIEPDEALSFGLITGFFAVFFMALCVNILASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG A+V+  +S+ S+++FLIIF+WTPPH W++AL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGHAAVSNTISLESIILFLIIFIWTPPHSWAIALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   IPM+P V     TK  ILIY+++  IV ++P  +G  +  Y IIV  +G  
Sbjct: 200 CNDDYKHCKIPMMPVVKGTLYTKKQILIYSIILFIVSLMPFFIGMNNDIYLIIVCIIGLV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTIL 285
           F  +A+  F   +  D +  K+ F  SI YL  +F +L
Sbjct: 260 FLYYAFSLF--YDTPDNKQAKRFFTYSIFYLCFIFILL 295


>gi|182639246|sp|Q6NBJ5|COXX_RHOPA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 312

 Score =  148 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 138/282 (48%), Positives = 191/282 (67%), Gaps = 1/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL ++TA VG+++APG    + ++ +I  IA+G GA+GALNM+Y+ D
Sbjct: 20  VADYIALLKPRVMSLVVFTALVGLLMAPGSFHPVLAITAIICIAVGGGAAGALNMWYEDD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RPIP G+++  EA   G++LA  S+V +G+ +NW++A LL  +IF YVVI
Sbjct: 80  IDAKMTRTANRPIPRGRVTRPEALTFGMTLAFFSVVTLGILVNWIAAGLLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ WASVTG +++  +++FLIIF WTPPHFW+LAL 
Sbjct: 140 YTMWLKRWTAQNIVIGGAAGALPPVVAWASVTGSLAVEPILLFLIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YTV    V   P  LG+  V YG+    LG  
Sbjct: 200 RNDDYARAGVPMLPVVAGPDHTRLQILLYTVALVAVAAAPWPLGYFDVIYGVASLALGGW 259

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITYLFVLFTILMVD 288
             + A R +  +         + LF  SI YLF LF IL+V+
Sbjct: 260 MLVLAVRVYRHRSGSAALRATRNLFKFSILYLFALFAILLVE 301


>gi|119476742|ref|ZP_01617052.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2143]
 gi|119449998|gb|EAW31234.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2143]
          Length = 300

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 113/288 (39%), Positives = 168/288 (58%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
               ++ L KP+V+ L + TA VG+ LA P  + +   +I+   I   A ++  +N   D
Sbjct: 13  NWRDYLELCKPKVVFLLLITAVVGMQLASPYWVPISTVIIATIGIGFAAASAAVINHVVD 72

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
           A ID  M RT +RP+  G ++  +A +    L +SS+ I+ + +N ++A L  + +  Y 
Sbjct: 73  AKIDAKMHRTKNRPVVQGNMNNNQALLFSAVLGISSMFILVVFVNTLTAILSLVGLIGYA 132

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYTI+LK  TPQNIVIGG+AGA+PP+IGWA+VT  +S   +++ LIIF+WTPPHFW+LA
Sbjct: 133 VIYTIFLKHATPQNIVIGGLAGALPPLIGWAAVTNTISHEGILLVLIIFVWTPPHFWALA 192

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   DDY+KA +PMLP       TK  I  Y++   IV + P  +G +   Y I    LG
Sbjct: 193 IDRIDDYKKAQVPMLPVTHGIAFTKTCIFAYSLALWIVSLAPFFVGMSGFLYLISASILG 252

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F+ +AW     K      +  K F+ S+ YLF LF+ L+ DH + M
Sbjct: 253 GWFSYYAWAL---KYRPSKGIAIKTFMVSVKYLFYLFSALLADHYLAM 297


>gi|254483327|ref|ZP_05096558.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2148]
 gi|214036422|gb|EEB77098.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2148]
          Length = 299

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 109/285 (38%), Positives = 166/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KP V+ L I T+ +G+ +A PG + +   ++    IA+ AGA+ A+N   D 
Sbjct: 12  WRDYKELTKPNVVLLMILTSAIGMFMAVPGMVPLDVLILGNLGIALSAGAAAAVNHLVDQ 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART +RPI  G++S  +A V  + +    + I+ + IN ++A L   S+  Y  
Sbjct: 72  RIDLQMARTHNRPIATGRLSNTQATVFAMIMGGLGMTILMVFINPLTAWLTLASLLGYAF 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA PP++GW +VTG++   +L++ LIIF WTPPHFW+LA+
Sbjct: 132 VYTMFLKRATPQNIVIGGLAGAAPPLLGWTAVTGEIHGHALLLVLIIFAWTPPHFWALAI 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +++Y    IPMLP       TK+ IL+YT++  ++ +LP     +   Y +    LG 
Sbjct: 192 HRREEYAAVGIPMLPVTHGVAFTKLQILLYTIIMFLITLLPYATRMSGPLYLLGAVVLGL 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  WA         K+     + F  SITYL  LF +++VDH +
Sbjct: 252 GFLYWAVELM---RGKNANAPMETFKYSITYLMALFVVMLVDHYL 293


>gi|264680066|ref|YP_003279975.1| protoheme IX farnesyltransferase [Comamonas testosteroni CNB-2]
 gi|262210581|gb|ACY34679.1| protoheme IX farnesyltransferase [Comamonas testosteroni CNB-2]
          Length = 307

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 108/290 (37%), Positives = 166/290 (57%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALN 61
            R   +  L KP+V+ L ++ AF+G+VLA    PG     + +++   I + A A+ A N
Sbjct: 20  SRWAQYYALTKPKVVQLIVFCAFIGMVLAVPGAPGWQDWGRMLVACAGIWLVAAAAAAFN 79

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +A +    L  +   I+ LA+N ++  L   + 
Sbjct: 80  CLVERSIDARMKRTAWRPTARGELSHSQALLFSALLCAAGAAILLLAVNALTLWLTLATF 139

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TG V   +L++FLIIFLWTPPHF
Sbjct: 140 IGYAVIYTLVLKPLTPQNIVIGGASGAMPPVLGWAAMTGQVGHEALLLFLIIFLWTPPHF 199

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY++A +PMLP    +  T++ + +YT++     +LP ++G +   Y    
Sbjct: 200 WALALYRVEDYRRAGLPMLPVTHGNAFTRLQVFLYTLVLFAGCLLPFVVGMSGYLYLFAA 259

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             LG  F  + W       D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 260 VILGLGFCGYGWALLRNYSD---ALARKTFRFSLIHLSLLFAALLVDHYL 306


>gi|71907095|ref|YP_284682.1| protoheme IX farnesyltransferase [Dechloromonas aromatica RCB]
 gi|123627713|sp|Q47G19|COXX_DECAR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|71846716|gb|AAZ46212.1| Protoheme IX farnesyltransferase [Dechloromonas aromatica RCB]
          Length = 298

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 114/288 (39%), Positives = 161/288 (55%), Gaps = 4/288 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           RL  F  L KPRV SL ++TA +G+ LA P    +L+  ++   IA+ + A+ ALN   +
Sbjct: 14  RLAAFSHLCKPRVNSLIVFTAMIGMCLATPDFPPLLRFGVASLGIALVSFAAAALNCLVE 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             +D  MART+ R    G ISP E   L  +L  + + ++   IN ++  L   +   Y 
Sbjct: 74  RTVDAKMARTSWRATARGDISPLETVTLATALGAAGLWLLHGFINDLTMWLTLATFVGYT 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT+ LK  TP NIVIGG +GA+PP++GW ++TG VS   LV+FLIIFLWTPPHFW+LA
Sbjct: 134 VIYTLILKPATPMNIVIGGASGAMPPLLGWTAMTGQVSAEPLVLFLIIFLWTPPHFWALA 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
              +DDY  + +PMLP       T  HIL YT++ +   ++P  LG +   Y I +  L 
Sbjct: 194 CYRRDDYACSGLPMLPVTHGIAFTCQHILWYTLMLAAASLIPVSLGMSGGFYLIAIGLLD 253

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
             F  +A        D    + ++ F  SI YL +LF  L  D LI +
Sbjct: 254 LVFLGYAIALCRRYSD---ALARRTFRYSILYLTLLFAALFADRLIVL 298


>gi|92115888|ref|YP_575617.1| protoheme IX farnesyltransferase [Nitrobacter hamburgensis X14]
 gi|92118921|ref|YP_578650.1| protoheme IX farnesyltransferase [Nitrobacter hamburgensis X14]
 gi|91798782|gb|ABE61157.1| protoheme IX farnesyltransferase [Nitrobacter hamburgensis X14]
 gi|91801815|gb|ABE64190.1| protoheme IX farnesyltransferase [Nitrobacter hamburgensis X14]
          Length = 328

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 126/271 (46%), Positives = 176/271 (64%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVMSL I+TA VG+++APGH+  +    +I  IA+GAGASGALNM  + D
Sbjct: 36  VADYFALLKPRVMSLVIFTALVGLMIAPGHVHPVLGFTAILCIAVGAGASGALNMALEGD 95

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G++L+  S++ +G  +NW +  LL  +IF YVVI
Sbjct: 96  IDVLMSRTANRPIPRGRITRGEAMGFGLTLSFFSVMTLGALVNWYAGGLLAFTIFFYVVI 155

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIVIGG AGA+PP++ WA+ TG +S+  L++FLIIF WTPPHFW+LAL 
Sbjct: 156 YTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSVEPLLLFLIIFFWTPPHFWALALF 215

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG+    LG  
Sbjct: 216 RSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWVYGVTSLVLGAG 275

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITY 277
             + A   +  +         ++LF  SI Y
Sbjct: 276 MLVLAINVYRHRTGSTALRATRRLFAFSILY 306


>gi|261856975|ref|YP_003264258.1| protoheme IX farnesyltransferase [Halothiobacillus neapolitanus c2]
 gi|261837444|gb|ACX97211.1| protoheme IX farnesyltransferase [Halothiobacillus neapolitanus c2]
          Length = 306

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 116/295 (39%), Positives = 174/295 (58%), Gaps = 5/295 (1%)

Query: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA--PGHISVLKSVISIFAIAMGAGASG 58
           M  QV     ++ L K +V+SL ++TA V +VLA  PG++     + +   IA+   ++ 
Sbjct: 9   MLMQVIPWRSYVKLCKIKVVSLVVFTALVAMVLAAPPGNLPWATVLAATVGIALAGASAA 68

Query: 59  ALNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLF 118
           ALN   D +ID +M RT +RP+P+G IS   A V  +SLA  ++VI+   +N ++A L  
Sbjct: 69  ALNHIADREIDTVMGRTQNRPLPMGNISRGSATVFALSLASLALVIIWTLVNPLTAVLTL 128

Query: 119 MSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTP 178
           +++  Y VIYT +LK   PQNIV+GG +GA P M+GW ++TG +   +  +FLIIF+WTP
Sbjct: 129 LTLIGYAVIYTRYLKWIGPQNIVLGGASGAAPAMLGWCAITGQIGWEAFALFLIIFVWTP 188

Query: 179 PHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYG 238
           PHFW+LA+  +D+Y KA +PM+P +     TK  I  Y ++   V  LP  +G +   Y 
Sbjct: 189 PHFWALAIARRDEYAKAGVPMMPVIRGVAYTKRSIFAYALVLIPVSYLPVTVGLSGPFYL 248

Query: 239 IIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           I    LG  F + A+R      D+      +LF  SITYL VLF +L+VDH + +
Sbjct: 249 IGATVLGGLFAIRAYRLMFVDSDR---QAMRLFGFSITYLTVLFALLLVDHYLPI 300


>gi|217969470|ref|YP_002354704.1| protoheme IX farnesyltransferase [Thauera sp. MZ1T]
 gi|217506797|gb|ACK53808.1| protoheme IX farnesyltransferase [Thauera sp. MZ1T]
          Length = 302

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 111/284 (39%), Positives = 169/284 (59%), Gaps = 4/284 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             F  L KPRV++L + TA+VG++LA  G     + +++   IAM +GA+ A N   D  
Sbjct: 22  RAFWQLTKPRVVALLVLTAWVGMMLATTGLPDFARMLVASLGIAMVSGAAAAFNHVLDHK 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART  RP+P G++S  +A     +LA +  V++ + +N ++A L    +F Y V+
Sbjct: 82  IDARMARTRLRPLPSGRLSGAQALGFACALAAAGFVLLLVEVNALTAWLTLAGLFGYAVV 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVIGG+AGA+PP++GW ++TG V   + ++ +I+F WTPPHFW+LA+ 
Sbjct: 142 YTVFLKRATPQNIVIGGVAGALPPVLGWTAMTGTVGAEAWLLMMIVFTWTPPHFWALAIH 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY++A +PMLP       T+  +L+YTVL   V +LP ++G +   Y      L   
Sbjct: 202 RVEDYRRAGLPMLPVTHGIEFTRTLVLLYTVLLLAVCLLPYLVGMSGPFYLAGSLALNLR 261

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F   AWR              + F  SIT+L +LF +L+ DH +
Sbjct: 262 FLHHAWRLKFAPRADT---AIRTFRFSITHLMLLFLVLLADHYL 302


>gi|158424582|ref|YP_001525874.1| protoheme IX farnesyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158331471|dbj|BAF88956.1| protoheme IX farnesyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 314

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 128/268 (47%), Positives = 180/268 (67%), Gaps = 1/268 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +I LLKPRVMSL I+TA VG+V AP H+  + +  +I  IA+GAGA+GALNM++DADI
Sbjct: 28  RDYISLLKPRVMSLVIFTALVGLVRAPDHVHPVIAFTAILCIAVGAGAAGALNMWWDADI 87

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RT  RPIP G+++P EA   G++LA  S+V++GL +N ++  LL  +IF YVV+Y
Sbjct: 88  DAVMSRTQRRPIPAGRVTPREALAFGLTLAAFSVVVLGLLVNVLAGALLAFTIFFYVVVY 147

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG++GA+PPM+ WA+ +G +S+ S+++  IIF WTPPHFW+L+L  
Sbjct: 148 TMWLKRSTPQNIVIGGLSGALPPMVAWAAASGSISLESVILVAIIFFWTPPHFWALSLYR 207

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            DDY +A +PMLP       T+  IL+YT+    + + P MLG A + YG++    G   
Sbjct: 208 ADDYARAGVPMLPVTAGPDETRKQILLYTLFLVPLALSPVMLGEAGLAYGVVAGVTGLGM 267

Query: 249 TLWAWRTFLCKEDKDIR-VTKKLFLESI 275
            L A   +  +         KKLF  SI
Sbjct: 268 LLLAVNVYRRRTGPAAVTAAKKLFGFSI 295


>gi|119509021|ref|ZP_01628172.1| protoheme IX farnesyltransferase [Nodularia spumigena CCY9414]
 gi|119466187|gb|EAW47073.1| protoheme IX farnesyltransferase [Nodularia spumigena CCY9414]
          Length = 317

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 114/285 (40%), Positives = 169/285 (59%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +  L  ++++    + A ++  +N  YD 
Sbjct: 17  IQSYYQLTKPRIIPLLLITTAGSMWIAAQGQVDPLLLLVTLTGGTLAAASAQTINCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RPIP G++ P +A +  ++LAV S  ++ +  N ++A L F  I  Y++
Sbjct: 77  DIDYDMERTRHRPIPSGKVQPRDALIFAIALAVMSFTLLAVFANLLAACLAFSGIVFYIL 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT WLKR + QNIVIGG AGAIP ++GWA+VTG +S A+ ++F I+FLWTPPHFW+LAL
Sbjct: 137 IYTHWLKRHSTQNIVIGGAAGAIPALVGWAAVTGTLSWAAWLIFAIVFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVL-TSIVGVLPTMLGFASVTYGIIVFFLG 245
           + +DDY K  IPMLP V  D  T   I  YT++      +L   L  +   YG I   LG
Sbjct: 197 MIRDDYAKVGIPMLPVVEGDIATVKQIWYYTLVTVGATILLVYPLHASGFVYGAIAVSLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   +WR     ED+   V ++LFL SI+Y+ +L   +++D L
Sbjct: 257 GLFVHKSWRLLHNPEDRT--VARELFLYSISYMMLLCLGMVIDSL 299


>gi|254451266|ref|ZP_05064703.1| protoheme IX farnesyltransferase [Octadecabacter antarcticus 238]
 gi|198265672|gb|EDY89942.1| protoheme IX farnesyltransferase [Octadecabacter antarcticus 238]
          Length = 313

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 127/286 (44%), Positives = 174/286 (60%), Gaps = 4/286 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  L+KPRVM L ++TAFVG+V+AP  ++     ++I  IA+GAGAS +LNM++DADID
Sbjct: 17  DYFALMKPRVMQLVVFTAFVGLVVAPVGVNPFIGFVAILCIAVGAGASASLNMWWDADID 76

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RPIP G ++  EA  +G++L+  SIV++ LA N ++A LL  +IF Y VIY+
Sbjct: 77  AIMKRTVKRPIPSGTVTEGEALGIGLALSGFSIVLLFLATNALAAGLLAFTIFFYAVIYS 136

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGWA  TG VSI S++MF +IF+WTPPHFW+LAL  K
Sbjct: 137 MWLKRSTPQNIVIGGAAGAFPPMIGWAVATGSVSIESVLMFALIFMWTPPHFWALALFVK 196

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY  A +PML        T+ HI+ Y     +V +           Y  +   L   F 
Sbjct: 197 SDYGDAGVPMLTETHGRTVTRKHIIAYCAPLVLVALWLGFTSIGGPFYLFVAVALNIWFL 256

Query: 250 LWAWRTFLC----KEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              +  +       +  +  V K  F  S+ YLF  F  LM++ L+
Sbjct: 257 KGCYAIWRRTDADSDADNYAVEKHTFKVSLYYLFGHFGALMIEALL 302


>gi|51893231|ref|YP_075922.1| putative heme O synthase [Symbiobacterium thermophilum IAM 14863]
 gi|81388563|sp|Q67ML5|COXX_SYMTH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|51856920|dbj|BAD41078.1| putative heme O synthase [Symbiobacterium thermophilum IAM 14863]
          Length = 298

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 107/282 (37%), Positives = 164/282 (58%), Gaps = 3/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKS-VISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPR++ L + T F  + +A G    L   V+++  +A+  GA+ A+NM+YD 
Sbjct: 15  VRDYVALTKPRIVILLLITGFAAMWVAAGGPPPLGLTVVTMIGLALSCGAANAINMWYDR 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +MART  RP+P G+++P +A   GV     S +++        A L    +  YV+
Sbjct: 75  DIDAVMARTRRRPLPAGRLTPEQALRFGVITGALSFLVLLTVNLLT-ALLATAGLLFYVL 133

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR T  NIVIGG AGA PP++GWA+VTG +  A+++MFL++FLWTPPHFW+LAL
Sbjct: 134 VYTMWLKRSTVHNIVIGGAAGAAPPLVGWAAVTGRLDWAAVIMFLVVFLWTPPHFWALAL 193

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              +DY++A +PMLP V  +R TK  IL+Y++L      L    G     Y      LG 
Sbjct: 194 FRSEDYERAGVPMLPVVRGERATKWQILLYSLLLIPSAALLYWTGTVGRLYLWTSVVLGC 253

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
                +      +  + +    + +  S+ YLFV+F  +M+D
Sbjct: 254 AMVSASVGLLRERAPQ-MDWAHRTYGWSLLYLFVIFLAMMLD 294


>gi|326318579|ref|YP_004236251.1| protoheme IX farnesyltransferase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375415|gb|ADX47684.1| protoheme IX farnesyltransferase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 302

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 112/290 (38%), Positives = 168/290 (57%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS----VLKSVISIFAIAMGAGASGALN 61
            R + F  L KPRV+ L ++ AF+G+VLA   +      L   I+ F I + AGA+ A N
Sbjct: 15  SRFSQFYALTKPRVVQLIVFCAFIGMVLAVPGLPSGAQWLHMAIACFGIWLVAGAAAAFN 74

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +       L ++  +++   +N ++  L F + 
Sbjct: 75  CLVEQHIDAKMKRTAWRPTAKGELSNAQTLAFSALLCLAGSLVLFAWVNALTMWLTFATF 134

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWAS+TGDV    L++FLIIFLWTPPHF
Sbjct: 135 VGYAVIYTVVLKPRTPQNIVIGGASGAMPPVLGWASMTGDVGPEPLILFLIIFLWTPPHF 194

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+K+ +PMLP    +  T++ +L+YT +     ++P + G +S  Y    
Sbjct: 195 WALALYRVEDYRKSGLPMLPVTHGNEFTRLQVLLYTFILFAGCLMPFVYGMSSWIYLAAA 254

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             L   F  +A+R +    D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 255 VVLCTGFCAYAFRLWRSYSD---ALARKTFRFSLIHLSLLFAALLVDHYV 301


>gi|307545741|ref|YP_003898220.1| protoheme IX farnesyltransferase [Halomonas elongata DSM 2581]
 gi|307217765|emb|CBV43035.1| protoheme IX farnesyltransferase [Halomonas elongata DSM 2581]
          Length = 314

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 75/285 (26%), Positives = 142/285 (49%), Gaps = 3/285 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             ++ + KP ++   +     G  LA  G +     + ++  +A+   +  A N   D D
Sbjct: 22  KDYLTITKPGIIGGNVIAVLGGFFLAARGDVDPWLLIATVVGLALVIASGCAFNNVIDRD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID MM RT +RP+  G+++P         L ++   ++ L  NWV+  L       YV +
Sbjct: 82  IDAMMERTRTRPLVQGRVTPAATLRFATLLGIAGFALLALFTNWVTVGLAAFGFAIYVGV 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           Y++++KR +    ++G ++GA+PP++G+ +VTG     +L + +I  LW  PH +++A+ 
Sbjct: 142 YSLYMKRQSEYGTLVGSLSGAMPPVVGYCAVTGQFDGGALTLLVIFCLWQMPHSYAIAIF 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DYQ A IP+LP V   +T K +IL Y +      +  ++ G+A   Y ++   +G +
Sbjct: 202 RLKDYQAARIPVLPVVRGIKTAKHYILGYILAFVFASLALSVAGYAGPGYFVVALVMGVY 261

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           +   A + +      + R  K++F  SI  +  L  ++ VD  + 
Sbjct: 262 WLYLAMQGYRV--HDEERWAKRVFAFSIITITALSLMMSVDASLP 304


>gi|254463387|ref|ZP_05076803.1| protoheme IX farnesyltransferase [Rhodobacterales bacterium
           HTCC2083]
 gi|206679976|gb|EDZ44463.1| protoheme IX farnesyltransferase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 312

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 132/287 (45%), Positives = 185/287 (64%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  LLKPRVM+L ++TA VG++ AP  +  + +  SI  IA+G GASGALNM++DAD
Sbjct: 17  FGDFFALLKPRVMTLVVFTALVGLLAAPNPVHPMIAFASILFIAIGGGASGALNMWWDAD 76

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP G+++  EA   G++L+  S V++GLA NWV+ +LL  +IF YVVI
Sbjct: 77  IDAVMKRTQKRPIPAGKVTEGEALGFGLALSGLSTVMLGLASNWVAGSLLGFTIFFYVVI 136

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+TPQNIVIGG AGA PPMIGWA  TG +SI S++MF + F+WTPPHFW+LAL 
Sbjct: 137 YTMWLKRWTPQNIVIGGAAGAFPPMIGWAVATGGISIESVLMFCLTFMWTPPHFWALALF 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R+T++HI +YT+L +I+ +   +       Y  I   L   
Sbjct: 197 MRKDYDHAGVPMLTVTHGRRSTRIHIFVYTILLAILALGAGVTSIGGPVYMAIAIVLNMM 256

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F   AW      E+     + +V +  F  S+ YLF+ F  ++++ +
Sbjct: 257 FVKGAWDILNRDEEMSEVDNFKVERNFFKLSLLYLFLHFGAILIEAI 303


>gi|257388837|ref|YP_003178610.1| protoheme IX farnesyltransferase [Halomicrobium mukohataei DSM
           12286]
 gi|257171144|gb|ACV48903.1| protoheme IX farnesyltransferase [Halomicrobium mukohataei DSM
           12286]
          Length = 472

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 97/289 (33%), Positives = 144/289 (49%), Gaps = 12/289 (4%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGI------VLAPGHISV--LKSVISIFAIAMGAGASGALN 61
            +  L KPR+M L    A  G+      V  P + S+     ++++    +  GASG  N
Sbjct: 186 AYFRLTKPRLMWLLCLVAAAGMALAAAHVAGPANPSLATSTILLTLGGGVLAIGASGTFN 245

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              + DIDK M RT+ RPI   Q+    A   G++LAV+S+  +   +N + A L   +I
Sbjct: 246 HVLERDIDKRMDRTSDRPIATHQLPVRNALAFGIALAVASL-ALFWQVNAIVAALGLAAI 304

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y V+YT+ LK  T QN VIGG AG++P +IGW +VTG   +  L +  IIFLWTP HF
Sbjct: 305 LFYSVVYTLVLKPNTVQNTVIGGFAGSLPALIGWVAVTGSFDLPGLALAGIIFLWTPAHF 364

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           ++LAL  K+DY +   PM+P V  +  T+ HI+ Y   T +   +   +      Y +  
Sbjct: 365 YNLALAYKEDYARGGFPMMPVVRGETETRKHIVYYLGATLVAAGVMVSITSLGALYTVTT 424

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             LG  F     R      ++  +   + F  S  YL  L   ++VD L
Sbjct: 425 ALLGAVFLWAVVRLH---RERTEQAAFRAFHASNAYLGALLIAIVVDAL 470


>gi|292571954|gb|ADE29869.1| Protoheme IX farnesyltransferase [Rickettsia prowazekii Rp22]
          Length = 312

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 128/278 (46%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL I+T FVG+ LAP  I  L + I++  IA+GAG++GA+NM+YD D
Sbjct: 22  VKDYILLMKPRVMSLVIFTGFVGMWLAPDSIHPLIAGIAVICIALGAGSAGAMNMWYDRD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT +RPI  G I P EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 82  IDILMKRTQNRPIVRGVIEPDEALSFGLITGFFAVFFMALCVNILASFLLLFTIFYYICI 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG A+V+  +S+ S+++FLIIF+WTPPH W++AL 
Sbjct: 142 YTIWLKRRSIQNIVIGGVSGALPPVIGHAAVSNTISLESIILFLIIFIWTPPHSWAIALF 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   IPM+P V     TK  ILIY+++  IV ++P  +G  +  Y IIV  +G  
Sbjct: 202 CNDDYKHCKIPMMPVVKGTLYTKKQILIYSIILFIVSLMPFFIGMNNDIYLIIVCIIGLV 261

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTIL 285
           F  +A+  F   +  D +  K+ F  SI YL  +F +L
Sbjct: 262 FLYYAFSLF--YDTPDNKQAKRFFTYSIFYLCFIFILL 297


>gi|291229319|ref|XP_002734617.1| PREDICTED: CG5037-like [Saccoglossus kowalevskii]
          Length = 412

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/264 (23%), Positives = 122/264 (46%), Gaps = 5/264 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           ++ L K R+ +L + TA  G V+APG   +   + +     + + ++ A+N + +   D 
Sbjct: 124 YMQLGKSRLTALVVLTAAGGYVMAPGDFYIGTLLFTTLGTFLTSSSANAINQFIEVPYDS 183

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
            MART +R +    ISP  A        ++   I+ L  N ++A L   ++  Y ++YT 
Sbjct: 184 QMARTRNRVLVQQLISPLHAATFAAVSGIAGTAILALGCNPLTAVLGLGNLALYTMVYTP 243

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            +KR +  N  +G + G +PP++GWA+  G +   + ++   ++ W  PHF SL+   + 
Sbjct: 244 -MKRVSILNTWVGAVVGGVPPLMGWAACMGHLDPGAWLLAGFLYAWQFPHFNSLSWNLRG 302

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           +Y +    M+         +   L Y+     +  L  ++   +  + +    +  + + 
Sbjct: 303 EYSRGGYRMMATTN-PALCRRVALRYSFGIIALSTLAPVVNLTTWAFAVDSLPINLYMSW 361

Query: 251 WAWRTFLCKEDKDIRVTKKLFLES 274
            AWR +    +KD    ++LF  S
Sbjct: 362 LAWRFYK---NKDSESARRLFRFS 382


>gi|28900399|ref|NP_800054.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260362071|ref|ZP_05775067.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus K5030]
 gi|260877351|ref|ZP_05889706.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260898388|ref|ZP_05906884.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|81726120|sp|Q87IR2|CYOE1_VIBPA RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|28808710|dbj|BAC61887.1| putative cytochrome c oxidase assembly factor [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308085128|gb|EFO34823.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308090899|gb|EFO40594.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308113835|gb|EFO51375.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus K5030]
          Length = 302

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 170/286 (59%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + ++ L KP+V++L + TA VG+ LAP      +++ I +  I + AG++ A N   D  
Sbjct: 17  STYLKLTKPKVVALMLVTAIVGMSLAPVTDFPWIQASIGLIGIGLMAGSAAAFNHLIDRR 76

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART +RP+P G  +P    +  V++ V   V++   +N ++A + F+S+  Y V+
Sbjct: 77  IDARMARTHTRPLPSGDTNPLSVAIFAVAIGVVGFVLLYAWVNELTAWMTFLSLLGYAVV 136

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+ 
Sbjct: 137 YTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHGNAWLLVMIIFIWTPPHFWALAIH 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K  IPMLP       TK  IL+YTVL ++V V+P ++G     Y      L   
Sbjct: 197 RVEDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVMPVLVGMVGFIYLFSALLLNAG 256

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AW+    K   +     + F  SI +L  LF  L+ DH I M
Sbjct: 257 FIYHAWKL---KFAPEPNSAIETFKFSIYHLLALFVALLADHYIGM 299


>gi|120596959|ref|YP_961533.1| protoheme IX farnesyltransferase [Shewanella sp. W3-18-1]
 gi|182639295|sp|A1RE84|CYOE2_SHESW RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|120557052|gb|ABM22979.1| protoheme IX farnesyltransferase [Shewanella sp. W3-18-1]
          Length = 301

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 110/285 (38%), Positives = 167/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  + KP+V++L + T  VG+ LA P  + V   +  +F IA+ AG++ ALN   D 
Sbjct: 18  WRAYFEMTKPKVVALMLLTVLVGMCLAVPTAVPVQPLIAGMFGIALMAGSAAALNHLIDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID MMART +RP+P G++S   A +   S+     V++ + +N ++A L F S+  Y +
Sbjct: 78  RIDGMMARTYNRPLPKGRVSAKRALIFAASIGGLGFVVLYVLVNPLTAWLTFASLIGYAL 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR T QNIVIGG+AGA+PP++GW +VT      +L++ +IIF WTPPHFW+LA+
Sbjct: 138 VYTAYLKRATSQNIVIGGLAGAMPPLLGWTAVTNQFHGHALLLVIIIFTWTPPHFWALAI 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + +Y K  IPMLP       TK  IL+YTVL +I  +LP ++G     Y +    L  
Sbjct: 198 HRRAEYAKVDIPMLPVTHGVEFTKTCILLYTVLLAIACLLPVLVGMCGPMYFVCSSLLSS 257

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   AW+      D    +  ++F  SI +L +LF  L++DH +
Sbjct: 258 VFIYKAWQLKYRDHDG---LAMQVFRFSIYHLMLLFMALLIDHYL 299


>gi|212637521|ref|YP_002314046.1| protoheme IX farnesyltransferase [Shewanella piezotolerans WP3]
 gi|212559005|gb|ACJ31459.1| Protoheme IX farnesyltransferase [Shewanella piezotolerans WP3]
          Length = 301

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 114/288 (39%), Positives = 170/288 (59%), Gaps = 4/288 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           +F+   +  + KP+V++L + T  VG+ LA PG + +   +  +  I M AGA+ A N  
Sbjct: 15  LFQWRAYYEMTKPKVVALMLLTVLVGMCLAVPGTVPLQPLIAGMTGIGMMAGAAAAFNHL 74

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D  ID +MART +RP+P G++S  +A V    L +   VI+   +N ++A L F S+  
Sbjct: 75  IDRRIDGLMARTYNRPLPKGKVSITKALVFSFGLGILGFVILYALVNPLTAWLTFASLIG 134

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT +LKR TPQNIV+GG+AGA+PP++GW SVTG+    +L++ +IIF WTPPHFW+
Sbjct: 135 YAVVYTAYLKRATPQNIVVGGLAGAMPPLLGWTSVTGEFHGNALLLVIIIFAWTPPHFWA 194

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  K +Y K  IPMLP       TK  I +YT+L +I  +LP ++G     Y +    
Sbjct: 195 LAIHRKAEYAKVDIPMLPVTHGVEFTKTCIFLYTILLAIACLLPVLVGMCGPVYLVSSTL 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F   AW+    K  +   +   +F  SI +L +LF  L+VDH +
Sbjct: 255 LSAGFIYKAWQL---KFHETPGLAMNVFKFSIYHLMLLFMALLVDHYL 299


>gi|119946339|ref|YP_944019.1| protoheme IX farnesyltransferase [Psychromonas ingrahamii 37]
 gi|182639533|sp|A1SY55|CYOE_PSYIN RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|119864943|gb|ABM04420.1| protoheme IX farnesyltransferase [Psychromonas ingrahamii 37]
          Length = 311

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 99/285 (34%), Positives = 157/285 (55%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +N ++ L K +V++L + TA VG+ LAP         ++S+F I + + ++  +N   D+
Sbjct: 29  INDYLELCKIKVVALLVLTALVGLALAPDMGRGYFVQLLSLFGIGLLSSSAAVINHIVDS 88

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  M RT +RP+    +S  +A +    +      ++  A NW++A +   ++  Y  
Sbjct: 89  KIDAKMVRTKNRPLVRKAVSRRQALIFSAVIGTLGFSLLVFAANWLTAQMTLFALVGYAF 148

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA+PP++GW S TG ++    ++ +IIF WTPPHFW+LA+
Sbjct: 149 VYTMFLKRATPQNIVIGGLAGAMPPLLGWISETGQLAAQPWILVMIIFTWTPPHFWALAI 208

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY KA IPMLP       TK  IL+Y++L ++V  LP ++  +   Y  +   +  
Sbjct: 209 HRKADYAKAKIPMLPVTHGTDFTKTCILLYSLLLTVVCFLPFLIHMSGYLYLFVAMLINI 268

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   A    L    +       LF  SI +L +LF  L  D  +
Sbjct: 269 IFIYKAVALKLS---ETSYGALNLFKYSILHLTLLFIALFADKFL 310


>gi|53802735|ref|YP_112602.1| protoheme IX farnesyltransferase [Methylococcus capsulatus str.
           Bath]
 gi|81683253|sp|Q60CP3|CYOE_METCA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|53756496|gb|AAU90787.1| protoheme IX farnesyl transferase [Methylococcus capsulatus str.
           Bath]
          Length = 298

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 112/287 (39%), Positives = 169/287 (58%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L K +V+   ++TA +G+ LA PG   +  +  +   I   A ++ ALN + D 
Sbjct: 15  WRTYLALCKLKVVGHIVFTAIIGMFLAVPGVPPLDTAFWASLGIGFAAASAAALNHFLDR 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
             D  MART +RP+P G I P +     + L + ++ I+   +N ++A L F+S+  Y V
Sbjct: 75  HADAEMARTQNRPLPSGDIRPAQVVGFALVLGIVAMAILIAFVNMLTAFLTFLSLIGYAV 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG AGA PP++GW +VTG V   +L++FL+IF+WTPPHFW+ A+
Sbjct: 135 IYTVYLKRATPQNIVIGGAAGAAPPVLGWCAVTGSVHPYALLLFLLIFVWTPPHFWAYAI 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY K  IPMLP       T++HIL+YT+L  + G++P + G +   Y       G 
Sbjct: 195 AKRDDYAKVDIPMLPVTHGIAFTQLHILLYTILLFLAGLMPYVTGMSGEIYLAAALIFGG 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  +A R    K   D R+  + F  S+ YL  +F+ L+VDH I +
Sbjct: 255 IFVYYAIRL---KRKADPRLAMQTFAYSLVYLVGIFSALLVDHYIVL 298


>gi|163733555|ref|ZP_02140998.1| protoheme IX farnesyltransferase [Roseobacter litoralis Och 149]
 gi|161393343|gb|EDQ17669.1| protoheme IX farnesyltransferase [Roseobacter litoralis Och 149]
          Length = 314

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 133/289 (46%), Positives = 184/289 (63%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +L  +  LLKPRVMSL ++TA VG++ AP  +  +    SI  +A+GAGASGALNM++DA
Sbjct: 18  QLGDYFALLKPRVMSLVVFTALVGLLAAPTPVHPVIGFASILFVAIGAGASGALNMWWDA 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT+ RPIP G+I P EA  LG +L+  SI+++ L  N+++A LL  +IF Y V
Sbjct: 78  DIDAIMRRTSKRPIPDGRIQPGEALNLGAALSGLSIMMLALTANFLAAGLLAFTIFFYAV 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IY++WLKR+TPQNIVIGG AGA PP+IGWA  TG +SI + +MF +IF+WTPPHFW+LAL
Sbjct: 138 IYSMWLKRWTPQNIVIGGAAGAFPPVIGWAIATGSLSIEAWLMFALIFMWTPPHFWALAL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY  A +PML      + T+ HI++YTVL +++ V           Y      L  
Sbjct: 198 FMKSDYDDAGVPMLTVTHGRKKTRAHIIVYTVLLAVLAVGTGFTAIGGPIYLAAALVLNA 257

Query: 247 HFTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   A   +   ED     + RV KK F  S+ YLF  F +++++  +
Sbjct: 258 LFLKGAVDIWRRDEDTAIADEYRVEKKFFRLSLWYLFAHFGVILLEAAL 306


>gi|300313438|ref|YP_003777530.1| protoheme IX farnesyltransferase (heme O synthase) transmembrane
           protein [Herbaspirillum seropedicae SmR1]
 gi|300076223|gb|ADJ65622.1| protoheme IX farnesyltransferase (heme O synthase) transmembrane
           protein [Herbaspirillum seropedicae SmR1]
          Length = 297

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 109/285 (38%), Positives = 166/285 (58%), Gaps = 4/285 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           R+  +  L KPRV  LA++ A +G+ L+ P      K +     I + AGA+ A+N   +
Sbjct: 10  RIAQYWALTKPRVTQLAVFCAVIGMFLSTPDLPDWHKVIFGTLGIWLLAGAAFAINCLVE 69

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            +ID  MARTA RP+  G+I+  +  V    L    + ++   +N ++  L F +   Y 
Sbjct: 70  REIDSRMARTARRPMARGEITVGQTLVFSGVLGGLGMWVLYNLVNPLTMWLTFATFVGYA 129

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           +IYTI LK  T QNIVIGG+AGA+PP +GWA++  DV + + V+ +IIF+WTPPHFW+LA
Sbjct: 130 IIYTIVLKPATSQNIVIGGLAGAMPPALGWAAMANDVPMQAWVLVMIIFIWTPPHFWALA 189

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  +DDY K+ +PMLP       TK+H+L+YT+    V +LP  +G + + Y      LG
Sbjct: 190 MYRRDDYAKSGLPMLPITHGMDVTKLHVLMYTIALFAVSLLPFAIGMSGLIYLGTAVVLG 249

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F  ++W+ +    D    + +K F  SI YL +LF +L+VDH 
Sbjct: 250 AIFFWYSWQMYRRYTD---LIARKAFAYSIVYLSILFAVLLVDHY 291


>gi|241955547|ref|XP_002420494.1| heme A:farnesyltransferase, putative; protoheme IX
           farnesyltransferase, mitochondrial precursor, putative
           [Candida dubliniensis CD36]
 gi|223643836|emb|CAX41573.1| heme A:farnesyltransferase, putative [Candida dubliniensis CD36]
          Length = 461

 Score =  148 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 68/309 (22%), Positives = 125/309 (40%), Gaps = 20/309 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ L KP +  L   ++     ++P  +S+ + +      A+ +GA+ A+NM  + + D
Sbjct: 146 AYLKLTKPNLTVLVTLSSICSYAISPLSVSLQELLFLTVGTALCSGAANAINMGREPEFD 205

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           K M RT  RP+  G I+P +A+            ++   +N   + L F +I  Y  +YT
Sbjct: 206 KQMPRTVGRPVVRGLITPTQAYQFAAVSGAIGCGMLWFGVNPTVSLLGFSNIVLYAWLYT 265

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
             +KR +  N  +G + GAIPP++GWA+ +     A+  +  +++ W  PHF +L+    
Sbjct: 266 S-MKRKSIINTWVGAVVGAIPPLMGWAASSSLAHPAAWCLAGLLYAWQFPHFNALSHGIA 324

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
             Y+ A   ++      R      L Y+VL   +    +  G     +           T
Sbjct: 325 QQYKSAGY-VMAAAENPRLNARVALRYSVLMFPLCFGLSYFGVTDWVFPFDSAIANGWLT 383

Query: 250 LWAWRTFLCKEDKDIR--------------VTKKLFLESITYLFVLFTILMVDHLIDMKT 295
             A+  +  +E                     KKLF  S+ +L  +  + M+      K 
Sbjct: 384 YLAYIFWQQQERNYKNGAKATSEGLALAGVHAKKLFWCSVWHLPAVLILAMLHK----KD 439

Query: 296 VERYFFSSF 304
                F   
Sbjct: 440 QWNRLFEHI 448


>gi|323495723|ref|ZP_08100793.1| Protoheme IX farnesyltransferase [Vibrio sinaloensis DSM 21326]
 gi|323319190|gb|EGA72131.1| Protoheme IX farnesyltransferase [Vibrio sinaloensis DSM 21326]
          Length = 298

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 111/271 (40%), Positives = 170/271 (62%), Gaps = 4/271 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ LA PG + V +SVI +  IA+ AG++ A N   D 
Sbjct: 16  WQVYLTLTKPKVVALMLLTALVGMCLAVPGALPVQQSVIGLVGIALMAGSAAAYNHLIDR 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+P G I+P + +    S+ V    ++ + +N ++A L F S+  Y V
Sbjct: 76  RIDAIMARTYKRPLPSGDINPVKVFAFATSIGVLGFALLLVWVNALTAWLTFASLIGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+
Sbjct: 136 VYTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHAHAWLLVMIIFIWTPPHFWALAV 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY KA IPMLP    +  TK  IL+YTVL ++V ++P ++G +   Y +    L  
Sbjct: 196 HRKEDYAKADIPMLPVTHGEEYTKTSILLYTVLLALVCLMPALVGMSGALYWVGSVVLSL 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
            F  +AW+    K + + +     F  SI +
Sbjct: 256 GFIGYAWKL---KYNPEQKTAIDTFKFSIYH 283


>gi|117928335|ref|YP_872886.1| protoheme IX farnesyltransferase [Acidothermus cellulolyticus 11B]
 gi|182637468|sp|A0LTZ0|COXX_ACIC1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|117648798|gb|ABK52900.1| protoheme IX farnesyltransferase [Acidothermus cellulolyticus 11B]
          Length = 307

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 154/286 (53%), Gaps = 1/286 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +   I L KPR++ L + T    ++LA  G  S    V+++ A A+ AG++  LN + D 
Sbjct: 22  VKGLIALTKPRIIELLLVTTVPTMMLAARGWPSSRLVVVTVLAGALAAGSANTLNCFIDR 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RTA RP+    I P EA   GV+L V + ++MG  +NW+SA L   +I  YV 
Sbjct: 82  DIDQVMRRTARRPLVRSVIRPAEALAFGVALGVVATLLMGFLVNWLSAILADAAIVFYVG 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YTI LKR TP NIVIGG AG  P +IGW++VTG V   ++V+F +IF WTPPHFW+LA+
Sbjct: 142 VYTIGLKRRTPSNIVIGGAAGCFPVLIGWSAVTGRVGWPAVVLFAVIFAWTPPHFWALAM 201

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PMLP V         IL Y+       +    +      Y  I   LG 
Sbjct: 202 RFREDYAAAHVPMLPVVAEPLVVARQILWYSYGMVAASLALAPVAHVGWVYVAIAALLGG 261

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            F   A R              +LF  SI+YL +LF  + +   + 
Sbjct: 262 WFLAEAHRIVQRVRLGRDPRPMRLFHMSISYLTLLFVAVALAPYLP 307


>gi|167031146|ref|YP_001666377.1| protoheme IX farnesyltransferase [Pseudomonas putida GB-1]
 gi|205716279|sp|B0KFZ0|CYOE1_PSEPG RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|166857634|gb|ABY96041.1| protoheme IX farnesyltransferase [Pseudomonas putida GB-1]
          Length = 297

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 104/271 (38%), Positives = 152/271 (56%), Gaps = 4/271 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+  G+ LA    +S    +     I + AG +  +N   D 
Sbjct: 12  WRDYLELTKPKVVVLMLITSLAGMFLATRAGVSWSVLLFGNLGIGLCAGGAAVVNHVVDR 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++ P  A +  ++LA+  + ++    N ++A L   S+  Y V
Sbjct: 72  RIDALMARTHKRPLAQGRVEPLPALLFALALALLGMALLLAFTNALTAWLTLASLLGYAV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA+
Sbjct: 132 LYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALAI 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +R TK+HIL+YT++   V +LP  +  +   Y      LG 
Sbjct: 192 HRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVSLLPYAIHMSGPLYLACALVLGL 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
            F  WAW  +              F  SI Y
Sbjct: 252 RFLQWAWVLYRGSR---PHAAIGTFKYSIAY 279


>gi|299134055|ref|ZP_07027248.1| protoheme IX farnesyltransferase [Afipia sp. 1NLS2]
 gi|298590802|gb|EFI51004.1| protoheme IX farnesyltransferase [Afipia sp. 1NLS2]
          Length = 313

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 127/263 (48%), Positives = 181/263 (68%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ +I LLKPRVMSL ++TA VG+V+APGH+  + ++ SI  IA+G GASGALNM+Y+ D
Sbjct: 21  VSDYIALLKPRVMSLVVFTALVGLVIAPGHLHPVLAITSILCIAVGGGASGALNMWYERD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           +D +M RTA+RPIP G+IS  EA   G++LA+ S+  +G+ +NW++  LL  +IF YVV+
Sbjct: 81  VDALMTRTANRPIPRGRISSSEAAAFGITLAIFSVTTLGILVNWLAGALLAFTIFFYVVV 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ WA+ TG ++   +++FLIIFLWTPPHFW+LAL 
Sbjct: 141 YTMWLKRWTAQNIVIGGAAGALPPVVAWAAATGSLAPQPIILFLIIFLWTPPHFWALALF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A+IPMLP V     T++ IL+YT++   V + P  LG+  V YGI    LG  
Sbjct: 201 RSDDYARANIPMLPVVAGPDATRLQILLYTIVLVAVAISPWPLGYFGVAYGITSVLLGAG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKL 270
               A   +  +   +     + 
Sbjct: 261 MLWCAVDVYRKRTGTEANRAARA 283


>gi|197104010|ref|YP_002129387.1| protoheme IX farnesyl transferase [Phenylobacterium zucineum HLK1]
 gi|196477430|gb|ACG76958.1| protoheme IX farnesyl transferase [Phenylobacterium zucineum HLK1]
          Length = 328

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 120/253 (47%), Positives = 169/253 (66%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           R   +  LLKPRVMSL ++TA  G+V A   I  + + +++  IA+GAGASGALNM++DA
Sbjct: 17  RWQDYFQLLKPRVMSLVVFTALTGLVCADRAIHPVLAGVAVLCIAVGAGASGALNMWWDA 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P G++   +A  LGV L++ S+++MG+A+NW +A LL  +I  Y V
Sbjct: 77  DIDAKMRRTRGRPVPAGRVQGADALALGVVLSLFSVMLMGMALNWFAAGLLAFTILFYAV 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR+T QNIVIGG+AGA+PP+IGWA+ TG   + + ++  IIF+WTPPHFW+L+L
Sbjct: 137 VYTMWLKRWTAQNIVIGGLAGALPPVIGWAAATGSAPLNAWLLCAIIFMWTPPHFWALSL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              +DY KA +PMLP V    +T+  ILIY++L   V + P   G   + Y  +    G 
Sbjct: 197 YTSEDYAKAGVPMLPVVRGAASTRRQILIYSLLLIPVCIAPAFTGLGGLPYLAVSSLGGL 256

Query: 247 HFTLWAWRTFLCK 259
            F L AWR +  K
Sbjct: 257 VFLLLAWRLYRSK 269


>gi|170077777|ref|YP_001734415.1| protoheme IX farnesyltransferase [Synechococcus sp. PCC 7002]
 gi|205693578|sp|B1XKB3|COXX_SYNP2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|169885446|gb|ACA99159.1| protoheme IX farnesyltransferase [Synechococcus sp. PCC 7002]
          Length = 317

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 108/285 (37%), Positives = 163/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  GHI  +K +I++    + A ++  LN  YD 
Sbjct: 17  IKSYYQLTKPRIIPLLLITTAASMWIASHGHIDPVKLLITLLGGTLAAASAQTLNCIYDQ 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RPIP G++ P  A +  + L   S  ++ + +N +SA L    I  Y++
Sbjct: 77  DIDFSMQRTRKRPIPSGRVQPRHALIFALILGSLSFSLLMVFVNLLSACLALSGIVFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR   QNIVIGG AG+IPP++GWA+VTG +  ++ ++F +IFLWTPPHFW+LAL
Sbjct: 137 VYTHWLKRHHVQNIVIGGAAGSIPPLVGWAAVTGQLDWSAWILFALIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGF-ASVTYGIIVFFLG 245
           + K+DY +  +PMLP V  ++ T   I IYT++     +L       + + Y I    LG
Sbjct: 197 MIKEDYAEVEVPMLPVVKGEKITVDQIWIYTLIVVPFSLLLVFPFQASGLFYAIAALVLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F   AW     +   D  + K +F  SI Y+ +L T ++VD L
Sbjct: 257 AIFIQKAWEL--KQNPFDQSLAKSMFKYSILYMMLLCTAMVVDSL 299


>gi|316932375|ref|YP_004107357.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315600089|gb|ADU42624.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 312

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 137/285 (48%), Positives = 192/285 (67%), Gaps = 1/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL ++TA VG+++APG    + ++ +I  IA+G GA+GALNM+Y+ D
Sbjct: 20  VADYIALLKPRVMSLVVFTALVGLLMAPGSFHPVLAITAIICIAVGGGAAGALNMWYEDD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RPIP G+++  EA   G++LA  S+V +G+ +NW++A LL  +IF YVVI
Sbjct: 80  IDAKMTRTANRPIPRGRVTRPEALTFGMTLAFFSVVTLGILVNWIAAALLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR+T QNIVIGG AGA+PP++ WASVTG +++  +++FLIIF WTPPHFW+LAL 
Sbjct: 140 YTMWLKRWTAQNIVIGGAAGALPPVVAWASVTGSLAVEPILLFLIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YTV    V   P  LG+    YG+    LG  
Sbjct: 200 RNDDYARAGVPMLPVVSGPDHTRLQILLYTVALVAVAAAPWPLGYFDAIYGVASLALGGW 259

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITYLFVLFTILMVDHLI 291
             + A R +  +         + LF  SI YLF LF IL+V+ ++
Sbjct: 260 MLVLAMRVYRHRTGSAALRATRNLFKFSILYLFALFAILLVEVIV 304


>gi|325274017|ref|ZP_08140174.1| protoheme IX farnesyltransferase [Pseudomonas sp. TJI-51]
 gi|324100844|gb|EGB98533.1| protoheme IX farnesyltransferase [Pseudomonas sp. TJI-51]
          Length = 297

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 104/271 (38%), Positives = 152/271 (56%), Gaps = 4/271 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+ L + T+  G+ LA    +     V     I + AG +  +N   D 
Sbjct: 12  WRDYLELTKPKVVVLMLITSLAGMFLATRAGVGWSVLVFGNLGIGLCAGGAAVVNHVVDR 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++ P  A +  ++LA+  + ++ +  N ++A L   S+  Y V
Sbjct: 72  RIDALMARTRKRPLAQGRVEPLPALLFALALALLGMALLLIFTNALTAWLTLASLLGYAV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR TPQNIVIGG+AGA PP++GW +V+G VS   L++ LIIF WTPPHFW+LA+
Sbjct: 132 LYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGQVSAEPLLLVLIIFAWTPPHFWALAI 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K++Y KA IPMLP    +R TK+HIL+YT++   V +LP  +  +   Y      LG 
Sbjct: 192 HRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVSLLPYAIHMSGPLYLACALALGL 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
            F  WAW  +              F  SI Y
Sbjct: 252 RFLRWAWVLYRGSR---PHAAIGTFKYSIVY 279


>gi|217977423|ref|YP_002361570.1| protoheme IX farnesyltransferase [Methylocella silvestris BL2]
 gi|259586156|sp|B8EPK3|COXX_METSB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|217502799|gb|ACK50208.1| protoheme IX farnesyltransferase [Methylocella silvestris BL2]
          Length = 316

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 140/290 (48%), Positives = 200/290 (68%), Gaps = 1/290 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ L+KPRVMSL I+TA  G+++AP H++ +    S+ AIA GAGASGALNM+YD+DID
Sbjct: 23  DYLALMKPRVMSLVIFTALTGVLIAPTHVNPIIGFASLLAIAAGAGASGALNMWYDSDID 82

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RPIP G+++   A   G+ LA+ S++ +G   NW +A LL  +IF YVVIYT
Sbjct: 83  AIMRRTQKRPIPAGRVARESALAFGMVLALLSVITLGFVANWAAAALLAFTIFFYVVIYT 142

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PP++ + +V G VS+ +L +F IIF+WTPPHFW+LAL+  
Sbjct: 143 MWLKRSTPQNIVIGGAAGAFPPIVAYLAVAGQVSLPALALFAIIFVWTPPHFWALALVKA 202

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            D+++A IPMLPNV     T+  IL+YT+L + +G+ P  +GFAS  YG++ F LG    
Sbjct: 203 GDFERAGIPMLPNVKGPDRTRRDILLYTLLLAPIGMTPYFIGFASPAYGLLSFGLGGVMI 262

Query: 250 LWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVER 298
           L A R +L +E D+  RV  ++F  SI YLF+LF  ++ + ++ +  +  
Sbjct: 263 LHAVRVYLAREGDQANRVAMRMFGFSILYLFLLFAAIVAERILALLPISS 312


>gi|13471157|ref|NP_102726.1| protoheme IX farnesyltransferase [Mesorhizobium loti MAFF303099]
 gi|75543706|sp|Q98LF1|COXX1_RHILO RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|14021901|dbj|BAB48512.1| heme O synthase [Mesorhizobium loti MAFF303099]
          Length = 311

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 148/281 (52%), Positives = 202/281 (71%), Gaps = 1/281 (0%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPRVM+LA++TAFVG+++APG ++ + +VI+I AIA+GAGA+GALNM+YDADID
Sbjct: 22  DFFALLKPRVMALAVFTAFVGLMVAPGAVNPVIAVIAIAAIAIGAGAAGALNMWYDADID 81

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M+RT+ RP+P G+++P EA   G+ L+  S++ +G+ + W++A+LL  +IF Y+VIYT
Sbjct: 82  ALMSRTSKRPVPSGRVTPGEALGFGLVLSALSVMTLGVLVGWLAASLLAFTIFFYIVIYT 141

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA+PP+IGWA+ TG V + SLV+FLIIFLWTPPHFW+LAL   
Sbjct: 142 MWLKRSTPQNIVIGGAAGALPPVIGWAAATGAVGVESLVLFLIIFLWTPPHFWALALFKV 201

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY  A IPM+PNV    +T+  IL Y +L + VGVLP   GF S  YGI    LG  F 
Sbjct: 202 GDYAAAGIPMMPNVAGPASTRRQILAYALLLAPVGVLPWAFGFTSGYYGIASAALGVGFI 261

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             +W+      + +++  K LF  SI YLF +F  L+ D +
Sbjct: 262 WHSWKV-RAASETELKPAKALFAYSIVYLFAVFAALLADTI 301


>gi|88607088|ref|YP_505634.1| protoheme IX farnesyltransferase [Anaplasma phagocytophilum HZ]
 gi|123494496|sp|Q2GJ17|COXX_ANAPZ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|88598151|gb|ABD43621.1| protoheme IX farnesyltransferase [Anaplasma phagocytophilum HZ]
          Length = 296

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 139/286 (48%), Positives = 195/286 (68%), Gaps = 1/286 (0%)

Query: 2   YFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALN 61
           +F +     +  LLKPR+M L ++TA  G+++APG I  L  ++S   IAMG+GA+GALN
Sbjct: 10  HFALSTARDYWQLLKPRIMYLVVFTASTGMIMAPGTIHPLIGLVSALCIAMGSGAAGALN 69

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
           M++D+DID +M+RT +RPIP G+IS  +A   G++L++ S+ IM L +N+VSA LL  SI
Sbjct: 70  MWFDSDIDAVMSRTKTRPIPSGRISRAQALECGLALSLLSVFIMSLTVNYVSAILLACSI 129

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y V+YT+ LKR TPQNIVIGGIAGA PP+IGW SVTG  SI SL++F+IIFLWTPPHF
Sbjct: 130 AFYAVVYTMVLKRRTPQNIVIGGIAGAFPPVIGWTSVTGIPSIESLLLFMIIFLWTPPHF 189

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+L+LL +D+Y+ A IPML  V + ++TK HI+ Y++L  IV +LP +    +V Y II 
Sbjct: 190 WALSLLNRDEYKLAGIPMLS-VYSVQSTKNHIMGYSLLLFIVALLPGLYVAETVLYEIIA 248

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
             LG  F   A+       +   +    LF  SI YLF++F+ + +
Sbjct: 249 TSLGAVFLTHAYCLLKEVGEPSPKACMGLFSFSIYYLFLIFSAIAL 294


>gi|68482636|ref|XP_714715.1| hypothetical protein CaO19.10676 [Candida albicans SC5314]
 gi|46436305|gb|EAK95669.1| hypothetical protein CaO19.10676 [Candida albicans SC5314]
          Length = 461

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 69/309 (22%), Positives = 124/309 (40%), Gaps = 20/309 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ L KP +  L   ++     ++P  +S+ + +      A+ +GA+ A+NM  + + D
Sbjct: 146 AYLKLTKPNLTVLVTLSSICSYAISPLSVSLQELMFLTVGTALCSGAANAINMGREPEFD 205

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           K M RT  RP+  G I+P +A+            ++   +N   + L F +I  Y  +YT
Sbjct: 206 KQMPRTVGRPVVRGLITPTQAYRFAAVSGAIGCGMLWFGVNPTVSLLGFSNIVLYAWLYT 265

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
             +KR +  N  +G + GAIPP++GWA+ +     A+  +  +++ W  PHF +L+    
Sbjct: 266 S-MKRKSIINTWVGAVVGAIPPLMGWAASSSLAHPAAWCLAGLLYAWQFPHFNALSHGIA 324

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
             Y+ A   M       R      L Y+VL   +    +  G     +           T
Sbjct: 325 QQYKSAGYVMTA-AENPRLNARVALRYSVLMFPLCFGLSYFGVTDWVFPFDSAIANGWLT 383

Query: 250 LWAWRTFLCKEDKDIR--------------VTKKLFLESITYLFVLFTILMVDHLIDMKT 295
             A+  +  +E                     KKLF  S+ +L  +  + M+      K 
Sbjct: 384 YLAYVFWQQQEKNYKNGAKPTSEGLALAGVHAKKLFWCSVWHLPAVLILAMLHK----KD 439

Query: 296 VERYFFSSF 304
                F   
Sbjct: 440 QWNRLFEHI 448


>gi|145590110|ref|YP_001156707.1| protoheme IX farnesyltransferase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|205693491|sp|A4T079|COXX_POLSQ RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|145048516|gb|ABP35143.1| protoheme IX farnesyltransferase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 297

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 166/288 (57%), Gaps = 4/288 (1%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNM 62
            + R   + VL KPRV  LA++ A +G+ LA PG +        I  I + AGA+ A+N 
Sbjct: 11  SMPRWRQYWVLTKPRVTQLAVFCAVIGMFLATPGMVPYPVLFGGIAGIWLLAGAAFAVNC 70

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
             +  +D  M RT+ RP   G+++P+   +  + L    ++I+    N ++  L   +  
Sbjct: 71  LIEQAVDAKMKRTSWRPSATGEVTPFHIIIFSIILGSLGMIILWNFCNPLTMWLTLATFV 130

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y VIYT  LK  TPQNIVIGG++GA+PP +GWA+VT  +S  + ++ LIIF+WTPPHFW
Sbjct: 131 GYAVIYTWLLKPATPQNIVIGGLSGAMPPALGWAAVTNGLSAEAWLLVLIIFVWTPPHFW 190

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LAL  +DDY ++ +PMLP    +R T ++IL+YT++     +LP + G + + Y I   
Sbjct: 191 ALALYRRDDYVQSGLPMLPVTHGERFTLLNILLYTLILIAATLLPYIYGMSGIIYLISAI 250

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
            LG  F  +    F+   D    + KK F  SITYL +LF  L++DH 
Sbjct: 251 VLGLMFLAYVIALFVSYSD---ALAKKTFRFSITYLSLLFAALLIDHY 295


>gi|326440302|ref|ZP_08215036.1| protoheme IX farnesyltransferase [Streptomyces clavuligerus ATCC
           27064]
          Length = 288

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 165/286 (57%), Gaps = 4/286 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            F+ L KPR++ L + T    + LA  G   +   + + F   + AG + ALNMY D DI
Sbjct: 2   AFVALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLATCFGGYLSAGGANALNMYIDRDI 61

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT+ RP+  G +SP EA V G++LAV S +  GL +NW+SA L   ++  YVV+Y
Sbjct: 62  DALMDRTSGRPLVTGMVSPREALVFGITLAVVSTLWFGLLVNWLSAWLALGALLFYVVVY 121

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QNIV GGIAG +P +IGW+SVT  +S A++V+FL+IF WTPPH+W L++  
Sbjct: 122 TMILKRRTAQNIVWGGIAGCMPVLIGWSSVTNSLSWAAVVLFLVIFFWTPPHYWPLSMKV 181

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           K+DY +  +PMLP V +++     I++Y+ +   V +L T +G+    Y  +    G  +
Sbjct: 182 KEDYARVGVPMLPVVASNKVVARQIVLYSWVMVGVSLLLTPMGYTGWFYTAVALAAGGWW 241

Query: 249 TLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              A                   +LF  SITY+ +LF  + VD  +
Sbjct: 242 LWEAHALQTRARAGVTGGKLKEMRLFHWSITYVSLLFVAVAVDPFL 287


>gi|295695009|ref|YP_003588247.1| protoheme IX farnesyltransferase [Bacillus tusciae DSM 2912]
 gi|295410611|gb|ADG05103.1| protoheme IX farnesyltransferase [Bacillus tusciae DSM 2912]
          Length = 311

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 101/282 (35%), Positives = 160/282 (56%), Gaps = 3/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ + K  +    ++T F G+ LA  G I    +V+++   A+  G   ALN + D 
Sbjct: 30  WKDYVSITKVGINVANLWTTFAGLWLAGHGRIDGYTTVVTLAGTALVVGGGAALNNWIDR 89

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID++M RTA RP+  G+I   +  +LG +++++ +V++ + IN ++A   F+  F YV+
Sbjct: 90  DIDRVMPRTAKRPLANGRIPAVQGLLLGSAISLAGLVLLAVGINGLAALTAFIGWFTYVI 149

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR T  N V+GGIAGA+PP+IGWA+V G +  ++ ++F IIFLW PPHF++LA+
Sbjct: 150 VYTLWLKRTTTLNTVVGGIAGAVPPLIGWAAVRGTLDPSAWILFSIIFLWQPPHFFALAM 209

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              DDY+ A IPMLP V     T+  +L YTV+   V +L    G A   Y I    LG 
Sbjct: 210 KRVDDYRAAGIPMLPVVRGFEPTRRQMLGYTVVLWPVSLLLFWTGAAGWLYLIPAAILGG 269

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            +   +   F   E   ++    +F  S+ YL  +    +V 
Sbjct: 270 IYVGMSLWGFRTSEP--MKWANGMFRYSLIYLMAICAAAIVG 309


>gi|254283920|ref|ZP_04958888.1| protoheme IX farnesyltransferase [gamma proteobacterium NOR51-B]
 gi|219680123|gb|EED36472.1| protoheme IX farnesyltransferase [gamma proteobacterium NOR51-B]
          Length = 302

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 116/284 (40%), Positives = 171/284 (60%), Gaps = 4/284 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
            + ++ L KPRV++L I TA +G+ +A PG +     V+    IA+ AGA+ A+N   D 
Sbjct: 15  WHDYLELTKPRVVALMIITALIGMCMAVPGWVPWQPLVMGNLGIALCAGAAAAINHIVDE 74

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID+ MART +RP+  G++S   A +    L    +VI+ + +N ++A L   S+  Y V
Sbjct: 75  AIDQRMARTRNRPVAQGRVSTRNAVLFSALLTAVGVVILVVWVNVITAVLTVASLVGYAV 134

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVIGG+AGA PP++GW +VTG++   +L++ LIIF WTPPHFW+LA+
Sbjct: 135 VYTMFLKRATPQNIVIGGLAGAAPPLLGWTAVTGEIHGHALLLVLIIFAWTPPHFWALAI 194

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +++Y    +PMLP     R T + IL+YT+L  ++ +LP   G +S  Y      LG 
Sbjct: 195 HRREEYAAVGVPMLPVTHGVRFTALQILLYTILMVLISLLPFATGLSSWLYLAGALVLGA 254

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
            F  W+        DK+       F  SITYL VLF I++VDH 
Sbjct: 255 VFMYWSVEII---RDKNPAAPMATFKYSITYLMVLFIIMLVDHW 295


>gi|238882605|gb|EEQ46243.1| protoheme IX farnesyltransferase, mitochondrial precursor [Candida
           albicans WO-1]
          Length = 461

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 69/309 (22%), Positives = 124/309 (40%), Gaps = 20/309 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ L KP +  L   ++     ++P  +S+ + +      A+ +GA+ A+NM  + + D
Sbjct: 146 AYLKLTKPNLTVLVTLSSICSYAISPLSVSLQELMFLTVGTALCSGAANAINMGREPEFD 205

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           K M RT  RP+  G I+P +A+            ++   +N   + L F +I  Y  +YT
Sbjct: 206 KQMPRTVGRPVVRGLITPTQAYQFAAVSGAIGCGMLWFGVNPTVSLLGFSNIVLYAWLYT 265

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
             +KR +  N  +G + GAIPP++GWA+ +     A+  +  +++ W  PHF +L+    
Sbjct: 266 S-MKRKSIINTWVGAVVGAIPPLMGWAASSSLAHPAAWCLAGLLYAWQFPHFNALSHGIA 324

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
             Y+ A   M       R      L Y+VL   +    +  G     +           T
Sbjct: 325 QQYKSAGYVMTA-AENPRLNARVALRYSVLMFPLCFGLSYFGVTDWVFPFDSAIANGWLT 383

Query: 250 LWAWRTFLCKEDKDIR--------------VTKKLFLESITYLFVLFTILMVDHLIDMKT 295
             A+  +  +E                     KKLF  S+ +L  +  + M+      K 
Sbjct: 384 YLAYVFWQQQEKNYKNGAKPTSEGLALAGVHAKKLFWCSVWHLPAVLILAMLHK----KD 439

Query: 296 VERYFFSSF 304
                F   
Sbjct: 440 QWNRLFEHI 448


>gi|332974248|gb|EGK11180.1| protoheme IX farnesyltransferase [Desmospora sp. 8437]
          Length = 316

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 95/280 (33%), Positives = 152/280 (54%), Gaps = 3/280 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDAD 67
              + L KP +    ++    G  LA G I   +    ++   A+  G S ALN   D D
Sbjct: 32  RDVLSLTKPGINLSNLFACLAGYWLASGGIPEWMSLSWALLGTALVVGGSCALNNGIDRD 91

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT  RP+P G++    A +LG+ L  + + ++ + +N ++A L     F YVV+
Sbjct: 92  FDRKMERTKHRPVPSGRVDRRAAVLLGLILVGAGVWLLAVGVNPLAAWLAAAGSFLYVVV 151

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR +  N VIG ++GAIPP+IGWA+    ++  + ++F I+FLW PPHF++LALL
Sbjct: 152 YTLWLKRISTSNTVIGSLSGAIPPLIGWAAAGQGLTWTAWILFFILFLWQPPHFFALALL 211

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY++A IPMLP V  +R T+  +L++  +   V +L    G  S  Y +    LG  
Sbjct: 212 KTEDYRRAGIPMLPVVKGERNTRRQMLLFVWILLPVSLLLGGTGTVSRGYSVTALVLGVS 271

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
           + + A      K   + R  + +F  S+ YL ++ T + V
Sbjct: 272 YLMLA--LLRFKGGGEKRWARWMFRYSLIYLTLILTAVAV 309


>gi|75674424|ref|YP_316845.1| protoheme IX farnesyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|123614291|sp|Q3SW48|COXX1_NITWN RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|182637554|sp|Q3SUL3|COXX2_NITWN RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|74419294|gb|ABA03493.1| protoheme IX farnesyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 312

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 128/271 (47%), Positives = 177/271 (65%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVMSL I+TA VG+++APGHI  +   I+I  IA+GAGASGALNM  + D
Sbjct: 20  VADYFALLKPRVMSLVIFTALVGLMIAPGHIHPVLGFIAILCIAVGAGASGALNMALEGD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G++L+  S++ +G  +NW +  LL  +IF YVVI
Sbjct: 80  IDVLMSRTANRPIPRGRITRGEAMGFGLTLSFFSVMTLGALVNWYAGGLLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIVIGG AGA+PP++ WA+ TG +S+  L++FLIIF WTPPHFW+LAL 
Sbjct: 140 YTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSVEPLLLFLIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG+    LG  
Sbjct: 200 RSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWVYGVTSLILGAG 259

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITY 277
             + A   +  +         ++LF  SI Y
Sbjct: 260 MLVLAIEVYRHRTGSQALRATRRLFAFSILY 290


>gi|83945306|ref|ZP_00957654.1| protoheme IX farnesyltransferase [Oceanicaulis alexandrii HTCC2633]
 gi|83851140|gb|EAP88997.1| protoheme IX farnesyltransferase [Oceanicaulis alexandrii HTCC2633]
          Length = 321

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 133/299 (44%), Positives = 180/299 (60%), Gaps = 13/299 (4%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMY 63
            +     ++ L+KPRVM+L ++T   G   AP  ++ L + I++  IA+GAGA+GA NM 
Sbjct: 7   SLASWRDYVSLMKPRVMTLVVFTGLAGFAAAPVAVNFLTAAIAMLCIAVGAGAAGAFNMA 66

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
           YDADID +M RT  RP+P G++   EA+V    +A++S+++M LA N+V+A LL  SIF 
Sbjct: 67  YDADIDAIMKRTRRRPVPTGRVPANEAYVFSGVMALASVLLMALATNYVAAGLLAFSIFF 126

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y VIYT+WLKR TPQNIVIGG AGA PPMIGWA+ TGD+S+ S+++F IIFLWTPPH W+
Sbjct: 127 YTVIYTMWLKRSTPQNIVIGGAAGAFPPMIGWAAATGDISLNSVLLFAIIFLWTPPHSWA 186

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LAL    DY  A +PM+P     ++T+  ILIYT L       P M G     Y   V  
Sbjct: 187 LALYKSGDYSAAGVPMMPVAKGAKSTRFQILIYTALYLAATAGPIMTGLGGWVYAGAVVL 246

Query: 244 LGYHFTLWAWRTFLCKEDKDI-------------RVTKKLFLESITYLFVLFTILMVDH 289
            G  F L A R F  +                  +  + LF  SI +L +LF  L+V+H
Sbjct: 247 GGALFALLAVRVFASRAGDANAAEDELYAVRAGDKAARDLFAYSIAHLTLLFAALLVEH 305


>gi|282861999|ref|ZP_06271062.1| protoheme IX farnesyltransferase [Streptomyces sp. ACTE]
 gi|282563024|gb|EFB68563.1| protoheme IX farnesyltransferase [Streptomyces sp. ACTE]
          Length = 285

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 108/284 (38%), Positives = 160/284 (56%), Gaps = 4/284 (1%)

Query: 12  IVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           + L KPR++ L + T    + LA  G   +   + +     + AG + ALNMY D DID 
Sbjct: 1   MALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLATTVGGYLSAGGANALNMYIDRDIDA 60

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
           +M RT+ RP+  G +SP E    G++L V S V  GL +NW+SA L   ++  YVV+YT+
Sbjct: 61  LMDRTSQRPLVTGMVSPRECLAFGIALGVISTVWFGLLVNWLSAALALGALLFYVVVYTM 120

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR T QNIV GGIAG +P +IGW++VT  +S A++++F +IF WTPPH+W L++  KD
Sbjct: 121 LLKRRTSQNIVWGGIAGCMPVLIGWSAVTNSMSWAAVILFAVIFFWTPPHYWPLSMKVKD 180

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +  +PMLP V T+R     I++Y+ +   V +L T LG+    Y  +    G  +  
Sbjct: 181 DYARVGVPMLPVVATNRVVARQIVVYSWVMVAVSLLLTPLGYTGWFYTTVAALTGGFWLW 240

Query: 251 WAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 241 EAHGLQNRAKAGVTGGKLKEMRLFHWSITYVSLLFVAVAVDPFL 284


>gi|153837361|ref|ZP_01990028.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus AQ3810]
 gi|260902879|ref|ZP_05911274.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|149749276|gb|EDM60055.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus AQ3810]
 gi|308107827|gb|EFO45367.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus AQ4037]
          Length = 302

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 170/286 (59%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + ++ L KP+V++L + TA VG+ LAP      +++ I +  I + AG++ A N   D  
Sbjct: 17  STYLKLTKPKVVALMLVTAIVGMSLAPVTDFPWIQASIGLIGIGLMAGSAAAFNHLIDRR 76

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART +RP+P G  +P    +  V++ V   V++   +N ++A + F+S+  Y V+
Sbjct: 77  IDARMARTHTRPLPSGDTNPLSVAIFAVAIGVVGFVLLYAWVNALTAWMTFLSLLGYAVV 136

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+ 
Sbjct: 137 YTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHGNAWLLVMIIFIWTPPHFWALAIH 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K  IPMLP       TK  IL+YTVL ++V V+P ++G     Y      L   
Sbjct: 197 RVEDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVMPVLVGMVGFIYLFSALLLNAG 256

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AW+    K   +     + F  SI +L  LF  L+ DH I M
Sbjct: 257 FIYHAWKL---KFAPEPNSAIETFKFSIYHLLALFVALLADHYIGM 299


>gi|308047915|ref|YP_003911481.1| protoheme IX farnesyltransferase [Ferrimonas balearica DSM 9799]
 gi|307630105|gb|ADN74407.1| protoheme IX farnesyltransferase [Ferrimonas balearica DSM 9799]
          Length = 301

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 115/287 (40%), Positives = 175/287 (60%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ + KP+V++L + TA VG+ LA PG I +   +  +  I M AG++ A+N   D 
Sbjct: 16  WRDYLEMTKPKVVALMLVTALVGMALATPGWIPLTALIFGLTGIGMMAGSAAAINHLVDR 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART +RP+P G+++P +A +    L V+   ++   +N ++A L   S+  Y V
Sbjct: 76  RIDTIMARTHNRPLPKGRVAPRQALIFAAVLGVAGFTLLYALVNPLTAWLTCASLVGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA+PP++GW +VTGD     +++ +IIF WTPPHFW+LA+
Sbjct: 136 IYTGFLKRATPQNIVIGGLAGAMPPLLGWTAVTGDFHGHGMLLVIIIFAWTPPHFWALAI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K+DY +A +PMLP       TK HIL+Y+ L ++  +LP ++G +   Y +    L  
Sbjct: 196 HRKEDYARAGLPMLPVTHGVEYTKTHILLYSFLLALACLLPVLVGMSGPLYLLGSTVLSG 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   AW+     E  +     KLFL SI  L  LF +L+VDH +++
Sbjct: 256 WFVWRAWQLKFQPERYEP---IKLFLFSIWQLLALFVLLLVDHYLEL 299


>gi|205696367|sp|A8IDL3|COXX_AZOC5 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 307

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 128/268 (47%), Positives = 180/268 (67%), Gaps = 1/268 (0%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +I LLKPRVMSL I+TA VG+V AP H+  + +  +I  IA+GAGA+GALNM++DADI
Sbjct: 21  RDYISLLKPRVMSLVIFTALVGLVRAPDHVHPVIAFTAILCIAVGAGAAGALNMWWDADI 80

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M+RT  RPIP G+++P EA   G++LA  S+V++GL +N ++  LL  +IF YVV+Y
Sbjct: 81  DAVMSRTQRRPIPAGRVTPREALAFGLTLAAFSVVVLGLLVNVLAGALLAFTIFFYVVVY 140

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR TPQNIVIGG++GA+PPM+ WA+ +G +S+ S+++  IIF WTPPHFW+L+L  
Sbjct: 141 TMWLKRSTPQNIVIGGLSGALPPMVAWAAASGSISLESVILVAIIFFWTPPHFWALSLYR 200

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            DDY +A +PMLP       T+  IL+YT+    + + P MLG A + YG++    G   
Sbjct: 201 ADDYARAGVPMLPVTAGPDETRKQILLYTLFLVPLALSPVMLGEAGLAYGVVAGVTGLGM 260

Query: 249 TLWAWRTFLCKEDKDIR-VTKKLFLESI 275
            L A   +  +         KKLF  SI
Sbjct: 261 LLLAVNVYRRRTGPAAVTAAKKLFGFSI 288


>gi|110679411|ref|YP_682418.1| protoheme IX farnesyltransferase [Roseobacter denitrificans OCh
           114]
 gi|123172551|sp|Q167W1|COXX_ROSDO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|109455527|gb|ABG31732.1| protoheme IX farnesyltransferase [Roseobacter denitrificans OCh
           114]
          Length = 314

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 132/289 (45%), Positives = 181/289 (62%), Gaps = 4/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +L  +  LLKPRVMSL ++TA VG+  AP  +  +    SI  +A+GAGASGALNM++DA
Sbjct: 18  QLGDYFALLKPRVMSLVVFTALVGLQAAPVSVHPVIGFASILFVAIGAGASGALNMWWDA 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RTA+RPIP G++ P EA  LG +L+  SI+++ L  N+++A LL  +IF Y V
Sbjct: 78  DIDAVMRRTANRPIPAGRVQPGEALNLGAALSGLSIMMLALTANFLAAGLLAFTIFFYAV 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IY++WLKR+TPQNIVIGG AGA PP+IGW   TG +SI + +MF +IF+WTPPHFW+LAL
Sbjct: 138 IYSMWLKRWTPQNIVIGGAAGAFPPVIGWVIATGSLSIEAWLMFALIFMWTPPHFWALAL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY  A +PML      + T+ HI+ YTVL +++ V           Y      L  
Sbjct: 198 FMKSDYDDAGVPMLTVTHGRKKTRAHIIAYTVLLAVLAVGTGFSAIGGPVYLAAALVLNA 257

Query: 247 HFTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F   A   +   ED     + RV KK F  S+ YLF  F  ++++  +
Sbjct: 258 LFLKGAIDIWRRDEDTAIADEYRVEKKFFRLSLWYLFAHFGAILLESAL 306


>gi|239978836|ref|ZP_04701360.1| protoheme IX farnesyltransferase [Streptomyces albus J1074]
          Length = 283

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 109/282 (38%), Positives = 162/282 (57%), Gaps = 4/282 (1%)

Query: 14  LLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
           + KPR++ L + T    + LA  G  S+   +++     + AG + ALNMY D DID +M
Sbjct: 1   MTKPRIIELLLITTVPVMFLAEQGVPSLSLVLVTCLGGYLSAGGANALNMYIDRDIDALM 60

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT+ RP+  G ISP E  V G++LAV S +  GL +NW+SA L   ++  YVV+YT+ L
Sbjct: 61  ERTSQRPLVTGMISPREGLVFGLALAVISTLWFGLLVNWLSAWLSLGALLFYVVVYTMIL 120

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR T QNIV GGIAG +P +IGW++VT  VS A++++FL+IF WTPPH+W L++  K+DY
Sbjct: 121 KRRTAQNIVWGGIAGCMPVLIGWSAVTNTVSWAAVILFLVIFFWTPPHYWPLSMKVKEDY 180

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +  +PMLP + ++R     I+IY+ +   V +L   LG+    Y  +    G  +   A
Sbjct: 181 ARVGVPMLPVIASNRVVARQIVIYSWVMVGVSLLLQPLGYTGWFYTAVALVTGGWWLWEA 240

Query: 253 WRTFLCKEDKD---IRVTKKLFLESITYLFVLFTILMVDHLI 291
                              +LF  SITY+ +LF  + VD  +
Sbjct: 241 HGLQNRARQGTTGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 282


>gi|54296448|ref|YP_122817.1| protoheme IX farnesyltransferase [Legionella pneumophila str.
           Paris]
 gi|81371187|sp|Q5X7X6|CYOE_LEGPA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|53750233|emb|CAH11627.1| hypothetical protein lpp0479 [Legionella pneumophila str. Paris]
          Length = 294

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 103/269 (38%), Positives = 160/269 (59%), Gaps = 4/269 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T  VG+ LA PG +S+     ++  I + AG++ A+N   D 
Sbjct: 13  WRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVSLRLIAFTLLGIGLCAGSAAAINHLVDR 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++S  +A    V + +  + ++ L +N ++A L F+++  Y  
Sbjct: 73  HIDSIMARTKKRPVAYGRVSVKQALWFAVIIGLMGLSLLILFVNQLTALLTFVTLIGYAG 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR T QNIVIGG+AGA PP++GW +VTG +   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 VYTGYLKRATSQNIVIGGLAGAAPPLLGWTAVTGQLDPQALLLVLIIFTWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               +YQ A IPMLP     + TK++I +YTVL  +V +LP ++  +   Y +    LG 
Sbjct: 193 YRYKEYQDAEIPMLPVTHGIQFTKLNIYLYTVLLLVVSLLPFVVSMSGWIYLLGALVLGI 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESI 275
            F +WA + +   +     V  + F  SI
Sbjct: 253 RFLVWAHKLYFTDK---PVVAMQTFRFSI 278


>gi|163867879|ref|YP_001609083.1| protoheme IX farnesyltransferase [Bartonella tribocorum CIP 105476]
 gi|205693098|sp|A9IQQ6|COXX_BART1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|161017530|emb|CAK01088.1| protoheme IX farnesyltransferase [Bartonella tribocorum CIP 105476]
          Length = 311

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 143/285 (50%), Positives = 195/285 (68%), Gaps = 1/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           ++ +I LLKPRVMSL ++TA VG++++P  I+     ++I  IA+G G +GALNM+YDAD
Sbjct: 21  ISDYIALLKPRVMSLVVFTALVGLMVSPVPINPWYGFLAIICIAVGGGGAGALNMWYDAD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP+G+ISP +A++ G+ L++ S+++MG  INW +A  L  +IF YVVI
Sbjct: 81  IDAVMERTKKRPIPMGKISPPKAFIFGMVLSLLSVLVMGSFINWFAAFFLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR TPQNIVIGG +GA PPMIGWA  TG VS+ S ++FLIIF+WTPPHFW+L+L 
Sbjct: 141 YTIWLKRITPQNIVIGGASGAFPPMIGWAVTTGAVSLDSFLLFLIIFMWTPPHFWALSLF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY+ A IPM+PNV  + +TK  IL YTVL  +    P   G   V YGI    LG  
Sbjct: 201 SSLDYEAAGIPMMPNVRGEYSTKKQILFYTVLMVLCATAPCFTGLGGVFYGIFSTILGII 260

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F  +A+R +     D+ I + KK F  S+ YL  +F  L+++ L+
Sbjct: 261 FIYFAYRLWKANTHDETILMAKKTFFFSLLYLAAVFGALLIESLV 305


>gi|54293406|ref|YP_125821.1| protoheme IX farnesyltransferase [Legionella pneumophila str. Lens]
 gi|81369279|sp|Q5WZC7|CYOE_LEGPL RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|53753238|emb|CAH14685.1| hypothetical protein lpl0455 [Legionella pneumophila str. Lens]
          Length = 294

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 102/269 (37%), Positives = 159/269 (59%), Gaps = 4/269 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T  VG+ LA PG +S+     ++  I + AG++ A+N   D 
Sbjct: 13  WRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVSLRLIAFTLLGIGLCAGSAAAINHLVDR 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++S  +A    V + +  + ++ L +N ++A L F+++  Y  
Sbjct: 73  HIDSIMARTKKRPVAYGRVSVKQALWFAVIIGLMGLSLLILFVNQLTALLTFITLIGYAG 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR T QNIVIGG+AGA PP++GW +VT  +   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 VYTGYLKRATSQNIVIGGLAGAAPPLLGWTAVTDQLDPQALLLVLIIFTWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               +YQ A IPMLP     + TK++I +YTVL  +V +LP ++  +   Y +    LG 
Sbjct: 193 YRYKEYQDAEIPMLPVTHGIQFTKLNIYLYTVLLLVVSLLPFVVSMSGWIYLLGALILGI 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESI 275
            F +WA + +   +     V  + F  SI
Sbjct: 253 RFLVWAHKLYFTDK---PVVAMQTFRFSI 278


>gi|221065322|ref|ZP_03541427.1| protoheme IX farnesyltransferase [Comamonas testosteroni KF-1]
 gi|220710345|gb|EED65713.1| protoheme IX farnesyltransferase [Comamonas testosteroni KF-1]
          Length = 307

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 106/290 (36%), Positives = 164/290 (56%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALN 61
            R   +  L KP+V+ L ++ AF+G+VLA    P      + + +   I + A A+ A N
Sbjct: 20  SRWAQYHALTKPKVVQLIVFCAFIGMVLAVPGVPSWQDWGRMLAACTGIWLVAAAAAAFN 79

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +A +    L  +   ++ LA+N ++  L   + 
Sbjct: 80  CLVERSIDARMKRTAWRPTARGELSHSQALLFSALLCAAGSTVLLLAVNALTLWLTLATF 139

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TG V   +L++FLIIFLWTPPHF
Sbjct: 140 IGYAVIYTLVLKPLTPQNIVIGGASGAMPPVLGWAAMTGQVGHEALLLFLIIFLWTPPHF 199

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY++A +PMLP    +  T++ + +YT++     +LP ++G +   Y    
Sbjct: 200 WALALYRVEDYRRAGLPMLPVTHGNAFTRLQVFLYTLVLFAGCLLPFVVGMSGYLYLFAA 259

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             LG  F  + W       D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 260 VILGLGFCGYGWALLRNYSD---ALARKTFRFSLIHLSLLFAALLVDHYL 306


>gi|205696365|sp|B2AGR8|COXX_CUPTR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 307

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWPVLIGGAAGIWLLAGAAFAINCLVEQK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  V    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 81  IDALMRRTAWRPSATGEITTRQTLVFSAILGGAGMWLLHVYANDLTMWLTFATFLGYAVV 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GWA+V G+V   +  + LIIF WTPPHFW+LAL 
Sbjct: 141 YTILLKPATPQNIVIGGLSGAMPPALGWAAVAGEVPAEAWFLVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    +R T +HIL+YT++     +LP + G +   Y      LG  
Sbjct: 201 RRADYAKSGLPMLPVTHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLAAALALGAG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AW+ +    D+   + ++ F  SI YL +LF  L+VDH    
Sbjct: 261 FLAYAWKLYRNYSDE---LAQRTFRFSILYLSLLFAALLVDHYFKF 303


>gi|260769604|ref|ZP_05878537.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           furnissii CIP 102972]
 gi|260614942|gb|EEX40128.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB [Vibrio
           furnissii CIP 102972]
          Length = 298

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 171/288 (59%), Gaps = 4/288 (1%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMY 63
           V R   ++ L KP+V++L + TA VG+ LA PG +    +V+ +  I + AGA+ ALN  
Sbjct: 14  VSRWQIYLTLTKPKVVALMLLTALVGMCLAQPGLMPFKAAVLGLSGIGLMAGAAAALNHL 73

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
            D  ID MMART  RP+P G+I      +    L +    I+   +N ++A L F S+  
Sbjct: 74  IDRRIDAMMARTYKRPLPSGEIQASRVMLFAFVLGIVGFAILYWGVNGLTAWLTFASLLG 133

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT++LKR TPQNIVI G+AGA+PP++GW SVTG++   + ++ +IIF+WTPPHFW+
Sbjct: 134 YAVVYTLYLKRATPQNIVIAGLAGAMPPLLGWTSVTGELHANAWLLVMIIFIWTPPHFWA 193

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+  KDDY KA IPMLP       TK  IL+YT L ++V VLP ++G + V Y      
Sbjct: 194 LAIHRKDDYAKADIPMLPVTHGVEYTKTSILLYTFLLALVCVLPVLVGMSGVIYFAASSV 253

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L   F   AW     K D +       F  SI +L +LF  L++DH +
Sbjct: 254 LSLGFIYSAWAL---KYDPENSSAINTFKYSIYHLMMLFIALLLDHYL 298


>gi|91090860|ref|XP_972689.1| PREDICTED: similar to CG5037 CG5037-PA [Tribolium castaneum]
 gi|270013242|gb|EFA09690.1| hypothetical protein TcasGA2_TC011818 [Tribolium castaneum]
          Length = 381

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 67/282 (23%), Positives = 134/282 (47%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L K R+ +L + T+  G  +AP         + I    + + A+ A+N +++  
Sbjct: 82  IQHYLKLSKIRLTTLVVVTSMAGYAVAPAPFEWGPFALCIAGTGLLSAAANAVNQFHEVP 141

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M RT  R +  G+++P  + +   + ++S + I+   +N ++ATL   +   Y  I
Sbjct: 142 FDAQMNRTKHRVLVCGRLTPLHSILFAATTSLSGLAILNFGVNGLTATLGLTNFILYTSI 201

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GWA+    +   + +M  +++ W  PHF +L+  
Sbjct: 202 YTP-MKRMSILNTWVGSIVGAIPPLMGWAACANSLGPGAWLMAALLYSWQFPHFNALSWN 260

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L +TV    + +    L   +  + +    L  +
Sbjct: 261 LRPDYSRAGYRMMAVTDPG-LCRRVALRHTVALEAMTIAAPFLDVTNWWFVLEASPLNLY 319

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   A+  +    D   + ++KLF  S+ +L +L  + +V+ 
Sbjct: 320 FIYLAYDFYK---DSSSQSSRKLFRFSLIHLPLLMILFLVNK 358


>gi|56417073|ref|YP_154147.1| protoheme IX farnesyltransferase [Anaplasma marginale str. St.
           Maries]
 gi|222475439|ref|YP_002563856.1| cytochrome c oxidase assembly factor (ctaB) [Anaplasma marginale
           str. Florida]
 gi|254995246|ref|ZP_05277436.1| protoheme IX farnesyltransferase [Anaplasma marginale str.
           Mississippi]
 gi|255003425|ref|ZP_05278389.1| protoheme IX farnesyltransferase [Anaplasma marginale str. Puerto
           Rico]
 gi|255004545|ref|ZP_05279346.1| protoheme IX farnesyltransferase [Anaplasma marginale str.
           Virginia]
 gi|81358931|sp|Q5P9Y8|COXX_ANAMM RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|254765930|sp|B9KGP6|COXX_ANAMF RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|56388305|gb|AAV86892.1| cytochrome c oxidase assembly factor [Anaplasma marginale str. St.
           Maries]
 gi|222419577|gb|ACM49600.1| cytochrome c oxidase assembly factor (ctaB) [Anaplasma marginale
           str. Florida]
          Length = 301

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 136/284 (47%), Positives = 192/284 (67%), Gaps = 1/284 (0%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMY 63
            +  +  ++ LLKPR+M L ++TA  G+++APG I  L  ++S   +A+GAGA+GA NM+
Sbjct: 16  SLSSVGDYVQLLKPRIMCLVVFTAITGMLIAPGTIHPLIGLVSTVCVALGAGAAGAFNMW 75

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
           YD+DID +M RT  RPIP G+I   +AW  G+ LA  S+ +M +A+N+VSA LL  SIF 
Sbjct: 76  YDSDIDAIMDRTKGRPIPAGKICREQAWECGMVLATLSVFVMAIAVNYVSALLLAGSIFS 135

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           Y V+YT+ LKR TPQNIVIGGIAGA PP+IGWASV+G +S+ SL +F IIF+WTPPHFW+
Sbjct: 136 YAVVYTMLLKRRTPQNIVIGGIAGAFPPVIGWASVSGTLSLESLSLFAIIFVWTPPHFWA 195

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           +ALL  ++Y+KA++PMLP V   R T+ HIL+Y+++ ++VG  P +     V Y I+   
Sbjct: 196 IALLTLEEYKKANVPMLP-VYCIRKTRSHILLYSIILAVVGATPGLFVKHPVLYEILATG 254

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
           L   F  +A   F  K     +    LF  SI YLF+LF +++ 
Sbjct: 255 LSATFIAYAIAVFREKGQPSHKACMGLFKYSIYYLFLLFAVVIA 298


>gi|182639256|sp|Q1QHV7|COXX_NITHX RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 312

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 126/271 (46%), Positives = 176/271 (64%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +  LLKPRVMSL I+TA VG+++APGH+  +    +I  IA+GAGASGALNM  + D
Sbjct: 20  VADYFALLKPRVMSLVIFTALVGLMIAPGHVHPVLGFTAILCIAVGAGASGALNMALEGD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M+RTA+RPIP G+I+  EA   G++L+  S++ +G  +NW +  LL  +IF YVVI
Sbjct: 80  IDVLMSRTANRPIPRGRITRGEAMGFGLTLSFFSVMTLGALVNWYAGGLLAFTIFFYVVI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LKR T QNIVIGG AGA+PP++ WA+ TG +S+  L++FLIIF WTPPHFW+LAL 
Sbjct: 140 YTMGLKRRTAQNIVIGGAAGALPPVVAWAAATGSLSVEPLLLFLIIFFWTPPHFWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY +A +PMLP V     T++ IL+YT++   +   P  LG+    YG+    LG  
Sbjct: 200 RSDDYARAGVPMLPVVAGPDATRLQILLYTIVLVAIAAAPWPLGYFDWVYGVTSLVLGAG 259

Query: 248 FTLWAWRTFLCKEDKDIRVT-KKLFLESITY 277
             + A   +  +         ++LF  SI Y
Sbjct: 260 MLVLAINVYRHRTGSTALRATRRLFAFSILY 290


>gi|313679387|ref|YP_004057126.1| protoheme ix farnesyltransferase [Oceanithermus profundus DSM
           14977]
 gi|313152102|gb|ADR35953.1| protoheme IX farnesyltransferase [Oceanithermus profundus DSM
           14977]
          Length = 608

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 109/287 (37%), Positives = 164/287 (57%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +I L KPR++SL ++TA  G+ +A G        ++ +      AGA+ A+NM  D 
Sbjct: 325 VRHYIALTKPRIISLLLFTALAGLFIAAGGWPGWKLLLVVLLGGYASAGAANAINMVIDR 384

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP    +IS  +A      LA  + V++    N ++ATL    +  YV+
Sbjct: 385 DIDAKMERTRGRPTVQNRISSADALKFAFLLAAFAFVVLWWGANLLAATLSLAGLMHYVL 444

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR +  NIVIGG AGA PP++GWA+VTGD+++ +  +F I+F WTP HFW+LAL
Sbjct: 445 IYTLYLKRRSWSNIVIGGAAGAFPPLVGWAAVTGDLNLLAWYLFAIVFFWTPVHFWALAL 504

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           L KDDY +  +PMLP V+ DR T + I +Y VLT+++ ++P  LG     Y     FL  
Sbjct: 505 LIKDDYARVGVPMLPVVLGDRVTVIQIALYAVLTAVISIMPLTLGQMGWIYAASAGFLNL 564

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
                +   +L  +       ++LF  S++YL +LF  + VD  +  
Sbjct: 565 VLLAQSLMLYLHPQRP---QARRLFFYSMSYLALLFLAMAVDRSVHF 608


>gi|262273569|ref|ZP_06051383.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB
           [Grimontia hollisae CIP 101886]
 gi|262222547|gb|EEY73858.1| heme O synthase protoheme IX farnesyltransferase COX10-CtaB
           [Grimontia hollisae CIP 101886]
          Length = 305

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 106/283 (37%), Positives = 160/283 (56%), Gaps = 5/283 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+++ + TA VG+ LA P        ++ +  I M + A+   N   D 
Sbjct: 21  WRDYLELTKPKVVAMLLLTAMVGMCLAVPALPPARAVILGLLGIGMQSAAAAVFNHVIDQ 80

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID+ M RT  RP+  G++S  +A   G  L V+   ++ +  N + A L F S+  Y V
Sbjct: 81  RIDRKMQRTVHRPVARGRVSTSQALAFGAVLMVAGFSLLWVL-NMLVAWLTFASLVGYAV 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLK  TPQNIVIGG+AGA+PP++GW +VTG +   +L++ ++IF WTPPHFW+LA+
Sbjct: 140 VYTAWLKHATPQNIVIGGLAGAMPPLLGWVAVTGTLDSHALLLVMLIFTWTPPHFWALAI 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY KA +PMLP       TK  IL+YT+L  +VG+LP + G + + Y      L  
Sbjct: 200 HRRKDYAKAGVPMLPVTHGVDFTKTMILLYTLLLVVVGLLPWLAGMSGLVYLFGTMALNL 259

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
            F   AW+    K      +    F  S+ ++F LF +L+ DH
Sbjct: 260 GFVWHAWQL---KFHDRKGLAWDTFKYSVWHVFGLFVVLLADH 299


>gi|87198937|ref|YP_496194.1| protoheme IX farnesyltransferase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|123490301|sp|Q2G9W3|COXX_NOVAD RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|87134618|gb|ABD25360.1| protoheme IX farnesyltransferase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 304

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 129/285 (45%), Positives = 180/285 (63%), Gaps = 2/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  L KPRVM+L I+T   G++ APG I  + +  +I  IA+GAG + ALN +++AD
Sbjct: 13  WRDFFALTKPRVMTLVIFTGLCGLLAAPGTIHPVIAFTAILCIAVGAGGAAALNQWWEAD 72

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA RP+P G++    A   G +LA  S+ +MGL + W++A +L  SIF Y  I
Sbjct: 73  IDAGMKRTAQRPLPAGRMDRTSARDFGFALAGGSVFVMGLGVGWLAAVILAFSIFYYSWI 132

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLK  TPQNIVIGG AGA PPMIGW +VTGD+++  +++FLIIF+WTPPHFW+LAL 
Sbjct: 133 YTVWLKPRTPQNIVIGGGAGAFPPMIGWVAVTGDITLMPVLLFLIIFMWTPPHFWALALF 192

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K  IPM+P V  +R+T+  IL Y++L   + ++P  +G A   YG     LG  
Sbjct: 193 VQTDYAKVGIPMMPVVAGERSTRKQILAYSILLLPLTLVPWWIGGAGAVYGWSALVLGLV 252

Query: 248 FTLWAWR--TFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F   + +        +  +   K+LF  S+ YLFVLF +L+ D L
Sbjct: 253 FVALSVKVGLRRSVPNDGMLPEKRLFGYSVLYLFVLFGMLVGDRL 297


>gi|52840657|ref|YP_094456.1| protoheme IX farnesyltransferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148360971|ref|YP_001252178.1| protoheme IX farnesyltransferase [Legionella pneumophila str.
           Corby]
 gi|296105963|ref|YP_003617663.1| protoheme IX farnesyltransferase [Legionella pneumophila 2300/99
           Alcoy]
 gi|81378178|sp|Q5ZYG0|CYOE_LEGPH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639302|sp|A5IHI2|CYOE_LEGPC RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|52627768|gb|AAU26509.1| protoheme IX farnesyltransferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148282744|gb|ABQ56832.1| protoheme IX farnesyltransferase [Legionella pneumophila str.
           Corby]
 gi|295647864|gb|ADG23711.1| protoheme IX farnesyltransferase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 294

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 102/269 (37%), Positives = 159/269 (59%), Gaps = 4/269 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T  VG+ LA PG +S+     ++  I + AG++ A+N   D 
Sbjct: 13  WRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVSLRLIAFTLLGIGLCAGSAAAINHLVDR 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++S  +A    V + +  + ++ L +N ++A L F+++  Y  
Sbjct: 73  HIDSIMARTKKRPVAYGRVSVKQALWFAVIIGLMGLSLLILFVNQLTALLTFVTLIGYAG 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR T QNIVIGG+AGA PP++GW +VT  +   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 VYTGYLKRATSQNIVIGGLAGAAPPLLGWTAVTDQLDPQALLLVLIIFTWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               +YQ A IPMLP     + TK++I +YTVL  +V +LP ++  +   Y +    LG 
Sbjct: 193 YRYKEYQDAEIPMLPVTHGIQFTKLNIYLYTVLLLVVSLLPFVVSMSGWIYLLGALVLGI 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESI 275
            F +WA + +   +     V  + F  SI
Sbjct: 253 RFLVWAHKLYFTDK---PVVAMQTFRFSI 278


>gi|328470354|gb|EGF41265.1| protoheme IX farnesyltransferase [Vibrio parahaemolyticus 10329]
          Length = 302

 Score =  146 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 170/286 (59%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + ++ L KP+V++L + TA VG+ LAP      +++ I +  I + AG++ A N   D  
Sbjct: 17  STYLKLTKPKVVALMLVTAIVGMSLAPVTDFPWIQASIGLMGIGLMAGSAAAFNHLIDRR 76

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MART +RP+P G  +P    +  V++ V   V++   +N ++A + F+S+  Y V+
Sbjct: 77  IDARMARTHTRPLPSGDTNPLSVAIFAVAIGVVGFVLLYAWVNALTAWMTFLSLLGYAVV 136

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT++LKR TPQNIVI GIAGA+PP++GW +VTG++   + ++ +IIF+WTPPHFW+LA+ 
Sbjct: 137 YTMYLKRATPQNIVIAGIAGAMPPLLGWTAVTGELHGNAWLLVMIIFIWTPPHFWALAIH 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             +DY+K  IPMLP       TK  IL+YTVL ++V V+P ++G     Y      L   
Sbjct: 197 RVEDYRKVDIPMLPVTHGIEYTKTSILLYTVLLTLVCVMPVLVGMVGFIYLFSALLLNAG 256

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F   AW+    K   +     + F  SI +L  LF  L+ DH I M
Sbjct: 257 FIYHAWKL---KFAPEPNSAIETFKFSIYHLLALFVALLADHYIGM 299


>gi|242008668|ref|XP_002425124.1| protoheme IX farnesyltransferase, putative [Pediculus humanus
           corporis]
 gi|212508798|gb|EEB12386.1| protoheme IX farnesyltransferase, putative [Pediculus humanus
           corporis]
          Length = 434

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 71/264 (26%), Positives = 130/264 (49%), Gaps = 5/264 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           ++ L K R+ SL + T+ +G  +APG   +   +       + + A+ ++N + +   D 
Sbjct: 102 YLKLSKFRLTSLVVMTSMMGYAMAPGAFELTSFLSCALGTGLVSSAANSINQFLEVPFDA 161

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
            M+RT +R +  G ++P  A           +VI+ +  N ++A L   ++F Y  IYT 
Sbjct: 162 QMSRTRNRVLVQGYLTPLHAVGFATVTGSLGLVILYVGANPLTALLGASNLFLYTSIYTP 221

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR +  N  +G I GAIPP++GWA+  G +   SL++  I++ W  PHF +L+   + 
Sbjct: 222 -LKRISIGNTWVGSIVGAIPPLMGWAASHGRLDAGSLILGGILYAWQFPHFNALSWNLRP 280

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +A   M+     D   +   L YT+  + +  L  +      T+G++   +  +F  
Sbjct: 281 DYSRAGYRMMAVTNPD-LCRKTALRYTIGITAISSLAPLFSVTHWTFGVLSLPINLYFVY 339

Query: 251 WAWRTFLCKEDKDIRVTKKLFLES 274
             ++ F    + D + ++KLF  S
Sbjct: 340 LGYKFFK---ESDSKNSRKLFRFS 360


>gi|29654311|ref|NP_820003.1| protoheme IX farnesyltransferase [Coxiella burnetii RSA 493]
 gi|153206712|ref|ZP_01945553.1| protoheme IX farnesyltransferase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154706522|ref|YP_001424424.1| protoheme IX farnesyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|161831268|ref|YP_001596720.1| protoheme IX farnesyltransferase [Coxiella burnetii RSA 331]
 gi|165918598|ref|ZP_02218684.1| protoheme IX farnesyltransferase [Coxiella burnetii RSA 334]
 gi|212212572|ref|YP_002303508.1| protoheme IX farnesyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212218443|ref|YP_002305230.1| protoheme IX farnesyltransferase [Coxiella burnetii CbuK_Q154]
 gi|81629045|sp|Q83CV6|CYOE_COXBU RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|205716365|sp|A9KCC9|CYOE_COXBN RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|205716370|sp|A9NCT0|CYOE_COXBR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|226696344|sp|B6J736|CYOE_COXB1 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|226696345|sp|B6J085|CYOE_COXB2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|29541578|gb|AAO90517.1| protoheme IX farnesyltransferase [Coxiella burnetii RSA 493]
 gi|120577075|gb|EAX33699.1| protoheme IX farnesyltransferase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154355808|gb|ABS77270.1| protoheme IX farnesyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|161763135|gb|ABX78777.1| protoheme IX farnesyltransferase [Coxiella burnetii RSA 331]
 gi|165917726|gb|EDR36330.1| protoheme IX farnesyltransferase [Coxiella burnetii RSA 334]
 gi|212010982|gb|ACJ18363.1| protoheme IX farnesyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212012705|gb|ACJ20085.1| protoheme IX farnesyltransferase [Coxiella burnetii CbuK_Q154]
          Length = 305

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 116/287 (40%), Positives = 172/287 (59%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KPRV+ L + TA VG+ LA PG +S    +     IA+ A ++ A+N   + 
Sbjct: 17  WRDYFQLCKPRVVLLMLLTAIVGMCLASPGIVSWRVFLFGNLGIALAASSAAAINHLLEH 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            +DK+M RT  RPI  G+I+   A +    L + S++I+   +N ++A L F+++  Y  
Sbjct: 77  HLDKLMRRTYRRPIVQGKINRKNAAIFAAILCILSMIILIAFVNLLTALLTFITLIGYAG 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
            YT++LK  TPQNIVIGG+AGA PP++GW +VTG +   +L++ LIIFLWTPPHFW+LA+
Sbjct: 137 FYTLYLKHATPQNIVIGGLAGAAPPLLGWVAVTGHIDPPALILLLIIFLWTPPHFWALAI 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              DDY KA+IPMLPN      TK++IL+YT+L + +  LP ++  +   Y   V  L  
Sbjct: 197 HRIDDYAKANIPMLPNTHGIIYTKINILLYTLLLTAISFLPFVIMTSGWIYFSSVCLLNL 256

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F  WA R    +  +   +  + F  SI YL +LFT L+VDH + +
Sbjct: 257 GFLYWAIRLLTSQRKE---IPMRTFQYSIWYLMLLFTALLVDHYVYL 300


>gi|307609221|emb|CBW98685.1| hypothetical protein LPW_04941 [Legionella pneumophila 130b]
          Length = 294

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 102/269 (37%), Positives = 159/269 (59%), Gaps = 4/269 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+ L + T  VG+ LA PG +S+     ++  I + AG++ A+N   D 
Sbjct: 13  WRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVSLRLIAFTLLGIGLCAGSAAAINHLVDR 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +MART  RP+  G++S  +A    V + +  + ++ L +N ++A L F+++  Y  
Sbjct: 73  HIDSIMARTKKRPVAYGRVSVKQALWFAVIIGLMGLSLLILFVNQLTALLTFVTLIGYAG 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR T QNIVIGG+AGA PP++GW +VT  +   +L++ LIIF WTPPHFW+LA+
Sbjct: 133 VYTGYLKRATSQNIVIGGLAGAAPPLLGWTAVTDQLDPQALLLVLIIFTWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               +YQ A IPMLP     + TK++I +YTVL  +V +LP ++  +   Y +    LG 
Sbjct: 193 YRYKEYQDAEIPMLPVTHGIQFTKLNIYLYTVLLLVVSLLPFVVSMSGWIYLLGALVLGI 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESI 275
            F +WA + +   +     V  + F  SI
Sbjct: 253 RFLVWAHKLYFTDK---PVVAMQTFRFSI 278


>gi|68482909|ref|XP_714585.1| hypothetical protein CaO19.3167 [Candida albicans SC5314]
 gi|46436166|gb|EAK95533.1| hypothetical protein CaO19.3167 [Candida albicans SC5314]
          Length = 461

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 69/309 (22%), Positives = 124/309 (40%), Gaps = 20/309 (6%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ L KP +  L   ++     ++P  +S+ + +      A+ +GA+ A+NM  + + D
Sbjct: 146 AYVKLSKPNLTVLVTLSSICSYAISPLSVSLQELMFLTVGTALCSGAANAINMGREPEFD 205

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           K M RT  RP+  G I+P +A+            ++   +N   + L F +I  Y  +YT
Sbjct: 206 KQMPRTVGRPVVRGLITPTQAYRFAAVSGAIGCGMLWFGVNPTVSLLGFSNIVLYAWLYT 265

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
             +KR +  N  +G + GAIPP++GWA+ +     A+  +  +++ W  PHF +L+    
Sbjct: 266 S-MKRKSIINTWVGAVVGAIPPLMGWAASSSLAHPAAWCLAGLLYAWQFPHFNALSHGIA 324

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
             Y+ A   M       R      L Y+VL   +    +  G     +           T
Sbjct: 325 QQYKSAGYVMTA-AENPRLNARVALRYSVLMFPLCFGLSYFGVTDWVFPFDSAIANGWLT 383

Query: 250 LWAWRTFLCKEDKDIR--------------VTKKLFLESITYLFVLFTILMVDHLIDMKT 295
             A+  +  +E                     KKLF  S+ +L  +  + M+      K 
Sbjct: 384 YLAYVFWQQQEKNYKNGAKPTSEGLALAGVHAKKLFWCSVWHLPAVLILAMLHK----KD 439

Query: 296 VERYFFSSF 304
                F   
Sbjct: 440 QWNRLFEHI 448


>gi|300781143|ref|ZP_07090997.1| protoheme IX farnesyltransferase [Corynebacterium genitalium ATCC
           33030]
 gi|300532850|gb|EFK53911.1| protoheme IX farnesyltransferase [Corynebacterium genitalium ATCC
           33030]
          Length = 306

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 167/306 (54%), Gaps = 11/306 (3%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNM 62
            +  +  +  L KPRV+ L +  A   ++ A  G +  L  + ++F   MGAGA+   NM
Sbjct: 1   MLETIKAYFALTKPRVIELLLVAAIPAMLQADRGEVHALLILATLFGGWMGAGAANTFNM 60

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMG-LAINWVSATLLFMSI 121
             D DID+ M RT +RP+    ++   A V   +L + S++ +G +  +W++A  + ++ 
Sbjct: 61  VADYDIDQKMGRTRARPLVRHTVTKERARVFAWALLILSVLWLGLVCRSWLAAFFIILTN 120

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASV-------TGDVSIASLVMFLIIF 174
           + Y+ +YT WLKR T QN++ GG AG +P M+GWA +       + D    ++V+FLIIF
Sbjct: 121 WFYIFVYTKWLKRKTWQNVIWGGAAGCMPVMVGWAVIRDNVFDGSPDRWWQAVVLFLIIF 180

Query: 175 LWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFAS 234
            WTPPH W+LA+  KDDY +A++PMLP V +   T   ILIY+ LT ++ +   ++   S
Sbjct: 181 FWTPPHTWALAMKYKDDYARANVPMLPVVASPEETTKQILIYSWLTVLISLA--LVPATS 238

Query: 235 VTYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
             Y  +    G  F L A R     +  +     KLF+ S  YL VLF  L VD ++ + 
Sbjct: 239 WIYLAVAVLSGAAFLLMATRLHNAIKRGEDVKPLKLFILSNNYLAVLFLGLSVDAILGLP 298

Query: 295 TVERYF 300
           T+   F
Sbjct: 299 TIAELF 304


>gi|318056370|ref|ZP_07975093.1| protoheme IX farnesyltransferase [Streptomyces sp. SA3_actG]
 gi|318075128|ref|ZP_07982460.1| protoheme IX farnesyltransferase [Streptomyces sp. SA3_actF]
          Length = 285

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 167/284 (58%), Gaps = 4/284 (1%)

Query: 12  IVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           + L KPR++ L + T    + LA  G   +    ++ F   + AG + ALNM+YD DID 
Sbjct: 1   MALTKPRIIELLLITTVPVMFLAEQGVPDLWLVFVTCFGGYLSAGGANALNMWYDRDIDA 60

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
           +M RT+ RP+  G ISP E  V G+ LAV S +  GL +NW+SA L   +I  YVV YT+
Sbjct: 61  LMDRTSQRPLVTGLISPREGLVFGLGLAVVSTLWFGLLVNWLSAALSLGAILLYVVGYTM 120

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR T QNIV GG+AG +P +IGW++VT  VS A++++FL+IF WTPPH+W L++  KD
Sbjct: 121 ILKRRTAQNIVWGGVAGCMPVLIGWSAVTNSVSWAAVILFLVIFFWTPPHYWPLSMRVKD 180

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY + ++PMLP +  ++     I++Y+ +   V +L T+LG+    Y ++    G ++  
Sbjct: 181 DYARVNVPMLPVIAGNKVVARQIVLYSWVMVAVSLLLTVLGYTGWFYTVVALLSGGYWLW 240

Query: 251 WAWRTFLCKEDK---DIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A       + +         +LF  SITY+ +LF  + +D  +
Sbjct: 241 EAHGLLHRAKGEITGAKLKEMRLFHWSITYVSILFVAVAIDPFL 284


>gi|182439382|ref|YP_001827101.1| protoheme IX farnesyltransferase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178467898|dbj|BAG22418.1| putative protoheme IX farnesyltransferase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 285

 Score =  145 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 108/284 (38%), Positives = 162/284 (57%), Gaps = 4/284 (1%)

Query: 12  IVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           + L KPR++ L + T    + LA  G   +   + +     + AG + ALNMY D DID 
Sbjct: 1   MALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLTTTIGGYLSAGGANALNMYIDRDIDA 60

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
           +M RT+ RP+  G ++P E    G++LAV S V  GL +NW+SA L   ++  YVV+YT+
Sbjct: 61  LMDRTSQRPLVTGMVTPRECLAFGIALAVISTVWFGLLVNWLSAALALGALLFYVVVYTM 120

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR T QNIV GGIAG +P +IGW++VT ++S A++++F +IF WTPPH+W L++  KD
Sbjct: 121 LLKRRTSQNIVWGGIAGCMPVLIGWSAVTNELSWAAVILFAVIFFWTPPHYWPLSMKVKD 180

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +  +PMLP V T+R     I++Y+ +   V +L T LG+    Y  +    G  +  
Sbjct: 181 DYARVGVPMLPVVATNRVVAKQIVLYSWVMVAVSLLLTPLGYTGWFYTAVALLSGGAWLW 240

Query: 251 WAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 241 EAHGLQNRAKAGVTGAKLKEMRLFHWSITYVSLLFLAVAVDPFL 284


>gi|218440608|ref|YP_002378937.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 7424]
 gi|226709215|sp|B7KHX2|COXX_CYAP7 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|218173336|gb|ACK72069.1| protoheme IX farnesyltransferase [Cyanothece sp. PCC 7424]
          Length = 323

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 168/285 (58%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G +  +  ++++    + A ++  LN  YD 
Sbjct: 17  IKSYYQLTKPRIIPLLLITTAAAMWIASNGQVDPVLLLVTLLGGTLAAASAQTLNCIYDQ 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++ P  A +  + LAV S  +  + +N  SA L    I  Y++
Sbjct: 77  DIDYAMLRTRARPIPSGRVRPLHALIFAIILAVLSFTLFVVFVNMASALLAMSGIAFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT  LKR +PQNIVIGG AG+IPP++GWA+VTGD+S A+  +F IIFLWTPPHFW+LAL
Sbjct: 137 IYTHMLKRHSPQNIVIGGAAGSIPPLVGWAAVTGDLSWAAWALFAIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIV-GVLPTMLGFASVTYGIIVFFLG 245
           + KDDY + ++PM+P V  + +T   I IYT++      +L   L  + + Y ++   LG
Sbjct: 197 MIKDDYAQVNVPMMPVVEGEESTVEQIWIYTLIVVPFTFILVYPLAASGIVYTLVALVLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F    W+      DKD  + + LF  SI Y+ +L T ++VD L
Sbjct: 257 GMFIYKTWQLKQNPLDKD--LARSLFKYSILYMMLLCTGMVVDSL 299


>gi|319764147|ref|YP_004128084.1| protoheme ix farnesyltransferase [Alicycliphilus denitrificans BC]
 gi|330826496|ref|YP_004389799.1| protoheme IX farnesyltransferase [Alicycliphilus denitrificans
           K601]
 gi|317118708|gb|ADV01197.1| protoheme IX farnesyltransferase [Alicycliphilus denitrificans BC]
 gi|329311868|gb|AEB86283.1| protoheme IX farnesyltransferase [Alicycliphilus denitrificans
           K601]
          Length = 308

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 104/290 (35%), Positives = 166/290 (57%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS----VLKSVISIFAIAMGAGASGALN 61
            R++ F  L KPRV+ L ++ AF+G+VLA   +       +  ++   I + AGA+ A N
Sbjct: 21  SRVSQFYALTKPRVVQLIVFCAFIGMVLAVPGLPSGAQWWQMAVASAGIWLVAGAAAAFN 80

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +  +    L  +   ++   +N ++  L F + 
Sbjct: 81  CLVERGIDARMKRTAWRPTARGELSNAQTLLFSALLCAAGSALLYFWVNPLTMWLTFATF 140

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GW+++T  V   +L++FLIIFLWTPPHF
Sbjct: 141 VGYAVIYTVILKPLTPQNIVIGGASGAMPPVLGWSAMTDSVGPEALILFLIIFLWTPPHF 200

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY+K+ +PMLP    +  T++ + +YT++     ++P + G +S  Y    
Sbjct: 201 WALALYRVEDYRKSGLPMLPVTHGNEYTRLQVFLYTLILFAGCLMPFIYGMSSWIYLAAA 260

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             LG  F L+ +  +    D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 261 VLLGAGFCLYGFWLWRGYSD---ALARKTFRFSLIHLSLLFAALLVDHYV 307


>gi|300711673|ref|YP_003737487.1| heme synthase [Halalkalicoccus jeotgali B3]
 gi|299125356|gb|ADJ15695.1| heme synthase [Halalkalicoccus jeotgali B3]
          Length = 488

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 94/285 (32%), Positives = 143/285 (50%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLA-IYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  +  L+KPR+M L  +  A    + A  ++ V+  V ++    +  GASG  N   + 
Sbjct: 206 LGAYYSLMKPRLMWLLCLVAAAAMTLAAGPNLPVVTIVATLLGGVLAIGASGTFNHVLER 265

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           D+D+ M RTA RP+    +    A   G  L ++S+    + +N ++A L   +I  Y V
Sbjct: 266 DVDQRMKRTADRPLATEIVPVSHALAFGALLGLASLGTFYVFVNALAALLGLTAIVFYSV 325

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT+ LK  T QN VIGG AGA+P +IGWA+ TG++ + +LV+  +IF WTP HF++LAL
Sbjct: 326 IYTLVLKPNTVQNTVIGGAAGALPALIGWAAATGEIGLPALVLAGVIFCWTPAHFYNLAL 385

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             KDDY +   PM+P V  +R T+ HI+ Y   T I   L   +      +       G 
Sbjct: 386 AYKDDYARGGFPMMPVVRGERLTRKHIVYYLGATLIAASLLAAVDTLGWLFAATSVVFGA 445

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F            ++      + F  S  YL  L   ++VD L+
Sbjct: 446 IFLREVMALH---REQTREAAMRSFHASNAYLGALLFAIIVDALV 487


>gi|299534104|ref|ZP_07047456.1| protoheme IX farnesyltransferase [Comamonas testosteroni S44]
 gi|298718013|gb|EFI59018.1| protoheme IX farnesyltransferase [Comamonas testosteroni S44]
          Length = 307

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 108/290 (37%), Positives = 165/290 (56%), Gaps = 7/290 (2%)

Query: 6   FRLNFFIVLLKPRVMSLAIYTAFVGIVLA----PGHISVLKSVISIFAIAMGAGASGALN 61
            R   +  L KP+V+ L ++ AF+G+VLA    PG     + + +   I + A A+ A N
Sbjct: 20  SRWVQYYALTKPKVVQLIVFCAFIGMVLAVPGVPGWQDWGRMLAACAGIWLVAAAAAAFN 79

Query: 62  MYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSI 121
              +  ID  M RTA RP   G++S  +A +    L  +   I+ LA+N ++  L   + 
Sbjct: 80  CLVERSIDARMKRTAWRPTARGELSHSQALLFSALLCAAGSAILLLAVNALTLWLTLATF 139

Query: 122 FCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHF 181
             Y VIYT+ LK  TPQNIVIGG +GA+PP++GWA++TG V   +L++FLIIFLWTPPHF
Sbjct: 140 IGYAVIYTLVLKPLTPQNIVIGGASGAMPPVLGWAAMTGQVGHEALLLFLIIFLWTPPHF 199

Query: 182 WSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIV 241
           W+LAL   +DY++A +PMLP    +  T++ + +YT++     +LP ++G +   Y    
Sbjct: 200 WALALYRVEDYRRAGLPMLPVTHGNAFTRLQVFLYTLVLFAGCLLPFVVGMSGYLYLFAA 259

Query: 242 FFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             LG  F  + W       D    + +K F  S+ +L +LF  L+VDH +
Sbjct: 260 VILGLGFCGYGWALLRNYSD---ALARKTFRFSLIHLSLLFAALLVDHYL 306


>gi|56751519|ref|YP_172220.1| protoheme IX farnesyltransferase [Synechococcus elongatus PCC 6301]
 gi|81561928|sp|Q5N1X0|COXX_SYNP6 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639234|sp|Q31JY9|COXX_SYNE7 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|56686478|dbj|BAD79700.1| cytochrome c oxidase folding protein [Synechococcus elongatus PCC
           6301]
          Length = 318

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 111/296 (37%), Positives = 163/296 (55%), Gaps = 4/296 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGI-VLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +L  +  L KPR++ L + T   G+ + A G +    ++ ++    + A A+  LN  YD
Sbjct: 19  QLLAYWQLTKPRIILLLLITTAAGMGLAAQGPLDPRLAIATLIGGGLAAAAANTLNCLYD 78

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M RT  RP+P G+I P+EAW   +SLA  S +++    N ++A L    I  YV
Sbjct: 79  RDIDAIMERTRWRPLPSGRIQPFEAWAFALSLAALSFILLDWQANQLAAGLALAGIVFYV 138

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT  LKR + QNIVIGG AGAIPP++GWA+VTG+++  + ++F I+ LWTPPHFW+LA
Sbjct: 139 VIYTHGLKRHSSQNIVIGGAAGAIPPLVGWAAVTGELAWPAWILFAIVCLWTPPHFWALA 198

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYT-VLTSIVGVLPTMLGFASVTYGIIVFFL 244
           L+ +DDY    +PMLP VV +  T   IL Y  +L      L   LG A   Y      L
Sbjct: 199 LMIRDDYAAVKVPMLPVVVGNAATAQQILAYAGLLLPTTLALAWPLGAAGPFYSATALLL 258

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
           G      + +   C+      + + LF  SI YL +L   + +D L    ++ +  
Sbjct: 259 GLELLRRSRQL--CQAPDSRPLARSLFKFSIFYLMLLCGAIAMDCLPGAPSLSQAI 312


>gi|195387463|ref|XP_002052415.1| GJ17536 [Drosophila virilis]
 gi|194148872|gb|EDW64570.1| GJ17536 [Drosophila virilis]
          Length = 333

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 73/282 (25%), Positives = 132/282 (46%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
            + +  L K R+ SL + T   G  +AP    +    +      + + A+ A+N Y++  
Sbjct: 12  FSKYKKLSKFRLTSLVVITTMGGYAMAPAAFDLTTFAMCTLGTGLVSAAANAINQYHEVP 71

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQI+P +A    V  A S + ++   +N ++A L   ++F Y  I
Sbjct: 72  FDSQMSRTKNRVLVTGQITPLKAVGFAVVSATSGLCLLYFGVNGLTAALGAGNLFLYTSI 131

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  IG I GAIPP++GWA  TG +   ++++  I++ W  PHF +L+  
Sbjct: 132 YTP-MKRMSIANTWIGSIVGAIPPLMGWAGCTGTLDAGAMILAGILYAWQFPHFNALSWN 190

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L Y      + ++  +    +  + +    L  +
Sbjct: 191 LRPDYSRAGYRMMAVTNPG-LCRRTALRYAFAICGLSMVAPLADVTNYWFALETLPLNAY 249

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           F   A+     K   D   ++KLF  S+ +L  L  + + + 
Sbjct: 250 FCYLAYEF---KSKSDSGSSRKLFRFSLIHLPALMLLFLANK 288


>gi|262193826|ref|YP_003265035.1| protoheme IX farnesyltransferase [Haliangium ochraceum DSM 14365]
 gi|262077173|gb|ACY13142.1| protoheme IX farnesyltransferase [Haliangium ochraceum DSM 14365]
          Length = 298

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 93/281 (33%), Positives = 154/281 (54%), Gaps = 3/281 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L   + L+KP +M +A+ TA  G+ LAPG    +  +  +   A+  GA+  LNMY + D
Sbjct: 18  LADAVALMKPNIMLMALLTAAGGMSLAPGAARPVTWLALMLGTALIVGAANTLNMYLERD 77

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           +D +MART +RP+P G+++P  A V+GV  A  +  I+  AIN ++  L  +++ CYV++
Sbjct: 78  LDCLMARTKNRPLPAGRMAPNFALVVGVIQAFIAAPILTFAINPLTGLLGVIALICYVMM 137

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  LK+ T    +IG + GA+P ++GW ++TG + +  L +F ++FLW  PHF ++A+ 
Sbjct: 138 YTP-LKQRTTLATLIGSVPGAMPALMGWTAITGGIDVRGLAVFGVLFLWQMPHFHAIAMF 196

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A +  +P  + +   +  I IY V    + ++   LG   V Y I+    G  
Sbjct: 197 RRKDYDRAGLKTVPGELGESAARWRIAIYLVAQVALSLVLYPLGVTGVVYLIVAILSGAA 256

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
                +           R  ++LF  SI YL VLFT ++ D
Sbjct: 257 --YLGYGLLGLATRGGPRWARRLFFASILYLPVLFTAMVFD 295


>gi|239947522|ref|ZP_04699275.1| protoheme IX farnesyltransferase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921798|gb|EER21822.1| protoheme IX farnesyltransferase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 305

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 119/274 (43%), Positives = 178/274 (64%), Gaps = 2/274 (0%)

Query: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGAL 60
           + +    +  +I+L+KPRVMSL I+T FVG+ LAP  +    + I++  IA+GAG++GA+
Sbjct: 13  INYSQSTVKDYILLMKPRVMSLVIFTGFVGMWLAPYSVHPFIAGIAVVCIALGAGSAGAI 72

Query: 61  NMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMS 120
           NM+YD DID +M RT  RPI  G + P EA   G+     ++  M L +N +++ LL  +
Sbjct: 73  NMWYDRDIDSLMKRTQKRPIVRGAVEPDEALSFGLITGFFAVFFMALCVNLLASFLLLFT 132

Query: 121 IFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPH 180
           IF Y+ IYTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH
Sbjct: 133 IFYYICIYTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPH 192

Query: 181 FWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGII 240
            W+LAL C +DY+   +PM+P V  +  TK  ILIY++L  IV ++P  +G  +  Y II
Sbjct: 193 SWALALFCNEDYKNCKVPMMPAVKGNLYTKKQILIYSILLFIVSLMPFFIGMNNFIYLII 252

Query: 241 VFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLES 274
              LG  F  ++   F   +  D +  K+ F  S
Sbjct: 253 SGILGLVFLYYSGSLF--YDTPDNKQAKRFFAYS 284


>gi|254456500|ref|ZP_05069929.1| protoheme IX farnesyltransferase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083502|gb|EDZ60928.1| protoheme IX farnesyltransferase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 303

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 123/288 (42%), Positives = 188/288 (65%), Gaps = 1/288 (0%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYY 64
           VF  +    L+KPRVMSL I+T  VG+++AP  +    ++I I  +++GAGA+GALNM+Y
Sbjct: 16  VFNFSELFKLMKPRVMSLVIFTCAVGLLMAPNIVPTKDAIIGIILVSIGAGAAGALNMWY 75

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           ++D+D +M RT  RPIP G+++  +A V G++L++ S++ +    N +SA+LL  +I  Y
Sbjct: 76  ESDLDALMTRTCLRPIPTGKVNRNQALVFGITLSIFSVIALDFFANRISASLLLSTILFY 135

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
           V +YTIWLKR TPQNIVIGG AGA+PP+IGW   T  +S+  +  FLIIF WTP HFW+L
Sbjct: 136 VFVYTIWLKRKTPQNIVIGGAAGALPPVIGWTIATNSLSLEPITFFLIIFFWTPSHFWAL 195

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           +L    DY+KA IPMLP      +TK++ILIY+++   V +LP  +GF S+ + I    L
Sbjct: 196 SLYKSSDYKKAKIPMLPITNGIESTKLNILIYSIIMLPVIILPYAIGFVSLIFLIPSLIL 255

Query: 245 GYHFTLWAWRTFL-CKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             ++    +  +   K   + +  K +F  SI YLF++F + ++D ++
Sbjct: 256 TLYYNFLCFELYNYKKNKFNAKKAKSIFGYSILYLFLIFVLFLIDKIL 303


>gi|284929095|ref|YP_003421617.1| protoheme IX farnesyltransferase [cyanobacterium UCYN-A]
 gi|284809554|gb|ADB95259.1| protoheme IX farnesyltransferase [cyanobacterium UCYN-A]
          Length = 322

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 107/285 (37%), Positives = 155/285 (54%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +  L KPR++ L + T    + +A  G ++  K  I++      A ++  +N  YD 
Sbjct: 17  IKSYYQLTKPRIIPLLLITTAASMWIASNGEVNSFKLFITLLGGTFAAASAQVMNCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT +RPIP G++    A +    L   S  +    IN +S  L    I  Y++
Sbjct: 77  DIDYEMLRTRTRPIPSGRVRSRHALIFAFILGFLSFSLFVAYINLLSGLLAMSGIVFYML 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT +LKR + QNIVIGG AG+IPP++GWA+VTGD+S A  ++F IIFLWTPPHFW+LAL
Sbjct: 137 VYTHFLKRNSSQNIVIGGAAGSIPPLVGWAAVTGDLSWAPWILFTIIFLWTPPHFWALAL 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFA-SVTYGIIVFFLG 245
           + KDDY +  +PM+P V  + +T   I +YT+L      L           YG+    LG
Sbjct: 197 MLKDDYAQVDVPMMPVVEGEESTVHQIWLYTLLVIPCTFLLIYSTETLGFLYGMSALILG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             F    W   L +   D  + + LF  SI YL +L   ++VD L
Sbjct: 257 VMFAQKTW--LLKQNPLDKSLARSLFKFSILYLMLLCAAMVVDSL 299


>gi|284043369|ref|YP_003393709.1| protoheme IX farnesyltransferase [Conexibacter woesei DSM 14684]
 gi|283947590|gb|ADB50334.1| protoheme IX farnesyltransferase [Conexibacter woesei DSM 14684]
          Length = 302

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 114/281 (40%), Positives = 162/281 (57%), Gaps = 4/281 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I L KPRV  L + T    + +A G  S+   ++++    + AG +GA+N +YD D
Sbjct: 23  VADYITLTKPRVQLLLLLTTVATMEIA-GSPSIGLILLTLLGGYLSAGGAGAVNHWYDRD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  MARTA+RPIP G++SP  A + G  L ++S  ++ L +N ++AT        YV +
Sbjct: 82  IDARMARTANRPIPSGRVSPRAALIYGFGLQIASFALLSLTVNLLAATFALAGFLGYVFV 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR TPQNIVIGG AGA+PP++GW + TG    A+L +F I+F WTPPHFW+L+L 
Sbjct: 142 YTMWLKRSTPQNIVIGGAAGAVPPLVGWVATTGSFDPAALYLFAIVFYWTPPHFWALSLR 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            KD+Y    +PMLP V  +  T+  I +YT L   V  LP         Y +    LG  
Sbjct: 202 MKDEYAAVGVPMLPVVRGEDETRRQITLYTFLLVAVTFLPFAGQLFDGIYAVSAAVLGGW 261

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
           F   A R    +   D     KL+L S+ YL +LF  ++VD
Sbjct: 262 FLWSAIRL---QRHPDRGAALKLYLFSMLYLALLFAAMVVD 299


>gi|55376982|ref|YP_134832.1| heme synthase [Haloarcula marismortui ATCC 43049]
 gi|74520693|sp|Q5V5S6|COXX_HALMA RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|55229707|gb|AAV45126.1| heme synthase [Haloarcula marismortui ATCC 43049]
          Length = 463

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 97/283 (34%), Positives = 145/283 (51%), Gaps = 5/283 (1%)

Query: 9   NFFIVLLKPRVMSLA-IYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           + +  L+KPR+M L  +  A    + A   ++V   ++++    +  GASG  N   + D
Sbjct: 183 SAYFRLMKPRLMWLLCLVAAAGMALAAGQTLTVRTVLLTLGGGVLSIGASGTFNHVLERD 242

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           IDK M RT+ RPI   QI    A   G+ L+ +S+  +   +N + A L   +I  Y VI
Sbjct: 243 IDKRMDRTSDRPIATHQIPVRNALAFGLLLSFASL-WLFWQVNALVAVLGLTAIVFYSVI 301

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+ LK  T QN V+GG AGA+P +IGW +  G V +  +V+ +IIFLWTP HF++LAL 
Sbjct: 302 YTLVLKPNTVQNTVLGGAAGALPALIGWVAADGSVGLPGVVLAVIIFLWTPAHFYNLALA 361

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            KDDY+    PM+P V  +  T+ HI+ Y   T I   +  +L      Y +    LG  
Sbjct: 362 YKDDYEAGGFPMMPVVRGETETRKHIVYYLGATLIASGILGVLTPLGWLYAVTSVLLGAV 421

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F    W   L   ++      + F  S  YL  +   ++VD L
Sbjct: 422 FL---WAVVLLHREQTEAAAFRAFHASNAYLGAVLIAIVVDAL 461


>gi|269468839|gb|EEZ80440.1| protoheme IX farnesyltransferase [uncultured SUP05 cluster
           bacterium]
          Length = 293

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 106/287 (36%), Positives = 162/287 (56%), Gaps = 6/287 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYY 64
               + L K +V+SL + TA VG++LA   P        + +   I M + ++   N   
Sbjct: 4   FIDLLGLCKLKVVSLILLTAVVGMLLAVPAPYLPDGWLVISASIGIGMASASAAVFNHIV 63

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D  ID  M+RT  RP+P G++S  +A V GV L V  +  + L +N ++  L F S+  Y
Sbjct: 64  DEQIDIQMSRTDQRPLPQGKVSRNQALVWGVFLGVVGLGTLQLFVNTITMLLTFASLIGY 123

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFL-WTPPHFWS 183
            V+YT++LKR TPQNIVIGG AGA PP++GW +++G   I    +  +I   WTPPHFW+
Sbjct: 124 AVVYTMYLKRATPQNIVIGGAAGAAPPVLGWTAISGTQGIEHAFLLFLIVFIWTPPHFWA 183

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           LA+   ++Y+K  +PMLP       T++ IL+YTVL  +V +LP + G + + Y      
Sbjct: 184 LAIHRVEEYKKVDVPMLPVTHGLAYTRVQILLYTVLLLLVTLLPYLSGMSGLIYLASAVV 243

Query: 244 LGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           LG  F ++A + +  K   D ++    F+ S+ YL +LF  L+VDH 
Sbjct: 244 LGLIFLMYAVKIY--KNPDDNKIAWTTFMYSVNYLMLLFIALLVDHY 288


>gi|255732205|ref|XP_002551026.1| protoheme IX farnesyltransferase, mitochondrial precursor [Candida
           tropicalis MYA-3404]
 gi|240131312|gb|EER30872.1| protoheme IX farnesyltransferase, mitochondrial precursor [Candida
           tropicalis MYA-3404]
          Length = 446

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 67/307 (21%), Positives = 124/307 (40%), Gaps = 16/307 (5%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              ++ L KP +  L   ++     ++P  +S+ + +      A+ +GA+ A+NM  + +
Sbjct: 130 FTAYLKLTKPNLTVLVTLSSICSYAISPLSVSLHELLFLTVGTALCSGAANAINMGREPE 189

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            DK M RT  RP+  G I+P +A+            ++   +N   + L F +I  Y  I
Sbjct: 190 FDKQMPRTVGRPVVRGLITPNQAYNFAALSGSIGCTMLWFGVNPTVSMLGFANIVLYAWI 249

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G + GAIPP++GWA+ +      +  +  +++ W  PHF +L+  
Sbjct: 250 YTS-MKRKSILNTWVGAVVGAIPPLMGWAASSSLSHPGAWCLAGLLYAWQFPHFNALSHG 308

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             + Y+ A   M       R      L Y++L   +    +  G     + I        
Sbjct: 309 IAEQYKSAGYVMTA-AENPRLNARVALRYSILMFPLCFGLSYFGVTDWVFPIDSGIANGW 367

Query: 248 FTLWAWRTFLCKEDKDIR--------------VTKKLFLESITYLFVLFTILMVDHLIDM 293
               A+  +  +E                     KKLF  S+ +L  +  + M+      
Sbjct: 368 LAYLAYVFWKQQERNYKNGAKPTAEGLALAGIQAKKLFWCSVWHLPAVLILAMLHKKDQW 427

Query: 294 KTVERYF 300
             +  Y 
Sbjct: 428 NRLFEYI 434


>gi|74152624|dbj|BAE42594.1| unnamed protein product [Mus musculus]
          Length = 443

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 67/262 (25%), Positives = 125/262 (47%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + T   G  LAPG       +++     + + A+ ++N +++   D  M
Sbjct: 158 RLSKIKLTALVVSTTSAGFALAPGPFDWSCFLLTSLGTGLASCAANSINQFFEVPFDSNM 217

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A       AV  + ++   +N ++  L   +IF Y   YT  L
Sbjct: 218 NRTKNRPLVRGQISPLLAVSFATCCAVPGVALLTWGVNPLTGALGVFNIFLYTCCYTP-L 276

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GAIPP++GW + TG +   +L++  I++ W  PHF +L+   ++DY
Sbjct: 277 KRVSITNTWVGAVVGAIPPVMGWTAATGSLDAGALLLGGILYSWQFPHFNALSWGLREDY 336

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    +     +L   +  + +I   +  + +   
Sbjct: 337 SRGGYCMMSVT-HPALCRRVALRHCLALIALSTAAPVLDITTWVFPVISLPINLYISYLG 395

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R ++   D D R ++KLF  S
Sbjct: 396 FRFYV---DADRRSSRKLFFCS 414


>gi|195119237|ref|XP_002004138.1| GI18678 [Drosophila mojavensis]
 gi|193914713|gb|EDW13580.1| GI18678 [Drosophila mojavensis]
          Length = 362

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 71/282 (25%), Positives = 136/282 (48%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           LN +  L K R+ SL + T   G V+AP        V+      + + A+ A+N Y++  
Sbjct: 41  LNKYKKLSKFRLTSLVVITTMGGYVMAPASFDATSFVMCTLGTGLVSAAANAVNQYHEVP 100

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQI+P  A    V  A + + ++   +N ++A L   ++F Y  I
Sbjct: 101 FDSQMSRTKNRVLVTGQITPLNALGFAVVSATTGLCLLYFGVNGLTAALGAGNLFLYTSI 160

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GW+  TG +   ++++  +++ W  PHF +L+  
Sbjct: 161 YTP-MKRISIANTWVGSIVGAIPPLMGWSGCTGTLDTGAMILAGVLYAWQFPHFNALSWN 219

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+  V+     +   L Y ++   + +        +  + +    L  +
Sbjct: 220 LRPDYSRAGYRMMA-VIDPALCRRTALRYALVICGMSLAAPFFNITNYWFVLESLPLNIY 278

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
               A++ +   +  D   +++LF  S+ +L  L  + + + 
Sbjct: 279 LCYLAYKFY---QKSDSGSSRRLFRFSLIHLPALMLLFLANK 317


>gi|113866382|ref|YP_724871.1| protoheme IX farnesyltransferase [Ralstonia eutropha H16]
 gi|123134475|sp|Q0KER8|COXX_RALEH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|113525158|emb|CAJ91503.1| Protoheme IX farnesyltransferase (heme O synthase) [Ralstonia
           eutropha H16]
          Length = 307

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +  L KPRV  LA++ A +G+ LA PG +     +     I + AGA+ A+N   +  
Sbjct: 21  RQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWRVLIGGAAGIWLLAGAAFAINCLVEQK 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP   G+I+  +  V    L  + + ++ +  N ++  L F +   Y V+
Sbjct: 81  IDALMRRTAWRPSATGEITTPQTLVFSAILGGAGMWLLHVYANDLTMWLTFATFLGYAVV 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LK  TPQNIVIGG++GA+PP +GWA+V G+V   +  + LIIF WTPPHFW+LAL 
Sbjct: 141 YTILLKPATPQNIVIGGLSGAMPPALGWAAVAGEVPAEAWFLVLIIFTWTPPHFWALALY 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY K+ +PMLP    +R T +HIL+YT++     +LP + G +   Y      LG  
Sbjct: 201 RRADYAKSGLPMLPVTHGERYTLLHILLYTLIMIAATLLPFVYGMSGYIYLAAALALGAG 260

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           F  +AW+ +    D+   + ++ F  SI YL +LF  L+VDH    
Sbjct: 261 FLAYAWKMYRNYSDE---LAQRAFRFSILYLSLLFAALLVDHYFKF 303


>gi|119387025|ref|YP_918080.1| protoheme IX farnesyltransferase [Paracoccus denitrificans PD1222]
 gi|182639214|sp|A1BA40|COXX_PARDP RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|119377620|gb|ABL72384.1| protoheme IX farnesyltransferase [Paracoccus denitrificans PD1222]
          Length = 305

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 133/289 (46%), Positives = 180/289 (62%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              ++ LLKPRVMSL ++TAFVG+ +AP  ++   +  ++  IA+G GASGALNM+YDAD
Sbjct: 15  FGDYVALLKPRVMSLVVFTAFVGLWIAPQPVNPFVAFCAVLFIALGGGASGALNMWYDAD 74

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP+P G+++  EA  +G++L+  S++++GLA NW +A  L  +IF Y V+
Sbjct: 75  IDAVMRRTAGRPVPSGRVTSQEALAVGIALSGLSVMMLGLAANWFAAGFLAFTIFFYAVV 134

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR TPQNIVIGG AGA PPMIGWA  TG + I SL+MF +IF WTPPHFW+LAL 
Sbjct: 135 YTIWLKRSTPQNIVIGGAAGAFPPMIGWACATGGIGIESLLMFALIFFWTPPHFWALALF 194

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            KDDY KA +PML      + T+ HI  YT++ +   +           Y  +   L   
Sbjct: 195 MKDDYSKAGVPMLTVTHGRKVTRCHIFAYTLVLAPFALWLGFTSVGGPLYLAVSVVLNAL 254

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           F    W+     ED       RV K+ F  S+ Y F+ F  L+V H + 
Sbjct: 255 FIAGGWQILRRSEDQAQADGYRVEKRYFRLSLYYTFLHFLALLVQHWVG 303


>gi|331697208|ref|YP_004333447.1| protoheme IX farnesyltransferase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326951897|gb|AEA25594.1| Protoheme IX farnesyltransferase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 325

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 107/289 (37%), Positives = 153/289 (52%), Gaps = 3/289 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            ++ L K R++   +      + LA  G  SV   + ++   AM A ++ ALN   DADI
Sbjct: 36  SYLALTKTRIIEQLLVVTVPAMFLAQRGVPSVWLILATLVGGAMAAASAHALNCVVDADI 95

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M RT+ RP+  G + P  A + G+ L   S   + L  NW++A L   +I  YV++Y
Sbjct: 96  DAKMKRTSRRPLAKGVVPPRNALIFGLVLGAVSSAWLALTTNWLAAALSAAAIAFYVLVY 155

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR T QNIV GG AG +P +IGWA+VTG V   +LVMF +IF WTPPHFW+LA+  
Sbjct: 156 TLLLKRRTAQNIVWGGAAGCMPVVIGWAAVTGTVGWPALVMFGVIFFWTPPHFWALAMRY 215

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           +DDY  A +PMLP V       + I+ Y V+ ++  +L  +L   S  Y  +    G  F
Sbjct: 216 RDDYAAAGVPMLPVVARPDQVSVRIVGYAVVMALWTLL--LLPVTSWIYAAVAVLGGGWF 273

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
              + R  +  +        KLF  S  YL VLF  + VD  + + T  
Sbjct: 274 VFKSVRMHVAVKAGRDVTPMKLFHLSNIYLCVLFAAIAVDAAVGLPTFG 322


>gi|115376445|ref|ZP_01463681.1| protoheme IX farnesyltransferase [Stigmatella aurantiaca DW4/3-1]
 gi|115366577|gb|EAU65576.1| protoheme IX farnesyltransferase [Stigmatella aurantiaca DW4/3-1]
          Length = 327

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 149/280 (53%), Gaps = 3/280 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
           +  + L KPR+ SL + T   G+ LAPGH+   + ++++ A A    A+ A N Y +   
Sbjct: 44  SDLLSLTKPRLSSLVLATTAGGVWLAPGHLHFSRVLVTLLATAGTVAAANAFNCYLERHS 103

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D+ MART +RP+P G++ P  A   G+SLA  S+  + L  N ++A L   ++  YV+IY
Sbjct: 104 DRFMARTTNRPLPSGRMEPGVALWFGLSLAAVSLPALALGANLLTALLGLAALLSYVLIY 163

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T  LK  T   +++G + GA+PP++GW +VTG V     V+F I+FLW  PHF ++AL  
Sbjct: 164 TP-LKARTSAAMLVGAVPGALPPLMGWTAVTGVVDAGGFVLFSILFLWQIPHFLAIALFR 222

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           K++Y  A +  +P    D +++  I++Y V    + +LP  L  A   Y      LG  F
Sbjct: 223 KEEYAAAGLKSVPLERGDESSRAQIVLYLVALVPMTLLPYQLHIAGGWYLAAAVVLGLVF 282

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
                  F  +  K     ++ F  S+ YL  LF  + +D
Sbjct: 283 LALGAWGFFRQMGK--PWARQTFFYSLLYLTGLFAAMALD 320


>gi|307326015|ref|ZP_07605213.1| protoheme IX farnesyltransferase [Streptomyces violaceusniger Tu
           4113]
 gi|306888237|gb|EFN19225.1| protoheme IX farnesyltransferase [Streptomyces violaceusniger Tu
           4113]
          Length = 288

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 162/286 (56%), Gaps = 4/286 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            F+ L KPRV+ L + T    + LA  G   +   V +     + AG + A NMYYD DI
Sbjct: 2   AFVALTKPRVIELLLMTTVPVMFLAAQGVPDLWLVVKTCVGGYLSAGGAAAFNMYYDRDI 61

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RTA RP+  G +SP E  V   +LA  S       +N +SA L   ++  YVVIY
Sbjct: 62  DALMERTAQRPLVTGMVSPRECLVFAFALAAVSTAWFWALVNPLSAMLSLGALVFYVVIY 121

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR T QNIV GGIAG +P +IGW+SVT +VS A++++FL+IF WTPPH+W L++  
Sbjct: 122 TMWLKRRTSQNIVWGGIAGCMPVLIGWSSVTNEVSWAAVILFLVIFFWTPPHYWPLSMKV 181

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           K+DY++A++PMLP +  ++     I++Y+    IV +L   LG+    Y ++   LG  +
Sbjct: 182 KEDYERANVPMLPVIAGNKVVAKQIVLYSWAMVIVSLLLWPLGYTGWFYPVVAAVLGGFW 241

Query: 249 TLWAWRTFLCKED---KDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 242 LKEAHALQGRAKAGIMGAKLKEMRLFHWSITYVSLLFVAVAVDPFL 287


>gi|88861095|ref|ZP_01135730.1| Polyprenyltransferase [Pseudoalteromonas tunicata D2]
 gi|88817023|gb|EAR26843.1| Polyprenyltransferase [Pseudoalteromonas tunicata D2]
          Length = 286

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 102/287 (35%), Positives = 165/287 (57%), Gaps = 6/287 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHI---SVLKSVISIFAIAMGAGASGALNMYY 64
           +N ++ L K +V++L + TA+VG+ LAP  +   S+     ++  I + + ++  +N   
Sbjct: 2   VNDYLELCKIKVVALLVLTAWVGLALAPDLLVPRSIAVQFFTLLGIGLLSSSAAVINHLV 61

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D +ID  MART  RP+  G++S   A +  +++ V    ++    N ++A L   ++  Y
Sbjct: 62  DREIDGKMARTRHRPVVKGRVSRKSAAIFALAIGVIGFFLLLEVANLLTAMLTLFALVGY 121

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT++LKR TPQNIVIGG+AGA+PP++GW S TG ++    ++ +IIF WTPPHFW+L
Sbjct: 122 AVVYTLFLKRATPQNIVIGGLAGAMPPLLGWVSETGQLAAEPWLLVMIIFTWTPPHFWAL 181

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  +DDY +A IPMLP        K  IL Y++L  IV ++P ++G +S  Y  +   L
Sbjct: 182 AIHRRDDYARAKIPMLPVTHGIEFCKTCILSYSILLGIVCLIPYLIGMSSWFYLAVACVL 241

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              F    ++ F+ K    +     LF  SI  L +LF  L +D  +
Sbjct: 242 NGLFI---FKAFMLKFRPAVNSAMDLFKYSIWQLMLLFIGLFIDKWL 285


>gi|189184102|ref|YP_001937887.1| protoheme IX farnesyltransferase [Orientia tsutsugamushi str.
           Ikeda]
 gi|238692018|sp|B3CTF6|COXX_ORITI RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|189180873|dbj|BAG40653.1| cytochrome c oxidase assembly factor [Orientia tsutsugamushi str.
           Ikeda]
          Length = 312

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 129/283 (45%), Positives = 184/283 (65%), Gaps = 3/283 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             F++L+KP VM LA++TA  G+ +AP  I  L S I+I  I+ GAGA+GA+NM+YDADI
Sbjct: 27  KDFLLLMKPSVMLLAVFTAITGLFIAPNKIHPLLSSIAILCISTGAGAAGAINMWYDADI 86

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D +M RT +RP   G+I P  A   G+ LA  S+++M + +N++S+ LL +SI  Y+++Y
Sbjct: 87  DSIMKRTRNRPTVTGKIPPSTALTFGIILAFFSVLVMAICVNYISSILLLISISFYIIVY 146

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR T QNIVIGG AGA+PP+IG+++VT  +    L++FLIIFLWTP HFW+L+L  
Sbjct: 147 TMWLKRRTAQNIVIGGAAGALPPVIGYSAVTNSIDTTCLMLFLIIFLWTPAHFWTLSLYY 206

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A++P+LP V     TK  IL YT LT I   LP     A + Y I     G  F
Sbjct: 207 TNDYKLANVPILPLVKGINYTKYSILAYTFLTVISASLPYFTDIAGLLYLICSTISGIIF 266

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +A   F    D++  + +K+F  SI YLF +F  L+++H I
Sbjct: 267 LCYASMLF---NDRNNILARKMFKYSIIYLFNIFLYLIIEHCI 306


>gi|30410008|ref|NP_848466.1| protoheme IX farnesyltransferase, mitochondrial precursor [Mus
           musculus]
 gi|83286949|sp|Q8CFY5|COX10_MOUSE RecName: Full=Protoheme IX farnesyltransferase, mitochondrial;
           AltName: Full=Heme O synthase; Flags: Precursor
 gi|23959172|gb|AAH38046.1| COX10 homolog, cytochrome c oxidase assembly protein, heme A:
           farnesyltransferase (yeast) [Mus musculus]
 gi|56205099|emb|CAI25610.1| COX10 homolog, cytochrome c oxidase assembly protein, heme A:
           farnesyltransferase (yeast) [Mus musculus]
 gi|56238020|emb|CAI26029.1| COX10 homolog, cytochrome c oxidase assembly protein, heme A:
           farnesyltransferase (yeast) [Mus musculus]
 gi|74185746|dbj|BAE32754.1| unnamed protein product [Mus musculus]
 gi|148678442|gb|EDL10389.1| COX10 homolog, cytochrome c oxidase assembly protein, heme A:
           farnesyltransferase (yeast), isoform CRA_a [Mus
           musculus]
          Length = 443

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 67/262 (25%), Positives = 125/262 (47%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + T   G  LAPG       +++     + + A+ ++N +++   D  M
Sbjct: 158 RLSKIKLTALVVSTTSAGFALAPGPFDWSCFLLTSLGTGLASCAANSINQFFEVPFDSNM 217

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A       AV  + ++   +N ++  L   +IF Y   YT  L
Sbjct: 218 NRTKNRPLVRGQISPLLAVSFATCCAVPGVALLTWGVNPLTGALGVFNIFLYTCCYTP-L 276

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GAIPP++GW + TG +   +L++  I++ W  PHF +L+   ++DY
Sbjct: 277 KRVSITNTWVGAVVGAIPPVMGWTAATGSLDAGALLLGGILYSWQFPHFNALSWGLREDY 336

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    +     +L   +  + +I   +  + +   
Sbjct: 337 SRGGYCMMSVT-HPALCRRVALRHCLALIALSTAAPVLDITTWVFPVISLPINLYISYLG 395

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R ++   D D R ++KLF  S
Sbjct: 396 FRFYV---DADRRSSRKLFFCS 414


>gi|269958519|ref|YP_003328306.1| protoheme IX farnesyltransferase [Anaplasma centrale str. Israel]
 gi|269848348|gb|ACZ48992.1| protoheme IX farnesyltransferase [Anaplasma centrale str. Israel]
          Length = 301

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 136/283 (48%), Positives = 187/283 (66%), Gaps = 1/283 (0%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYY 64
           +  +  +I LLKPR+M L ++TA  G+++APG I  L  ++S   +A+GAGA+GALNM+Y
Sbjct: 17  LSSVGDYIQLLKPRIMCLVVFTAVTGMLVAPGTIHPLIGLVSTVCVALGAGAAGALNMWY 76

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D+DID +M RT SRP+P G+I   +A   G+ LA  S+ IM +A+N+ SA LL  SIF Y
Sbjct: 77  DSDIDAIMDRTKSRPVPAGKIRREQALECGMVLATLSVFIMAIAVNYASALLLAGSIFSY 136

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LKR TPQNIVIGGIAGA PP+IGWASV+G  S  SL +F IIF+WTPPHFW++
Sbjct: 137 AVVYTMLLKRRTPQNIVIGGIAGAFPPVIGWASVSGAPSFESLALFAIIFVWTPPHFWAI 196

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           +LL  ++Y+KASIPMLP V   R T+ HIL+Y+ + ++V   P +     + Y I+   L
Sbjct: 197 SLLTLEEYKKASIPMLP-VYCVRKTRWHILLYSAILAVVSATPGLFVKNPILYEILATCL 255

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
              F  +A   F  K     +    LF  SI YLF+LF  ++ 
Sbjct: 256 SATFIAYATAVFREKGQPSPQACMGLFKYSIYYLFLLFATVIA 298


>gi|163782589|ref|ZP_02177586.1| cytochrome c oxidase assembly factor [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882162|gb|EDP75669.1| cytochrome c oxidase assembly factor [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 293

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 100/282 (35%), Positives = 170/282 (60%), Gaps = 5/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVL-APGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ L KP +++L + T   GI + A G++  +    ++      A  S  +NM++D 
Sbjct: 12  LKEYLALTKPGIVTLVLITTLGGIYIGAKGNLEPISVFWTLLGTGFAAAGSAVINMFFDR 71

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           D+D +M RT+SRP+P G ++P  A V G+ L V+S  ++ + +N ++A L  ++ F YVV
Sbjct: 72  DVDVLMERTSSRPLPRGAVNPTGALVFGILLLVTSFAVLYVFVNTIAAVLAMLAAFSYVV 131

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR TP    +GGI+GA+PP+IG+ + +G++ + + V+FLI+F+W PPHFW LAL
Sbjct: 132 LYTVILKRRTPVATEVGGISGALPPVIGYVAASGELDLRAFVLFLIMFMWQPPHFWVLAL 191

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +DDY +A IP LP       TK+  L+YTV    + ++P  +G     Y +  F +  
Sbjct: 192 KYRDDYARAGIPTLPVSRGVFITKVKTLVYTVSLLPLSLIPYAIGMTGKLYFVTAFVISL 251

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            +T++  +    K+++      KLF  SI Y+ VLF+++++D
Sbjct: 252 IYTVYTLKFLFSKKEES----MKLFFFSIIYIAVLFSVMIID 289


>gi|8039780|sp|P08301|COXX_PARDE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 298

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 130/289 (44%), Positives = 177/289 (61%), Gaps = 4/289 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              ++ LLKPRVMSL ++TAFVG+ +AP  ++   +  ++  IA+G GASGALNM+YDAD
Sbjct: 8   FGDYVALLKPRVMSLVVFTAFVGLWIAPQPVNPFVAFCAVLFIALGGGASGALNMWYDAD 67

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RTA RP+P G+++  E   +G++L+  S++++G   NW +A  L  +IF Y V+
Sbjct: 68  IDAVMRRTAGRPVPSGRVTSQEPLAVGIALSGLSVMMLGAGGNWFAAGFLAFTIFFYAVV 127

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR TPQNIVIGG AGA PPMIGWA  TG + I SL+MF +IF WTPPHFW+LAL 
Sbjct: 128 YTIWLKRSTPQNIVIGGAAGAFPPMIGWALPTGGIGIESLLMFALIFFWTPPHFWALALF 187

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            KDDY KA +PML      + T+ HI  YT++ +   +           Y  +   L   
Sbjct: 188 MKDDYSKAGVPMLTVTHGRKVTRCHIFAYTLVLAPFALWLGFTSVGGPLYLAVSVVLNAL 247

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           F    W+     ED       RV K+ F  S+ Y F+ F  L+V H + 
Sbjct: 248 FIAGGWQILRRSEDQAQADGYRVEKRYFRLSLYYTFLHFLALLVQHWVG 296


>gi|224074605|ref|XP_002198729.1| PREDICTED: COX10 homolog, cytochrome c oxidase assembly protein,
           heme A: farnesyltransferase [Taeniopygia guttata]
          Length = 454

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 70/273 (25%), Positives = 133/273 (48%), Gaps = 5/273 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + T   G  +AP    +   +++     + + A+ ++N +++   D  M
Sbjct: 157 RLSKIKLTALVVSTTSAGFAMAPVPFELTCFLLASLGTGLASCAANSINQFFEVPFDSNM 216

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A     S  +  I ++ L +N ++  L   +IF Y   YT  L
Sbjct: 217 NRTKNRPLVRGQISPLLAVCFAASCGIPGIALLTLGVNPLTGALGAFNIFLYTCCYTP-L 275

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GAIPP++GW + TG +   +L++  I++ W  PHF +L+   ++DY
Sbjct: 276 KRMSIANTWVGAVVGAIPPIMGWTAATGSLDAGALLLGGILYSWQFPHFNALSWGLREDY 335

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    +  +  +L   + T+ II   L  + +   
Sbjct: 336 SRGGYCMMSVTHPG-LCRRVALRHCLALIGLSTVAPVLNITTWTFPIISLPLNLYISYLG 394

Query: 253 WRTFLCKEDKDIRVTKKLFLESITYLFVLFTIL 285
           +R +    D D   ++KLF  S+ +L +L  ++
Sbjct: 395 FRFY---RDADRSSSRKLFFCSLWHLPMLLLVM 424


>gi|195050631|ref|XP_001992934.1| GH13369 [Drosophila grimshawi]
 gi|193899993|gb|EDV98859.1| GH13369 [Drosophila grimshawi]
          Length = 351

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 67/283 (23%), Positives = 134/283 (47%), Gaps = 5/283 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           + N +  L K R+ SL + T   G  +AP    +   V+      + + A+ ++N Y++ 
Sbjct: 29  KFNQYKKLSKFRLTSLVVITTMGGYAMAPAAFDLTTFVMCSVGTGLVSAAANSINQYHEV 88

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
             D  M+RT +R +  GQ++P +A       A + + ++   +N ++A L   ++F Y  
Sbjct: 89  PFDSQMSRTKNRVLVTGQMTPLQAVGFAAVSATTGLCMLYFGVNGLTAALGAGNLFLYTS 148

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT  +KR +  N  +G + GAIPP++GWA   G +   ++++  +++ W  PHF +L+ 
Sbjct: 149 VYTP-MKRMSIANTWVGSVVGAIPPLMGWAGCAGSLDAGAMILAGVLYAWQFPHFNALSW 207

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + DY +A   M+     D   +   L Y      + ++  +L   +  + +    L  
Sbjct: 208 NLRPDYSRAGYRMMAVTNPD-LCRRTALRYAFAIGGLSMMAPLLDVTNYWFVLETLPLNA 266

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDH 289
           +F   A++        D   ++KLF  S+ +L  L  + + + 
Sbjct: 267 YFCYLAYKFHH---KSDSGSSRKLFRFSLIHLPALMLLFLANK 306


>gi|315128022|ref|YP_004070025.1| polyprenyltransferase [Pseudoalteromonas sp. SM9913]
 gi|315016536|gb|ADT69874.1| polyprenyltransferase [Pseudoalteromonas sp. SM9913]
          Length = 309

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 103/287 (35%), Positives = 161/287 (56%), Gaps = 4/287 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG-HISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ + K +V+++ + TA+VG+ LAP     V    IS+  I + + A+  +N   D+
Sbjct: 26  IQDYLAISKFKVVAMLVLTAWVGLALAPDVGRGVGVQFISLLGIGLLSAAAAVINHVVDS 85

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           +ID  MART  RP+  G++S   A      + V+  +++ L  N ++A L   ++  Y  
Sbjct: 86  EIDSKMARTRHRPVAKGRLSKLHALSFAAVIGVAGFIMLMLWANTLTAILTLFALVGYAF 145

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNIVIGG+AGA+PP++GW S T  ++ A  ++ +IIF WTPPHFW+LA+
Sbjct: 146 IYTSFLKRATPQNIVIGGLAGAMPPLLGWVSETNQMAAAPWLLVMIIFTWTPPHFWALAI 205

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             K DY++A IPMLP        K  +L Y+VL +IV V P ++G + + Y      L  
Sbjct: 206 ARKSDYERAKIPMLPVTHGIDFCKTCVLAYSVLLAIVCVFPYLIGMSGLIYLSGACLLNI 265

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
            F   A       ++        LF  SI +L +LF IL +D  + +
Sbjct: 266 VFIYKAINLKFAAKEDT---AMDLFRFSIIHLMILFIILFIDKWLVI 309


>gi|50305327|ref|XP_452623.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74606948|sp|Q6CTW6|COX10_KLULA RecName: Full=Protoheme IX farnesyltransferase, mitochondrial;
           AltName: Full=Heme O synthase; Flags: Precursor
 gi|49641756|emb|CAH01474.1| KLLA0C09548p [Kluyveromyces lactis]
          Length = 452

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/300 (22%), Positives = 132/300 (44%), Gaps = 20/300 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   +VL+ +       + + ++ A+NM  + D
Sbjct: 139 IEPYLQLSKPRLTVLVMLSAICSYALSPYPATVLQLLSLTVGTTLCSASANAINMGREPD 198

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G +SP +A+    +       I+ L +N   A L F +I  Y  +
Sbjct: 199 FDRQMIRTQARPVVRGIVSPNQAFKFATAAGTLGTSILWLGVNPTVAFLGFSNIALYAWL 258

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  LKR    N  +G + GAIPP++GWA+ +      +  +  +++ W  PHF +L+  
Sbjct: 259 YTS-LKRKHIINTWVGALVGAIPPLMGWAASSPLSHPGAWCLAGLLYAWQFPHFNTLSHN 317

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M       +      L Y++L   +    +        Y +   F+   
Sbjct: 318 IRNEYKNAGYVMTAWKN-PKLNARVALRYSLLMFPLCFGLSYFNVTDWYYQLDSAFVNAW 376

Query: 248 FTLWAWRTFLCKEDKDIR------------------VTKKLFLESITYLFVLFTILMVDH 289
            +LWA++ +  ++    +                    ++ F  S+ +L  +  + ++  
Sbjct: 377 MSLWAFKFYFQQKRNYSKEIYNNKTEFNKGLAMANVYARRTFWVSVLHLPAVLILAILHK 436


>gi|239940393|ref|ZP_04692330.1| protoheme IX farnesyltransferase [Streptomyces roseosporus NRRL
           15998]
 gi|239986873|ref|ZP_04707537.1| protoheme IX farnesyltransferase [Streptomyces roseosporus NRRL
           11379]
          Length = 285

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 110/284 (38%), Positives = 161/284 (56%), Gaps = 4/284 (1%)

Query: 12  IVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           + L KPR++ L + T    + LA  G   +   +++     + AG + ALNMY D DID 
Sbjct: 1   MALTKPRIIELLLITTVPVMFLAAQGVPDLWLVLMTTIGGYLSAGGANALNMYIDRDIDA 60

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
           +M RT+ RP+  G +SP E    G+ LAV S +  GL +NW+SA L   ++  YVVIYT+
Sbjct: 61  LMDRTSQRPLVTGMVSPRECLAFGIGLAVFSTLWFGLLVNWLSAALALGALLFYVVIYTM 120

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR T QNIV GGIAG +P +IGW++VT  VS A++++F +IF WTPPH+W L++  KD
Sbjct: 121 LLKRRTSQNIVWGGIAGCMPVLIGWSAVTNTVSWAAVILFAVIFFWTPPHYWPLSMKVKD 180

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY +  +PMLP V T+R     I++Y+ +   V +L T LG+    Y  +    G  +  
Sbjct: 181 DYARVGVPMLPVVATNRVVARQIVLYSWVMVAVSLLLTPLGYTGWFYTAVALLSGGAWLW 240

Query: 251 WAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A       +           +LF  SITY+ +LF  + VD  +
Sbjct: 241 EAHGLQNRAKAGVTGAKLKEMRLFHWSITYVSLLFLAVAVDPFL 284


>gi|308177671|ref|YP_003917077.1| protoheme IX farnesyltransferase [Arthrobacter arilaitensis Re117]
 gi|307745134|emb|CBT76106.1| protoheme IX farnesyltransferase [Arthrobacter arilaitensis Re117]
          Length = 300

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 105/300 (35%), Positives = 160/300 (53%), Gaps = 6/300 (2%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHIS-VLKSVISIFAIAMGAGASGALNM 62
              +   ++ L KPRV+ L + +    ++ A      V   + ++   AM AGASGA N 
Sbjct: 1   MKRKALAYLALTKPRVIELLLVSTLPTMIFAERGFPAVWLMISTLVGGAMAAGASGAFNC 60

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           Y D D+DK+M RT  RP+  G ++P EA +   SLAV+S++++ +  N ++  L   +I 
Sbjct: 61  YIDRDMDKLMKRTKGRPLVTGDLTPKEALIFSWSLAVASLIVLWVGTNPLTTALGLAAIL 120

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            YVV YT+ LKR T QNIV GGIAG +P +I WA+V   +   ++++FL+IFLWTPPH+W
Sbjct: 121 LYVVFYTLILKRRTAQNIVWGGIAGCMPVLIAWAAVKNTIEWPAVILFLVIFLWTPPHYW 180

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
            L++   DDY  AS+PML  +   R   + +++Y   T +  +L   LG A + Y  I  
Sbjct: 181 PLSMKYADDYNAASVPMLGAIANARRVSVQVVLYAWATVVCSMLLVPLGNAGILYTAIAG 240

Query: 243 FLGYHFTLWAWRTFLCKEDKD-----IRVTKKLFLESITYLFVLFTILMVDHLIDMKTVE 297
             G  F   +   +   +         R   K+F  SITYL ++F  L VD  +      
Sbjct: 241 GAGIWFVYESHVLYREAQGNHKPAEVNRKAMKVFHISITYLTIVFLALAVDPFVGSPLFG 300


>gi|170046632|ref|XP_001850860.1| protoheme IX farnesyltransferase, mitochondrial [Culex
           quinquefasciatus]
 gi|167869353|gb|EDS32736.1| protoheme IX farnesyltransferase, mitochondrial [Culex
           quinquefasciatus]
          Length = 458

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 68/268 (25%), Positives = 130/268 (48%), Gaps = 6/268 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +++L K R+ SL + TA  G  +AP    +   ++      + +GA+ ++N   +  
Sbjct: 123 IYHYLMLSKIRLTSLVVMTAMAGYAMAPAPFELSTFLLCSIGTTLVSGAANSINQVIETS 182

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  MART +R +  G +S   A    +  +   + ++   +N ++A L   ++  Y  I
Sbjct: 183 FDAQMARTRNRVLVQGHLSRLHAVGFALGASTVGVGMLYFGVNELTAALGAANLILYTSI 242

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVT-GDVSIASLVMFLIIFLWTPPHFWSLAL 186
           YT  +KR++  N  +G + GAIPP++GWA+ T GD+   + ++  +++ W  PHF +L+ 
Sbjct: 243 YTP-MKRYSILNTWVGSLVGAIPPLMGWAACTGGDIGAGAWILAGLLYCWQFPHFNALSW 301

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             + +Y KA   M+ N           L +T  T+ + +L   L   ++ + +    L  
Sbjct: 302 NIRPEYLKAGYKMMANS-HPELCTRVSLRHTGYTTALCLLAPALDVTNMWFALETLPLNA 360

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLES 274
           +F   AW      +  D + ++KLF  S
Sbjct: 361 YFAYLAWEFH---QKADSKSSRKLFRFS 385


>gi|194761758|ref|XP_001963093.1| GF15766 [Drosophila ananassae]
 gi|190616790|gb|EDV32314.1| GF15766 [Drosophila ananassae]
          Length = 395

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/267 (26%), Positives = 127/267 (47%), Gaps = 5/267 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L+ +  L K R+ SL + T   G  +AP         +     A+ + A+ A+N Y++  
Sbjct: 76  LSQYKKLSKFRLTSLVVITTMGGYAMAPAAFDPTSFAMCTLGTALVSAAANAINQYHEVP 135

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  M+RT +R +  GQ++P  A    V  A + + ++    N ++A L   ++F Y  I
Sbjct: 136 FDSQMSRTKNRVLVTGQMTPLHAVTFAVVSATTGLSMLYFGTNGLTAALGAGNLFLYTTI 195

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G + GAIPP++GWA   G +   ++++  I++ W  PHF +L+  
Sbjct: 196 YTP-MKRISIVNTWVGSVVGAIPPLMGWAGCAGTLDAGAMILAGILYAWQFPHFNALSWN 254

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+         +   L Y+V    + VL  +L   +  + +    L  +
Sbjct: 255 LRPDYSRAGYRMMAVTNPG-LCRRTALRYSVAIVGLSVLAPVLDVTNYWFALETLPLNAY 313

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F   A++     E  D   ++KLF  S
Sbjct: 314 FAYLAYKFH---EKSDSGSSRKLFRFS 337


>gi|312883094|ref|ZP_07742825.1| Protoheme IX farnesyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369254|gb|EFP96775.1| Protoheme IX farnesyltransferase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 299

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 100/271 (36%), Positives = 160/271 (59%), Gaps = 4/271 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V++L + TA VG+ L+ P   SV K+++ +F I + AGA+ +LN   D 
Sbjct: 16  WRCYLALTKPKVVALMLLTALVGMCLSNPDTFSVEKALLGLFGIGLMAGAAASLNHLIDE 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID +M RT  RP+P G++      V    L ++  + + + +N ++A L F S+  Y +
Sbjct: 76  RIDGIMERTHKRPLPSGRLKANHVIVFATILGLTGFITLFIGVNQLTAWLTFASLVGYAL 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR TPQNIVI GIAGA+PP++GW ++T ++   + ++ +IIF+WTPPHFW+L++
Sbjct: 136 VYTMYLKRATPQNIVIAGIAGAMPPLLGWTALTNELHAHAWILVMIIFVWTPPHFWALSI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY KA IPMLP       TK  IL+YT+L ++V +LP ++G +   Y      L  
Sbjct: 196 HRYQDYAKAKIPMLPVTHGIEYTKTSILLYTILLAVVSMLPFLIGMSGSLYLFGSTLLSV 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITY 277
            F   A++      D+      + F  SI +
Sbjct: 256 GFIYHAYKLKYLPTDRS---AIEAFKFSIYH 283


>gi|172040680|ref|YP_001800394.1| protoheme IX farnesyltransferase [Corynebacterium urealyticum DSM
           7109]
 gi|171851984|emb|CAQ04960.1| protoheme IX farnesyltransferase [Corynebacterium urealyticum DSM
           7109]
          Length = 312

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 93/305 (30%), Positives = 154/305 (50%), Gaps = 14/305 (4%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L KPRV+ L +      ++ A  G I +   ++++    MGA ++   NM  D 
Sbjct: 8   VKAYLALTKPRVIELLLVATIPAMLQANRGEIELGLIILTLIGGWMGAASANTFNMVVDY 67

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLA-INWVSATLLFMSIFCYV 125
           DID++M RT  RP+    +    A +    L ++S++ +     + +SA  + ++I+ YV
Sbjct: 68  DIDQLMRRTRRRPLAKDTVPVEHAKIFAWVLMIASVLWLTFLVHSPLSAAFILLTIWFYV 127

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV----------SIASLVMFLIIFL 175
            +Y+ WLKR T QN++ GG AG +P M+GWA+VT +            I ++++F++IF 
Sbjct: 128 YVYSKWLKRRTWQNVIWGGAAGCMPVMVGWAAVTDNNGGAFNAGWSSWIQAIILFMVIFF 187

Query: 176 WTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASV 235
           WTPPH W+L +  ++DY+ A +PM+P V         IL YT  T I  +L  ++  A  
Sbjct: 188 WTPPHTWALGMRYREDYKAAGVPMMPVVKPPLEVTRQILWYTWATVITSLL--LVPAAGW 245

Query: 236 TYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            Y +     G  F   A       ++       KLF  S  YL +LF  L VD +I   T
Sbjct: 246 IYAVAALASGAWFIFRAHGLHRGVKEGTPVKPMKLFFLSNNYLSLLFVALSVDAVIGWDT 305

Query: 296 VERYF 300
           + +  
Sbjct: 306 IWQML 310


>gi|301103564|ref|XP_002900868.1| protoheme IX farnesyltransferase, putative [Phytophthora infestans
           T30-4]
 gi|262101623|gb|EEY59675.1| protoheme IX farnesyltransferase, putative [Phytophthora infestans
           T30-4]
          Length = 461

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 72/310 (23%), Positives = 141/310 (45%), Gaps = 13/310 (4%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYY 64
             RL  +  L K R+ +L + T   G ++A G IS      +    ++ A ++   N  +
Sbjct: 72  KERLTIYSQLGKSRLSALVVMTTGAGFLMAGGPISWSTFAAATVGTSLAAVSANTFNQCW 131

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           + ++D  M RT  RP+P G+I+   A   G + A +S  I+    + + A+L   +I  Y
Sbjct: 132 EVELDAKMQRTHRRPLPSGRITRPHALAFGAATATASTAILAAGCSPLVASLGAFNIGLY 191

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV-SIASLVMFLIIFLWTPPHFWS 183
            ++YT  +K  +  N  +G I GAIPP++GWA+ TG V +  + +   +++ W  PHF++
Sbjct: 192 SLVYTP-MKMKSEWNTWMGSIVGAIPPVMGWAAATGTVLAPEAALHAYLLYCWQMPHFFA 250

Query: 184 LALLCKDDYQKASIPMLPNVVT-DRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           L+   + DY +    M+         +    L Y+     + ++  +    S  + +   
Sbjct: 251 LSWRSRKDYGRGGYQMVACNDPTGSRSAALALRYSYYMGAIPIVAALTDATSYMFAVEGT 310

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV-------DHLIDMKT 295
            +  +    A + +      +    +K+FL S+ YL V+   +++       D  ++ K 
Sbjct: 311 VVNAYTIYLAHKFY---AKPNNATAQKVFLASLWYLPVIMGCMVLHSQQWMDDEEVEAKK 367

Query: 296 VERYFFSSFL 305
               +  +FL
Sbjct: 368 EANVWREAFL 377


>gi|72162400|ref|YP_290057.1| protoheme IX farnesyltransferase [Thermobifida fusca YX]
 gi|123629164|sp|Q47ND5|COXX_THEFY RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|71916132|gb|AAZ56034.1| protoheme IX farnesyltransferase [Thermobifida fusca YX]
          Length = 325

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 99/288 (34%), Positives = 159/288 (55%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +I L KPRV+ L + T    + +A  G   +  +V ++    M A ++ A+N Y D 
Sbjct: 33  IRAYIALSKPRVIELLLITTIPVMFVAAQGVPPLGIAVATLVFGTMSAASANAINCYIDR 92

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  RP  + Q++P    + G++LAV S V   + +NW++A L   +I  Y+ 
Sbjct: 93  DIDRAMRRTRRRPTAMEQVTPRGTMIYGITLAVLSTVGFVVFVNWLAAALSVFAIAFYIF 152

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QN+V GGIAG +P +IGWA++T  +  A  ++FL++F WTPPH W+LA+
Sbjct: 153 VYTLLLKRRTAQNVVWGGIAGCMPVLIGWAAITERLDWAPFILFLVVFFWTPPHTWALAM 212

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A++PMLP V +DR   +  ++Y+  T +V +L   +   ++ Y +    LG 
Sbjct: 213 RYREDYAAANVPMLPVVASDRRVMLECVLYSWATVVVSLLLWPIADTTLLYPVAAAVLGV 272

Query: 247 HFTLWAWRTFLCKE---DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
                A R +             T   F  S  YL +LF  + +D L+
Sbjct: 273 ILLAQAHRLYNQVRAGVSGSKLKTMGFFHLSNAYLALLFVAVTIDPLL 320


>gi|325002687|ref|ZP_08123799.1| protoheme IX farnesyltransferase [Pseudonocardia sp. P1]
          Length = 350

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 107/290 (36%), Positives = 157/290 (54%), Gaps = 3/290 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  ++ L K R++   +      + LA  G  S+   V ++F  AM A A+ ALN   DA
Sbjct: 62  VAAYLGLTKTRIIEQLLVVTVPAMFLAQRGVPSLWLIVATLFGGAMAAAAAHALNCVADA 121

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RTA RP+  GQ+    A + G+ LA  S V +G   NW++A L   +I  YV+
Sbjct: 122 DIDQKMKRTARRPLAKGQVPTRHALIFGLVLAALSSVWLGFTTNWLAAALSLAAIAFYVL 181

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+ LKR T QNIV GG AG +P +IGWA+VTG V   +LVMF +IF WTPPHFW+LA+
Sbjct: 182 VYTLLLKRRTSQNIVWGGAAGCMPVVIGWAAVTGSVEWPALVMFGVIFFWTPPHFWALAM 241

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY  A +PMLP +       + I++Y+ +     +L  +L   S  Y  +    G 
Sbjct: 242 RYREDYAAAGVPMLPVIAPAPAVTVRIVVYSWVMVAWSLL--LLPATSWVYLAVAALGGI 299

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
           +F + A +     +         LF  S  YL VLF  + VD  + +  +
Sbjct: 300 YFVVRAHKLHAEVKAGGEVSPMPLFHLSNIYLCVLFAAIAVDAALGLPLL 349


>gi|259149984|emb|CAY86787.1| Cox10p [Saccharomyces cerevisiae EC1118]
 gi|323346140|gb|EGA80430.1| Cox10p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 462

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 62/307 (20%), Positives = 125/307 (40%), Gaps = 20/307 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   SV + +       + +G++ A+NM  + +
Sbjct: 146 IMPYLQLTKPRLTILVMLSAICSYALSPYPASVSELLCLTVGTTLCSGSANAINMGREPE 205

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +A+     +    + I+   +N   A L   +I  Y   
Sbjct: 206 FDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWA 265

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR    N  +G + G +PP++GW + +      S  +  ++F W  PHF +L+  
Sbjct: 266 YTS-MKRKHIINTWLGALVGMVPPLMGWTAASPLSHPGSWCLAGLLFAWQFPHFNTLSHN 324

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M              L Y++L   +    +        Y I    +   
Sbjct: 325 IRNEYKNAGYVMTAWKN-PLLNARVSLRYSILMFPLCFGLSYFNITDWYYQIDSGLINAW 383

Query: 248 FTLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDH 289
            T WA++ +  +                          +K F+ S+ +L  +  + ++  
Sbjct: 384 LTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIYARKTFMASVLHLPAILILAIIHK 443

Query: 290 LIDMKTV 296
                 +
Sbjct: 444 KGRWDWI 450


>gi|126733562|ref|ZP_01749309.1| protoheme IX farnesyltransferase [Roseobacter sp. CCS2]
 gi|126716428|gb|EBA13292.1| protoheme IX farnesyltransferase [Roseobacter sp. CCS2]
          Length = 310

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 130/278 (46%), Positives = 175/278 (62%), Gaps = 4/278 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            +  LLKPRVMSL ++TA VG+++AP  +      ++I  IA+GAGASGALNM++DADID
Sbjct: 17  DYFALLKPRVMSLVVFTALVGLLVAPVPVHPFIGFVAILCIAVGAGASGALNMWWDADID 76

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
             M RTA RPIP G++ P EA  +G++L+  +IV++ LA N+++A LL  +IF Y VIY+
Sbjct: 77  ARMKRTAGRPIPSGRVEPGEALGIGLALSGFAIVLLALATNFLAAFLLAFTIFFYAVIYS 136

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA PPMIGWA  TG V I S++MF +IF+WTPPHFW+LAL  K
Sbjct: 137 MWLKRATPQNIVIGGAAGAFPPMIGWAVATGGVGIESVLMFALIFMWTPPHFWALALFVK 196

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
            DY  A +PML        T+ HI+IYT+L   V +           Y  +  ++   F 
Sbjct: 197 SDYGNAGVPMLTETHGRDATRKHIIIYTLLLVPVAIGLGFTSIGGPIYMAVAVWMNAWFL 256

Query: 250 LWAWRTFLCKE----DKDIRVTKKLFLESITYLFVLFT 283
             A+  +   +        RV  K+F  S+ YLF  F 
Sbjct: 257 KGAYDIWRRTDADCEADKHRVEIKVFKVSLYYLFAHFG 294


>gi|196017008|ref|XP_002118352.1| hypothetical protein TRIADDRAFT_34046 [Trichoplax adhaerens]
 gi|190579068|gb|EDV19174.1| hypothetical protein TRIADDRAFT_34046 [Trichoplax adhaerens]
          Length = 295

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 80/285 (28%), Positives = 138/285 (48%), Gaps = 5/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L  ++ + K R+  L + T+  G +LAPG   +   + +   + +   ++ A+N + +  
Sbjct: 3   LPVYLQISKIRLTGLVLLTSIGGYLLAPGDTVLSSLLCTSLGVGLSGCSANAINQWLEVP 62

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D  MART +R +  G I+P  A        +SS+ ++  A+N ++A L  ++IF Y  I
Sbjct: 63  YDSQMARTRNRVLVKGLITPVHAMTFATLSGISSVSLLYYAVNPLTAYLAALNIFLYTCI 122

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT   KR    N  +G I GA+PP++GWA+ TG + I  L +  I++ W  PHF +L+  
Sbjct: 123 YTP-SKRLGIGNTWLGAIVGALPPLMGWAAKTGGIDIGGLALAGILYSWQFPHFNALSWN 181

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            K DY +A   M+  V      +   L +T+  +++  L  +       + +        
Sbjct: 182 LKADYSRAGYRMMA-VTHPELCRRVSLRHTLALTLLSCLLPICQLTPWWFALYSLPTNAW 240

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
           FT  AWR      D + +  +KLF  S+ YL ++   + V  LI 
Sbjct: 241 FTWLAWRFHK---DANNQSARKLFRFSLYYLPLIIGTMFVSKLIH 282


>gi|323335303|gb|EGA76592.1| Cox10p [Saccharomyces cerevisiae Vin13]
          Length = 462

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 62/307 (20%), Positives = 125/307 (40%), Gaps = 20/307 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   SV + +       + +G++ A+NM  + +
Sbjct: 146 IMPYLQLTKPRLTILVMLSAICSYALSPYPASVSELLCLTVGTTLCSGSANAINMGREPE 205

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +A+     +    + I+   +N   A L   +I  Y   
Sbjct: 206 FDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWA 265

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR    N  +G + G +PP++GW + +      S  +  ++F W  PHF +L+  
Sbjct: 266 YTS-MKRKHIINTWLGALVGMVPPLMGWXAASPLSHPGSWCLAGLLFAWQFPHFNTLSHN 324

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M              L Y++L   +    +        Y I    +   
Sbjct: 325 IRNEYKNAGYVMTAWKN-PLLNARVSLRYSILMFPLCFGLSYFNITDWYYQIDSGLINAW 383

Query: 248 FTLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDH 289
            T WA++ +  +                          +K F+ S+ +L  +  + ++  
Sbjct: 384 LTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIYARKTFMASVLHLPAILILAIIHK 443

Query: 290 LIDMKTV 296
                 +
Sbjct: 444 KGRWDWI 450


>gi|149200836|ref|ZP_01877811.1| protoheme IX farnesyltransferase [Roseovarius sp. TM1035]
 gi|149145169|gb|EDM33195.1| protoheme IX farnesyltransferase [Roseovarius sp. TM1035]
          Length = 318

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 131/285 (45%), Positives = 183/285 (64%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
              F  LLKPRVM+L ++TA VG++ AP  +  +    +I  IA+G GA+GALNM++++D
Sbjct: 22  FGDFFALLKPRVMTLVVFTALVGLLAAPVGVHPVIGFAAILFIAVGGGAAGALNMWWESD 81

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP G+++  EA+  G++LAV S+V++ LA N ++A +L  +IF YVVI
Sbjct: 82  IDALMKRTQKRPIPAGKVTRDEAFAFGITLAVMSVVMLWLATNALAAGILAFTIFFYVVI 141

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTI LKR+TPQNIVIGG AGA PPMIGWA+ TG VS+ S++MF +IF+WTPPHFW+LAL 
Sbjct: 142 YTIGLKRWTPQNIVIGGAAGAFPPMIGWAAATGTVSLESVLMFALIFMWTPPHFWALALF 201

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY  A +PML      R T++HIL+YTVL + + +     G     Y  +       
Sbjct: 202 MRGDYDTAGVPMLTVTHGRRATRVHILVYTVLLAALAIGAAFTGIGGPVYLAVAVVFNAL 261

Query: 248 FTLWAWRTFLCKED----KDIRVTKKLFLESITYLFVLFTILMVD 288
           F   A   +   ED     + RV K+ F  S+ YLF  FT ++ +
Sbjct: 262 FLRDAVAIWRRDEDQAEADNYRVEKRAFKLSLWYLFAHFTAILAE 306


>gi|151942627|gb|EDN60973.1| heme O synthase [Saccharomyces cerevisiae YJM789]
          Length = 462

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/307 (20%), Positives = 126/307 (41%), Gaps = 20/307 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   SV + +       + +G++ A+NM  + +
Sbjct: 146 IMPYLQLTKPRLTILVMLSAICSYALSPYPASVSELLCLTVGTTLCSGSANAINMGREPE 205

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +A+     +    + I+   +N   A L   +I  Y   
Sbjct: 206 FDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWA 265

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR    N  +G + G +PP++GWA+ +      S  +  ++F W  PHF +L+  
Sbjct: 266 YTS-MKRKHIINTWLGALVGMVPPLMGWAAASPLSHPGSWCLAGLLFAWQFPHFNTLSHN 324

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M              L Y++L   +    +        Y I    +   
Sbjct: 325 IRNEYKNAGYVMTAWKN-PLLNARVSLRYSILMFPLCFGLSYFNITDWYYQIDSGLINAW 383

Query: 248 FTLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDH 289
            T WA++ +  +                          +K F+ S+ +L  +  + ++  
Sbjct: 384 LTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIYARKTFMASVLHLPAILILAIIHK 443

Query: 290 LIDMKTV 296
                 +
Sbjct: 444 KGRWDWI 450


>gi|190407789|gb|EDV11054.1| farnesyl transferase [Saccharomyces cerevisiae RM11-1a]
 gi|256274194|gb|EEU09102.1| Cox10p [Saccharomyces cerevisiae JAY291]
 gi|323306952|gb|EGA60236.1| Cox10p [Saccharomyces cerevisiae FostersO]
 gi|323351966|gb|EGA84505.1| Cox10p [Saccharomyces cerevisiae VL3]
          Length = 462

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 63/307 (20%), Positives = 126/307 (41%), Gaps = 20/307 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   SV + +       + +G++ A+NM  + +
Sbjct: 146 IMPYLQLTKPRLTILVMLSAICSYALSPYPASVSELLCLTVGTTLCSGSANAINMGREPE 205

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +A+     +    + I+   +N   A L   +I  Y   
Sbjct: 206 FDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWA 265

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR    N  +G + G +PP++GWA+ +      S  +  ++F W  PHF +L+  
Sbjct: 266 YTS-MKRKHIINTWLGALVGMVPPLMGWAAASPLSHPGSWCLAGLLFAWQFPHFNTLSHN 324

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M              L Y++L   +    +        Y I    +   
Sbjct: 325 IRNEYKNAGYVMTAWKN-PLLNARVSLRYSILMFPLCFGLSYFNITDWYYQIDSGLINAW 383

Query: 248 FTLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDH 289
            T WA++ +  +                          +K F+ S+ +L  +  + ++  
Sbjct: 384 LTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIYARKTFMASVLHLPAILILAIIHK 443

Query: 290 LIDMKTV 296
                 +
Sbjct: 444 KGRWDWI 450


>gi|307545100|ref|YP_003897579.1| protoheme IX farnesyltransferase [Halomonas elongata DSM 2581]
 gi|307217124|emb|CBV42394.1| protoheme IX farnesyltransferase [Halomonas elongata DSM 2581]
          Length = 301

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 100/283 (35%), Positives = 160/283 (56%), Gaps = 3/283 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
               + L KPRV+++ +  + VG++LA       K V+ +  I + A  + A N   D  
Sbjct: 16  WRDLVTLGKPRVVAVMLVCSLVGMLLARPVPPFDKLVLGLVGIGLAASGAAAFNHVVDRR 75

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           +D MM RTASRP+   ++S   A      L+V  I ++ + +N ++A L F S+  Y +I
Sbjct: 76  LDAMMLRTASRPLATRRLSIPLALGWASLLSVMGIGLLYVGVNALTAWLTFGSLIGYALI 135

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT +LKR TPQNIVIGG+AGA PP++GW SV+  +    L++ LI+F WTPPHFW+LA+ 
Sbjct: 136 YTAFLKRATPQNIVIGGVAGAAPPLLGWTSVSDQLGPEPLLLVLIVFAWTPPHFWALAIH 195

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y++A +PMLP    +  T++ + +Y  LT  V +LP ++G +   Y   V  L   
Sbjct: 196 KREEYERAEVPMLPVTHGEAFTRLQVWLYGWLTVAVTLLPFVIGMSGWLYLAGVTALNVR 255

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
           F  W  + +     +D +     F  SI Y+  +F +L++D  
Sbjct: 256 FMWWNGKVW---RGRDPKAPLAAFWFSIRYILGVFVVLLLDSY 295


>gi|88608368|ref|YP_506502.1| protoheme IX farnesyltransferase [Neorickettsia sennetsu str.
           Miyayama]
 gi|123491715|sp|Q2GDE4|COXX_NEOSM RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|88600537|gb|ABD46005.1| protoheme IX farnesyltransferase [Neorickettsia sennetsu str.
           Miyayama]
          Length = 302

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 144/287 (50%), Positives = 190/287 (66%), Gaps = 8/287 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYY 64
           +  +  LLKPRV+SL  +TA  G VLA     H        +IF IA+G+GA+GALNMYY
Sbjct: 13  VRAYFALLKPRVVSLVTFTAVTGAVLAYFSGYHAPFFSVFTAIFCIAVGSGAAGALNMYY 72

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           D DID +M+RT+ RPIP G+ISP  A V G+ L   S+++M LA+N +SA LL +++F Y
Sbjct: 73  DRDIDAIMSRTSKRPIPQGKISPEAALVFGLVLFALSVLLMELAVNHLSAVLLSVAVFYY 132

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT++LKR TPQNIV+GG AGA PPMIGWA+V   + + SLV+FLIIFLWTPPHFW+L
Sbjct: 133 SVIYTVYLKRRTPQNIVVGGGAGAFPPMIGWAAVANHIGVESLVLFLIIFLWTPPHFWAL 192

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL    +Y+ A IPMLP     + TKM IL Y+VL  I  +LP +L F+  TY I+ F L
Sbjct: 193 ALKNSGEYEAAGIPMLPVTSGVKATKMQILCYSVLLFITSILPYLLRFSGGTYMIVAFIL 252

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           G  F  +A   +L     D +   KLF  S+ YLF+LF + ++D  +
Sbjct: 253 GLVFLYYAINVYL-----DEKKCMKLFYYSVLYLFLLFGVFILDAAL 294


>gi|108757480|ref|YP_633469.1| protoheme IX farnesyltransferase [Myxococcus xanthus DK 1622]
 gi|122387999|sp|Q1D1K4|COXX_MYXXD RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|108461360|gb|ABF86545.1| protoheme IX farnesyltransferase [Myxococcus xanthus DK 1622]
          Length = 294

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 93/282 (32%), Positives = 154/282 (54%), Gaps = 3/282 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
           +  I L KPR+ SL + TA  G+ LAPGH+  + +++++ A A   GA+ ALN Y++   
Sbjct: 13  SDLISLTKPRLSSLVLVTAAGGMWLAPGHMGAVNALVTLLATAGTVGAANALNCYWERHS 72

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D+ M RT +RP+P G++ P  A   G+SLA  S+  + L  N ++A L  +++  YV+ Y
Sbjct: 73  DQFMDRTRNRPLPSGRMEPAVALWFGISLAAVSLPALALGANVLTAALGLVALLSYVLAY 132

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T  LK  T   +++GG+ GA+PP++GW +VT  + +    +F I+FLW  PHF ++AL  
Sbjct: 133 TP-LKARTSAAMLVGGVPGALPPLMGWTAVTNQMDVGGFSLFAIMFLWQMPHFIAIALFR 191

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           K++Y+ A +  +P    D +++  +++Y V    + +LP  L  A   Y      LG  F
Sbjct: 192 KEEYRAAGLTSVPLERGDESSRAQVVLYLVALIPMTLLPFQLHIAGAWYLAAAVLLGLSF 251

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
                  F  +        ++ F  S+ YL  LF  L +D +
Sbjct: 252 LGLGAWGFFRRLGNT--WARQTFFFSLIYLTGLFAALALDRV 291


>gi|90426260|ref|YP_534630.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|122474877|sp|Q20X25|COXX_RHOPB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|90108274|gb|ABD90311.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 313

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 133/271 (49%), Positives = 178/271 (65%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL I+TA VG++LAPG+I  + +  SI  IA+GAGASGALNM+Y+ D
Sbjct: 21  VADYIALLKPRVMSLVIFTALVGLLLAPGYIHPVLAFTSILCIAVGAGASGALNMWYEDD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RPIP G++S  EA   G+ L+  S+V +G+ +NW +A LL  +IF YVVI
Sbjct: 81  IDAKMTRTANRPIPRGRVSKPEALTFGLVLSFFSVVTLGILVNWFAAALLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR+T QNIVIGG AGA+PP++ WA+  G +S+  +++F IIF WTPPHFW+LAL 
Sbjct: 141 YTIWLKRWTAQNIVIGGAAGALPPVVAWAAAAGSLSVEPMLLFAIIFFWTPPHFWALALF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY  A +PMLP       T++ IL+YT++   V   P  LG+    YGI    LG  
Sbjct: 201 RAGDYANAGVPMLPVTAGPDATRLSILLYTIVLVAVAFAPWPLGYFDAIYGITSLALGGW 260

Query: 248 FTLWAWRTFLCK-EDKDIRVTKKLFLESITY 277
             L   R +  +     +R ++ LF  SI Y
Sbjct: 261 MLLLTLRVYRLRHGSAALRASRSLFKFSILY 291


>gi|254584306|ref|XP_002497721.1| ZYRO0F11990p [Zygosaccharomyces rouxii]
 gi|238940614|emb|CAR28788.1| ZYRO0F11990p [Zygosaccharomyces rouxii]
          Length = 435

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 66/306 (21%), Positives = 124/306 (40%), Gaps = 20/306 (6%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
           N +I L KPR+  L + +A     ++P   SV + +       + + ++ A+NM  + + 
Sbjct: 122 NPYIQLTKPRLTVLVMLSAICSYAISPYAASVSQLLSLTVGTTLCSASANAINMGREPEF 181

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D+ M RT +RP+  G  +P +A+            ++   +N   A L   +I  Y  IY
Sbjct: 182 DRQMVRTQARPVVRGLTTPAQAYKFAAVCGTVGGSVLWAGVNPTVALLGISNIALYAWIY 241

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T  LKR    N   G + GAIPP++GWA+ +      +  +  +++ W  PHF +L+   
Sbjct: 242 TS-LKRKHIINTWAGALVGAIPPLMGWAAASPLTDPGAWCIAGLLYAWQFPHFNTLSHNI 300

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           +++Y+ A   M              L Y++L   +    +  G     Y +    +    
Sbjct: 301 RNEYRNAGYVMTAWKN-PLLNARVALRYSLLMFPICFGFSYFGVTDWMYQLDSSIINAWM 359

Query: 249 TLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDHL 290
           + WA R +  ++                         KK FL S+ +L  +  + ++   
Sbjct: 360 SYWALRFYWQQKKNYSSRDFSDKAKYNKGLAIANGFAKKTFLVSVLHLPAVLILAILHKK 419

Query: 291 IDMKTV 296
                +
Sbjct: 420 GRWDWI 425


>gi|227549231|ref|ZP_03979280.1| protoheme IX farnesyltransferase [Corynebacterium lipophiloflavum
           DSM 44291]
 gi|227078685|gb|EEI16648.1| protoheme IX farnesyltransferase [Corynebacterium lipophiloflavum
           DSM 44291]
          Length = 321

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 101/306 (33%), Positives = 163/306 (53%), Gaps = 11/306 (3%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           +  +  +  L KPRV+ L +  A   ++ A  G + +   + ++    MGA A+   NM 
Sbjct: 18  LETIKAYFALTKPRVIELLLVAAIPAMLQANRGSVDLWLILGTLLGGWMGAAAANTFNMV 77

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAIN-WVSATLLFMSIF 122
            D DID+ M RT +RP+    ++   A +   +L   S++ +G   + W++A  + ++ +
Sbjct: 78  ADYDIDQKMGRTRARPLVRHTVTKRRATIYAWALLALSVLWLGFVCDSWLAAFFIVLTNW 137

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASV-------TGDVSIASLVMFLIIFL 175
            Y+ +YT WLKR T QN++ GG AG +P ++GWA+V       + D    ++V+F+IIF 
Sbjct: 138 FYIFVYTKWLKRRTWQNVIWGGAAGCMPVLVGWAAVRDNVDDGSPDRWWQAVVLFMIIFF 197

Query: 176 WTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASV 235
           WTPPH W+LA+  KDDY +A +PMLP V + + T   I+ Y+ LT    +L  ++  AS 
Sbjct: 198 WTPPHTWALAMKYKDDYARAKVPMLPVVASAQETTRQIVFYSWLTVATSLL--LVPAASW 255

Query: 236 TYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            Y ++    G  F + A R        D      LF+ S  YL VLF  L VD ++   T
Sbjct: 256 IYLVVAVASGVAFLVMATRLHNGVVRGDDVKPLALFILSNNYLAVLFLALSVDAVLGWNT 315

Query: 296 VERYFF 301
           + +Y F
Sbjct: 316 IGQYLF 321


>gi|6325085|ref|NP_015153.1| Cox10p [Saccharomyces cerevisiae S288c]
 gi|117135|sp|P21592|COX10_YEAST RecName: Full=Protoheme IX farnesyltransferase, mitochondrial;
           AltName: Full=Heme O synthase; Flags: Precursor
 gi|171265|gb|AAA34509.1| COX10 [Saccharomyces cerevisiae]
 gi|1370363|emb|CAA97879.1| COX10 [Saccharomyces cerevisiae]
 gi|207340665|gb|EDZ68947.1| YPL172Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|285815370|tpg|DAA11262.1| TPA: Cox10p [Saccharomyces cerevisiae S288c]
          Length = 462

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/307 (20%), Positives = 126/307 (41%), Gaps = 20/307 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   SV + +       + +G++ A+NM  + +
Sbjct: 146 IMPYLQLTKPRLTILVMLSAICSYALSPYPASVNELLCLTVGTTLCSGSANAINMGREPE 205

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +A+     +    + I+   +N   A L   +I  Y   
Sbjct: 206 FDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWA 265

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR    N  +G + G +PP++GWA+ +      S  +  ++F W  PHF +L+  
Sbjct: 266 YTS-MKRKHIINTWLGALVGMVPPLMGWAAASPLSHPGSWCLAGLLFAWQFPHFNTLSHN 324

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M              L Y++L   +    +        Y I    +   
Sbjct: 325 IRNEYKNAGYVMTAWKN-PLLNARVSLRYSILMFPLCFGLSYFNITDWYYQIDSGLINAW 383

Query: 248 FTLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDH 289
            T WA++ +  +                          +K F+ S+ +L  +  + ++  
Sbjct: 384 LTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIYARKTFMASVLHLPAILILAIIHK 443

Query: 290 LIDMKTV 296
                 +
Sbjct: 444 KGRWDWI 450


>gi|237785549|ref|YP_002906254.1| protoheme IX farnesyltransferase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758461|gb|ACR17711.1| protoheme IX farnesyltransferase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 305

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 94/305 (30%), Positives = 161/305 (52%), Gaps = 11/305 (3%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMY 63
           + ++  ++ L KPRV+ L +      ++ A  G I +   ++++    MGA A+ + NM 
Sbjct: 1   MEKIKAYVALTKPRVIELLLVATIPAMLQADRGTIHLWLILLTLVGGWMGAAAANSFNMI 60

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINW-VSATLLFMSIF 122
            D+DIDK+M RT +RP+  G+++  EA V   S+ V S + +    +  ++A  + ++I 
Sbjct: 61  VDSDIDKVMKRTQNRPLVDGRLTLTEAKVFASSMTVLSFLFLTFLCHSLLAAVFVMLTIL 120

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMF-------LIIFL 175
            Y+ IYT WLKR T QN++ GG AG +P ++GWA +  + S  S+  +       +IIF 
Sbjct: 121 FYIFIYTKWLKRRTWQNVIWGGAAGCMPVIVGWAVIADNTSNHSVAGWLQAVALFMIIFF 180

Query: 176 WTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASV 235
           WTPPH W+L +  ++DY+ A +PM+P V T       IL+YT LT++  +       +  
Sbjct: 181 WTPPHTWALGMRYEEDYRGAGVPMMPVVKTRAQVAKQILLYTWLTALTSLTLIFA--SGW 238

Query: 236 TYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKT 295
            Y +     G  F + A R +            +LF+ S  YL +LF  L +D +I+++ 
Sbjct: 239 FYTLTAIGAGAWFIISATRLYKRISTGKPVKPIRLFILSNNYLSLLFVGLSIDAVINLQP 298

Query: 296 VERYF 300
           +    
Sbjct: 299 LHEVL 303


>gi|157803916|ref|YP_001492465.1| protoheme IX farnesyltransferase [Rickettsia canadensis str.
           McKiel]
 gi|182639232|sp|A8EZ97|COXX_RICCK RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|157785179|gb|ABV73680.1| protoheme IX farnesyltransferase [Rickettsia canadensis str.
           McKiel]
          Length = 307

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 119/267 (44%), Positives = 175/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL I+T FVG++LAP  +    + I++  IA GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMSLVIFTCFVGMLLAPYSVHPFIASIAVVCIAFGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I P EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPIVRGAIEPDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLII +WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLQSVILFLIILIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C +DY+   +PM+P +      K  ILIY+ L  IV ++P  +G ++  Y II   LG  
Sbjct: 200 CNEDYKNCKVPMMPTIKGALYAKKQILIYSFLLFIVSLMPFFIGMSNFIYLIISGILGLV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  +A   F   +  D +  K+LF+ S
Sbjct: 260 FLYYAGSLF--YDTPDNKQAKRLFVYS 284


>gi|253575268|ref|ZP_04852606.1| protoheme IX farnesyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251845265|gb|EES73275.1| protoheme IX farnesyltransferase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 312

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 80/282 (28%), Positives = 152/282 (53%), Gaps = 3/282 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
              FI L KP ++   +  AF G  +A    +  ++ ++ +    +   +S   N Y+D 
Sbjct: 29  WRDFIALTKPGILRSNLIAAFAGFWVASRWELDYIQLIVMLLGTTLVMASSCVFNNYFDR 88

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           ++D  MART +R +P G+++P       V L V  + ++ +    ++     + +F YVV
Sbjct: 89  EMDTKMARTKNRVLPTGKLAPKTVLWYAVILGVLGLSVLFIFSGLLAGLFGAVGMFVYVV 148

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR +  +  +G I+GA+PP+IG+ + +G + + + ++F ++FLW PPHFW+L +
Sbjct: 149 VYTLWLKRSSTWSTSVGAISGAMPPVIGYVAASGRIDLGTWMLFALLFLWQPPHFWALGI 208

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
              ++Y+ A  P+LP V     TK+ ++ Y  L   + +L    G+  V + II   L  
Sbjct: 209 RRTEEYRAAGFPLLPVVKGIPRTKLQMIPYLALLIPIPILMYAYGYTGVWFLIIGCLLSV 268

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVD 288
            + L A + F  K++      K++F+ S+ YL +   ++++D
Sbjct: 269 AWLLMALQGFRAKDND--AWAKRVFIFSVNYLTIALIVMILD 308


>gi|91794871|ref|YP_564522.1| protoheme IX farnesyltransferase [Shewanella denitrificans OS217]
 gi|123060540|sp|Q12IC7|CYOE_SHEDO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|91716873|gb|ABE56799.1| protoheme IX farnesyltransferase [Shewanella denitrificans OS217]
          Length = 301

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 116/292 (39%), Positives = 175/292 (59%), Gaps = 5/292 (1%)

Query: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGA 59
           M F +     +  + KP+V++L + T  VG+ LA PG + +   V  +  IAM AG++ A
Sbjct: 12  MSFSLS-WRDYFEMTKPKVVALMLLTVLVGMCLALPGAVPLQPLVFGMLGIAMMAGSAAA 70

Query: 60  LNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFM 119
            N   D  ID +MART +RP+P G++S  +A+    SL V   V++   +N ++A L F 
Sbjct: 71  FNHLIDRRIDGLMARTYNRPLPKGKLSVNKAFSFAFSLGVLGFVLLYWWVNPLTAWLTFA 130

Query: 120 SIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPP 179
           S+  Y V+YT +LKR TPQNIVIGG+AGA+PP++GW +VT ++   +L++ +IIF WTPP
Sbjct: 131 SLIGYAVVYTAYLKRATPQNIVIGGLAGAMPPLLGWTAVTNELHGNALLLVIIIFTWTPP 190

Query: 180 HFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGI 239
           HFW+LA+  K +Y K  IPMLP       TK  IL+YT L ++  +LP ++G +   Y +
Sbjct: 191 HFWALAIHRKAEYAKVDIPMLPVTHGVEFTKTCILLYTFLLALACLLPVLVGMSGPVYLV 250

Query: 240 IVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
               L   F   AW+    K   +  +  K+F  SI +L +LF +L+VDH +
Sbjct: 251 GSSILSCGFIYKAWQL---KYQDEPGLAMKVFKFSIYHLMLLFVVLLVDHYL 299


>gi|147904565|ref|NP_001091482.1| protoheme IX farnesyltransferase, mitochondrial [Bos taurus]
 gi|146186533|gb|AAI40518.1| COX10 protein [Bos taurus]
 gi|296476574|gb|DAA18689.1| heme A:farnesyltransferase [Bos taurus]
          Length = 443

 Score =  143 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 66/262 (25%), Positives = 123/262 (46%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + T   G  LAP        +++     + + A+ ++N +++   D  M
Sbjct: 159 RLSKIKLTALVVSTTSAGFALAPAPFDWSCFLLTFVGTGLASCAANSINQFFEVPFDSNM 218

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A       AV  + ++   +N ++  L   +IF Y   YT  L
Sbjct: 219 NRTKNRPLVRGQISPLLAVSFATCCAVPGVALLTWGVNPLTGALGLFNIFLYTCCYTP-L 277

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GAIPP++GW + TG +   + ++  I++ W  PHF +L+   ++DY
Sbjct: 278 KRVSIANTWVGAVVGAIPPVMGWTAATGSLDAGACLLGGILYSWQFPHFNALSWGLREDY 337

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    + V    L   + T+ +I   +  + +   
Sbjct: 338 SRGGYCMMSVT-HPALCRRVALRHCLALLAMCVAAPALDVTTWTFPVIALPINLYISYLG 396

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R +    D D + ++KLF  S
Sbjct: 397 FRFY---RDADRKSSRKLFFCS 415


>gi|157828342|ref|YP_001494584.1| protoheme IX farnesyltransferase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165933051|ref|YP_001649840.1| protoheme IX farnesyltransferase [Rickettsia rickettsii str. Iowa]
 gi|166218149|sp|A8GRQ1|COXX_RICRS RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|205693549|sp|B0BX58|COXX_RICRO RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|157800823|gb|ABV76076.1| protoheme IX farnesyltransferase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165908138|gb|ABY72434.1| protoheme IX farnesyltransferase [Rickettsia rickettsii str. Iowa]
          Length = 305

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 121/267 (45%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL I+T FVG+ LAP  +    + I++  IA+GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMSLVIFTGFVGMWLAPYSVHPFIAGIAVVCIALGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I   EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPIVRGVIESDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V     TK  ILIY++L  IV ++P  +G  +  Y II   LG  
Sbjct: 200 CNDDYKNCKVPMMPAVKGTVYTKKQILIYSILLFIVSLMPFFIGMNNFIYLIISGILGVV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  +A   F   +  D +  K+ F  S
Sbjct: 260 FLYYAGSLF--YDTPDNKQAKRFFAYS 284


>gi|58584564|ref|YP_198137.1| protoheme IX farnesyltransferase [Wolbachia endosymbiont strain TRS
           of Brugia malayi]
 gi|75497941|sp|Q5GSX9|COXX_WOLTR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|58418880|gb|AAW70895.1| Polyprenyltransferase (cytochrome oxidase assembly factor)
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 295

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 129/278 (46%), Positives = 181/278 (65%), Gaps = 3/278 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            F  LLKPR+M L ++TA  G+V APG I    ++IS+  IA+G+G++GA+NM+YD DID
Sbjct: 15  DFWRLLKPRIMYLVVFTAVAGMVAAPGSIHPFLALISLICIALGSGSAGAINMWYDRDID 74

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT +RPIP G++S   A   GV++ V S+ IM +A+N++SA LL + I  Y+ IYT
Sbjct: 75  LLMKRTKARPIPSGRVSAESALEFGVTIGVLSVFIMAIAVNYISAILLAIGILFYIFIYT 134

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           IWLKR TPQNIVIGG +GA PP+IGWA VT  VS    V+FLIIF+WTPPHFW+L+L   
Sbjct: 135 IWLKRRTPQNIVIGGASGAFPPVIGWAVVTDSVSWRGFVLFLIIFMWTPPHFWALSLNKS 194

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +DY+KAS+PM   V     T+ +IL+Y+VL  +  +LP +    +  Y  +  F G  F 
Sbjct: 195 EDYEKASVPMFNVVYGPEKTRKYILVYSVLLVLTSLLPALFLKRAPFYLGMAIFGGCIFI 254

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
             A      K+    +   ++F  SI+YLF LF  +++
Sbjct: 255 WHAVSIMKLKDHSSQK---RMFSYSISYLFFLFASIIL 289


>gi|319408220|emb|CBI81873.1| protoheme IX farnesyltransferase [Bartonella schoenbuchensis R1]
          Length = 310

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 145/284 (51%), Positives = 201/284 (70%), Gaps = 1/284 (0%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
               +I LLKPRVMSL ++TA VG++++P  ++ L  V++I  IA+G G +GALNM+YDA
Sbjct: 20  NFYDYITLLKPRVMSLVVFTALVGLMVSPVTVNPLHGVLAILCIAVGGGGAGALNMWYDA 79

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT +RPIP G+IS  +A+V G++L+V S+ +MG+ INW SA  L  +IF YVV
Sbjct: 80  DIDAVMKRTKNRPIPTGKISRKKAFVFGLALSVLSVTVMGVFINWFSAIFLAFTIFFYVV 139

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYTIWLKR TPQNIVIGG AGA PPMIGWA+ TG +SI S ++FLIIF+WTPPHFW+L+L
Sbjct: 140 IYTIWLKRVTPQNIVIGGAAGAFPPMIGWAAATGAISIESFLLFLIIFMWTPPHFWALSL 199

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DY  A IP++PNV  + +TK  IL+YTV+ ++  V P ++G A +TYGI    L  
Sbjct: 200 FSSIDYDAAGIPIMPNVRGEYSTKKQILVYTVIMALCAVGPYIIGLAGITYGICSAILSV 259

Query: 247 HFTLWAWRTFLCK-EDKDIRVTKKLFLESITYLFVLFTILMVDH 289
            F   ++R +     D+ I + KK+F  S+ YL  +F IL++++
Sbjct: 260 TFIYLSYRLWKADTRDETISMAKKVFFFSLFYLAAIFGILLIEN 303


>gi|149238129|ref|XP_001524941.1| protoheme IX farnesyltransferase, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146451538|gb|EDK45794.1| protoheme IX farnesyltransferase, mitochondrial precursor
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 499

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 67/309 (21%), Positives = 126/309 (40%), Gaps = 18/309 (5%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           L  ++ L KP +  L   +      ++P  +S+ +        A+ +GA+ A+NM  + +
Sbjct: 180 LGAYVKLTKPNLTVLVTLSCVCSYAISPLSVSIAELFFLASGTALCSGAANAINMGREPE 239

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            DK M RT  RP+  G I+P +A+     +      ++   +N V + L F +I  Y  I
Sbjct: 240 FDKQMPRTVGRPVVRGLITPNQAYSFAALVGSVGCTMLWFGVNPVVSMLGFFNIVLYAWI 299

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR +  N  +G I GAIPP++GWA+ +      +  +  +++ W  PHF +L+  
Sbjct: 300 YT-LMKRKSILNTWVGAIVGAIPPLMGWAASSSLAHPGAWCLAGLLYAWQFPHFNALSHG 358

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
               Y++A   M       +      L Y++L   +    +  G     +          
Sbjct: 359 IAQQYKQAGYVMTA-AENPKLNARVALRYSILMFPLCFGLSYFGVTDWVFPFDSALANGW 417

Query: 248 FTLWAWRTFLCKEDKDIR----------------VTKKLFLESITYLFVLFTILMVDHLI 291
              W+++ +  ++                       KKLF  S+ +L  +  + M+    
Sbjct: 418 LAYWSFKFWQQQQRNYSSGSKKGPTSEGLALAGTHAKKLFWCSVWHLPAVLILAMLHKKD 477

Query: 292 DMKTVERYF 300
               +  Y 
Sbjct: 478 QWNRLSDYI 486


>gi|91205655|ref|YP_538010.1| protoheme IX farnesyltransferase [Rickettsia bellii RML369-C]
 gi|122425524|sp|Q1RI93|COXX_RICBR RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           O synthase
 gi|91069199|gb|ABE04921.1| Protoheme IX farnesyltransferase [Rickettsia bellii RML369-C]
          Length = 300

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 124/272 (45%), Positives = 179/272 (65%), Gaps = 2/272 (0%)

Query: 3   FQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNM 62
           +    +  +I+L+KPRVMSL ++T F G+ LAP  +    SVI++  IA+GAG++GA+NM
Sbjct: 15  YPQSTVKDYILLMKPRVMSLVVFTGFSGMWLAPNSLHPFISVIALICIAIGAGSAGAINM 74

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           +YD DID +M RT  RPI  G I   EA   G+ +A  S+  M L +N++SA LL  +IF
Sbjct: 75  WYDRDIDALMKRTQKRPIVRGAIEADEALSFGLIMAFFSVFFMALCVNFLSALLLLFTIF 134

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y+ IYT+WLKR + QNIVIGG AGA+PP+IG+ASV+G VS+ S+++FLIIF+WTPPH W
Sbjct: 135 YYICIYTMWLKRSSIQNIVIGGAAGALPPVIGYASVSGSVSLDSVILFLIIFIWTPPHSW 194

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LAL C DDY+   +PM+P +     TK  ILIY+VL  +  + P  +G +++ Y +I  
Sbjct: 195 ALALFCNDDYKNCKVPMMPVIKGALYTKKQILIYSVLLFLTSLKPFFVGMSNIIYLVIAA 254

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLES 274
            LG  F  ++   F   ++ D +  K+ F  S
Sbjct: 255 VLGLVFLYYSISLF--YDNADNKQAKRFFAYS 284


>gi|56477833|ref|YP_159422.1| protoheme IX farnesyltransferase [Aromatoleum aromaticum EbN1]
 gi|81357201|sp|Q5P2E3|COXX_AZOSE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|56313876|emb|CAI08521.1| Prenyltransferase, probably involved in heme a synthesis
           [Aromatoleum aromaticum EbN1]
          Length = 304

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 115/289 (39%), Positives = 168/289 (58%), Gaps = 5/289 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA--PGHISVLKSVISIFAIAMGAGASGALNMYY 64
           RL+ F VL KPRV +L ++ A +G+ LA   G       V +   IA  AGA+ A+N   
Sbjct: 19  RLHAFYVLTKPRVNTLIVFCAVIGMFLAVPDGLPDPKSVVAATLGIAFVAGAAAAMNCLI 78

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +A ID  MART  RP+P G+++P E  +    L  + + ++   +N ++  L   +   Y
Sbjct: 79  EAHIDARMARTRHRPLPRGELAPAETLLFAGVLGGTGLTVLYHWVNPLTMWLTLATFVGY 138

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LK  TPQNIVIGG +GA+PP++GWA+VTG+VS  +L++FLIIF WTPPHFW+L
Sbjct: 139 AVVYTVLLKPRTPQNIVIGGASGAMPPVLGWAAVTGEVSADALLLFLIIFAWTPPHFWAL 198

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL    DY +A +PMLP       T++ +L+YT +   V +LP     +   Y +    L
Sbjct: 199 ALYRSADYARAGLPMLPVTHGPEFTRLSVLLYTCILFGVTLLPFATRMSGPLYLVCAVAL 258

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDM 293
           G  F   AWR +    D      ++ F  SI YLF+LF  L++DH + +
Sbjct: 259 GIGFLRHAWRLY---ADYSDAFARRTFRFSILYLFLLFAALLMDHYLPL 304


>gi|299117072|emb|CBN73843.1| COX10 homolog, cytochrome c oxidase assembly protein [Ectocarpus
           siliculosus]
          Length = 412

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 67/280 (23%), Positives = 121/280 (43%), Gaps = 6/280 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  L K R+ +L + T   G + A G +  L    +     + + ++   N   +   
Sbjct: 57  KLYSQLSKHRLSALVMSTTSAGYLAAGGPVDALALTSACVGTMLASSSANTFNQVIETAN 116

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M RT +RP+P G+IS   A   GV+   + I ++    N ++ATL   ++  YV  Y
Sbjct: 117 DARMHRTRARPLPSGRISRQHALGWGVASGTAGITVLAAGSNPLTATLGAANLLLYVGPY 176

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFL-WTPPHFWSLALL 187
           T   K  +  N  +G + GA+PP++GWA+ TG++     ++       W  PHF+SLA L
Sbjct: 177 T-LSKTRSEINTWVGSVVGAVPPLMGWAAATGELVAVEPLLLATYLFMWQFPHFFSLAWL 235

Query: 188 CKDDYQKASIPMLPNVVT-DRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
            ++DY +    M+P        T   +  Y+     + +    L   S  + +       
Sbjct: 236 HREDYARGGFAMVPCADPTGSRTASLVTRYSWYLVPIPLAAAALDATSWMFAVEGTAFNA 295

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILM 286
           +    A+R      DK     + +F  S+ +L  +  + +
Sbjct: 296 YLLYHAYRF---DGDKSNANARGVFKASLWHLPAVLALFV 332


>gi|15892392|ref|NP_360106.1| protoheme IX farnesyltransferase [Rickettsia conorii str. Malish 7]
 gi|229586610|ref|YP_002845111.1| protoheme IX farnesyltransferase [Rickettsia africae ESF-5]
 gi|20137868|sp|Q92IF1|COXX_RICCN RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|259586157|sp|C3PN58|COXX_RICAE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|15619542|gb|AAL03007.1| cytochrome c oxidase assembly factor [Rickettsia conorii str.
           Malish 7]
 gi|228021660|gb|ACP53368.1| Protoheme IX farnesyltransferase [Rickettsia africae ESF-5]
          Length = 305

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 121/267 (45%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL I+T FVG+ LAP  +    + I++  IA+GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMSLVIFTGFVGMWLAPYSVHPFIAGIAVVCIALGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I   EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPIVRGVIESDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V     TK  ILIY++L  IV ++P  +G  +  Y II   LG  
Sbjct: 200 CNDDYKNCKVPMMPAVKGTLYTKKQILIYSILLFIVSLMPFFIGMNNFIYLIISGILGVV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  +A   F   +  D +  K+ F  S
Sbjct: 260 FLYYAGSLF--YDTPDNKQAKRFFAYS 284


>gi|88811917|ref|ZP_01127170.1| protoheme IX farnesyltransferase [Nitrococcus mobilis Nb-231]
 gi|88790801|gb|EAR21915.1| protoheme IX farnesyltransferase [Nitrococcus mobilis Nb-231]
          Length = 310

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 116/286 (40%), Positives = 165/286 (57%), Gaps = 4/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KP V++L  +TA VG+++A PG +      +    IA+ AG++ A+N   D 
Sbjct: 21  WRDYYELCKPGVVALMAFTAIVGMLVASPGEVPWRALTLGSLGIALAAGSAAAINHMVDQ 80

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  M RT  RP+P  +I    A V    L VS + I+ L IN ++A L F+S+  Y  
Sbjct: 81  RIDGQMWRTKRRPLPTARIRTPHAVVFASLLGVSGLGILYLFINPLTAFLTFLSLIGYAF 140

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG AGA PPM+GW +VTG +   SL++FLIIF+WTPPHFW+LA+
Sbjct: 141 IYTLYLKRATPQNIVIGGAAGAAPPMLGWTAVTGSIDPNSLLLFLIIFVWTPPHFWALAI 200

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY K +IPMLP    DR T+ ++L YT+L   V  LP + G + + Y      +G 
Sbjct: 201 HRREDYAKVNIPMLPVTHGDRYTRWNVLFYTILLVAVSALPFVTGLSGLIYLTGAMIMGG 260

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            +  +     +     D  +  K F  SI YL  +F IL+ D  + 
Sbjct: 261 IYLYYGVAMLVS---SDKSLPMKSFGFSIIYLMAIFAILLFDRYLP 303


>gi|255325021|ref|ZP_05366127.1| protoheme IX farnesyltransferase [Corynebacterium
           tuberculostearicum SK141]
 gi|311739481|ref|ZP_07713316.1| protoheme IX farnesyltransferase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|255297586|gb|EET76897.1| protoheme IX farnesyltransferase [Corynebacterium
           tuberculostearicum SK141]
 gi|311305297|gb|EFQ81365.1| protoheme IX farnesyltransferase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 314

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 99/309 (32%), Positives = 158/309 (51%), Gaps = 15/309 (4%)

Query: 5   VFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHI-----SVLKSVISIFAIAMGAGASGA 59
           +  +  +  L KPR++ L +  A   ++ A   +     ++   V +IF   MGA A+  
Sbjct: 1   METIKAYFALTKPRIIELLLVAAIPAMLQAQRGVEAVSDNIWLIVSTIFGGWMGAAAAHT 60

Query: 60  LNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLA-INWVSATLLF 118
            N   D ++D+ M RT +RP+   +IS   A +    + + S++ +G+   +W++A  + 
Sbjct: 61  FNNVVDYELDQKMQRTRARPLVRAKISKRNAAIFAWIMLIISVLWLGVLAHSWLAAFFVV 120

Query: 119 MSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGW-------ASVTGDVSIASLVMFL 171
           ++ F YV +YT +LK    QNIV GG+AG +P M+GW        +   D    ++V+FL
Sbjct: 121 LTNFFYVFVYTKFLKMRNAQNIVWGGLAGCMPAMVGWAVIRDNAPAGEPDRWWQAIVLFL 180

Query: 172 IIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLG 231
           IIF WTPPH W+LA+  K+DY+KA +PMLP V  ++     I+ YTV T IV +L     
Sbjct: 181 IIFFWTPPHTWALAMKYKEDYRKAGVPMLPVVADEKEVTRQIVWYTVGTVIVTLLIVPA- 239

Query: 232 FASVTYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            AS  Y       G  F   A R     ++       +LF+ S  YL VLF  L +D ++
Sbjct: 240 -ASWIYLAAALASGAVFLWMAIRLHKGVKNGAKVKPMRLFIYSNNYLSVLFIGLSIDAVL 298

Query: 292 DMKTVERYF 300
             + + R  
Sbjct: 299 GWEPLGRML 307


>gi|182639242|sp|A8F1B6|COXX_RICM5 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 305

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRV+SL I+T FVG+ LAP  +    + I++  IA+GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVISLVIFTGFVGMWLAPYSVHPFIAGIAVVCIALGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I   EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPIVRGVIESDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V     TK  ILIY++L  IV ++P  +G  +  Y II   LG  
Sbjct: 200 CNDDYKNCKVPMMPAVKGTLYTKKQILIYSILLFIVSLMPFFIGMNNFIYLIIAGILGVV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  +A   F   +  D +  K+ F  S
Sbjct: 260 FLYYAGSLF--YDTSDNKQAKRFFAYS 284


>gi|313201019|ref|YP_004039677.1| protoheme ix farnesyltransferase [Methylovorus sp. MP688]
 gi|312440335|gb|ADQ84441.1| protoheme IX farnesyltransferase [Methylovorus sp. MP688]
          Length = 301

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 170/288 (59%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  F ++ KPRV +L ++TA +G+ +A P    +   + +   IAM +GA+ A N   + 
Sbjct: 16  LRSFFMMCKPRVSALIVFTAMIGMFMATPHLPPLDILIAATLGIAMTSGAAAAFNCIIEQ 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART  RP+P GQ+S  +  VL   L  + + ++   +N ++  L F ++  Y V
Sbjct: 76  KIDARMARTRHRPLPTGQVSTRQTLVLATLLGFAGLSLLYAMVNPLTMWLTFGTLLGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LK  TP NIVIGG +GA+PP++GWA++   VS  +L+MFLIIF WTPPHFW+LAL
Sbjct: 136 IYTVFLKPATPLNIVIGGASGAMPPILGWAAINNVVSHEALIMFLIIFAWTPPHFWALAL 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +++Y K  IPMLP     + T +HI++YT++   +  +P  +G + + Y I    L  
Sbjct: 196 YRREEYAKVGIPMLPVTHGVQFTLLHIVLYTIILVTITFIPYSMGMSHLIYLISALVLNL 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
            F ++    +    D    + K+ F  SITYL +LF  LM+DH   ++
Sbjct: 256 VFMVYVVALY---ADYSDALAKRTFRYSITYLTLLFAALMLDHYWMLE 300


>gi|254491347|ref|ZP_05104527.1| protoheme IX farnesyltransferase [Methylophaga thiooxidans DMS010]
 gi|224463476|gb|EEF79745.1| protoheme IX farnesyltransferase [Methylophaga thiooxydans DMS010]
          Length = 298

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 102/270 (37%), Positives = 158/270 (58%), Gaps = 4/270 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
               ++ L KP+V+ L + TA VG  +A PG  ++ + +I++  I   A +   +N   D
Sbjct: 14  NWKDYLALCKPKVVLLMLITALVGAFIATPGWPNIGQLLIAVIGIGACAASGATINNMID 73

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             +D  MART  R    G +SP +A    ++LAVS ++++   +N ++A L   ++  Y 
Sbjct: 74  HQLDAKMARTRHRATASGIVSPVQALAFALALAVSGMLLLWFLVNPLTAWLTLFALIGYA 133

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT++LKR TPQNI IGG+AGA+PP++GW +VTG V   +L++ LIIF WTPPHFW+LA
Sbjct: 134 VIYTLFLKRATPQNITIGGLAGAMPPLLGWTAVTGQVDPNALLLVLIIFAWTPPHFWALA 193

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L  KD+Y KA +PMLP    D  T++ I +Y++L     +LP + G + + Y   +  L 
Sbjct: 194 LHKKDEYAKADVPMLPVTHGDAFTRIQIALYSLLLLGCTLLPFVTGMSGLIYLTGILILN 253

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESI 275
                  W+ F   + K+ +   +LF  SI
Sbjct: 254 SRQFYLLWQLF---DKKNTQAPYRLFKFSI 280


>gi|19552785|ref|NP_600787.1| protoheme IX farnesyltransferase [Corynebacterium glutamicum ATCC
           13032]
 gi|62390455|ref|YP_225857.1| protoheme IX farnesyltransferase [Corynebacterium glutamicum ATCC
           13032]
 gi|145295696|ref|YP_001138517.1| protoheme IX farnesyltransferase [Corynebacterium glutamicum R]
 gi|81760677|sp|Q8NQ66|COXX_CORGL RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|182639205|sp|A4QEE9|COXX_CORGB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|21324341|dbj|BAB98966.1| Polyprenyltransferase (cytochrome oxidase assembly factor)
           [Corynebacterium glutamicum ATCC 13032]
 gi|41325792|emb|CAF21581.1| Polyprenyltransferase (cytochrome oxidase assembly factor)
           [Corynebacterium glutamicum ATCC 13032]
 gi|140845616|dbj|BAF54615.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 323

 Score =  142 bits (357), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 158/302 (52%), Gaps = 11/302 (3%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           +  +I L KPRV+ L +      ++ A  G  +++  ++++F   MGA A+   NM  D+
Sbjct: 17  IKAYIALTKPRVIELLLVATIPTMLQAERGENNIVLILLTVFGGWMGAAAANTFNMVADS 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAIN-WVSATLLFMSIFCYV 125
           DID+ M RT +RP+    +S  +A +    L V+S + + L  +  ++   + ++IF Y+
Sbjct: 77  DIDQRMGRTRARPLVRHTVSNRDASIFAWVLTVASFLWLWLLCDSMLAGIFVLITIFFYI 136

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV-------SIASLVMFLIIFLWTP 178
            +YT WLKR T  NIV GG AG +P ++GWA +              ++V+F++IF WTP
Sbjct: 137 FVYTKWLKRRTHMNIVWGGAAGCMPVLVGWAVIVDQFEPGVPQQWWQAIVLFMVIFFWTP 196

Query: 179 PHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYG 238
           PH W+LA+  ++DY+ A +PMLP V T       I+ Y+V T +   L  ++      Y 
Sbjct: 197 PHTWALAMKYREDYKAAGVPMLPVVRTPVQVTAQIVWYSVATVLTTFL--LIPATGWIYA 254

Query: 239 IIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVER 298
            I    G  F   A +  L  ++       KLF+ S  YL VLF  L VD ++ ++T+  
Sbjct: 255 AIAVISGVTFLFMAIKLHLGIKNGGKVKPLKLFILSNNYLAVLFVALSVDAVLGLETIGE 314

Query: 299 YF 300
             
Sbjct: 315 ML 316


>gi|94984516|ref|YP_603880.1| protoheme IX farnesyltransferase [Deinococcus geothermalis DSM
           11300]
 gi|94554797|gb|ABF44711.1| Cytochrome c oxidase assembly factor, CtaB [Deinococcus
           geothermalis DSM 11300]
          Length = 312

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 108/288 (37%), Positives = 162/288 (56%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+SL ++T    + +A  G   +   V+   A  M AG++G  NM  D 
Sbjct: 23  WRDYLALTKPKVISLLLWTTLTAMFMAARGWPGLGLLVVVSLAGYMSAGSAGVFNMIIDR 82

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RTA+RP   G IS  +A + G +L V S  ++ +    ++A +       YVV
Sbjct: 83  DIDLRMKRTATRPTSSGLISTRDAAIFGGALQVLSFGMLWVWATPLAAWMSLAGFLTYVV 142

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR T  NIV+GG AG  PP++GWA+VTGD+++ +  +F IIF WTP HFW+LAL
Sbjct: 143 VYTLWLKRNTWHNIVLGGAAGCFPPLVGWAAVTGDLNLFAWFLFAIIFFWTPVHFWALAL 202

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + KD+Y++  IPMLP V  DR T   I +Y + T ++ V+P  LG     Y +    LG+
Sbjct: 203 MIKDEYREVGIPMLPVVHGDRLTVAQIGLYAIYTVVLSVMPVFLGEVGWLYFLSALVLGW 262

Query: 247 HFTLWAWRTFLCK---EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
                +W  +         + +V   L+L S+ YL +LF    VD ++
Sbjct: 263 LLLQRSWVLYRHVMAGNKVERKVAVPLYLYSMLYLALLFVAGAVDRVL 310


>gi|238893375|ref|YP_002918109.1| protoheme IX farnesyltransferase [Klebsiella pneumoniae NTUH-K2044]
 gi|238545691|dbj|BAH62042.1| protoheme IX farnesyltransferase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 310

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 80/286 (27%), Positives = 147/286 (51%), Gaps = 3/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ + KP ++   + +   G +LA  GHI     V ++  +++   +    N Y D 
Sbjct: 17  FKQYLQVTKPGIIFGNLISVIGGFLLASKGHIDYPLFVWTLLGVSLVVASGCVFNNYIDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT +R +  G ISP  + V    L ++  +++    N ++  L  M    YV 
Sbjct: 77  DIDRKMERTKNRVLVKGLISPEASLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVYVG 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++++KR +    +IG ++GA PP+IG+ +VTGD    + ++  I  LW  PH +++A+
Sbjct: 137 VYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAILLAIFSLWQMPHSYAIAI 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
               DYQ A+IP+LP V      K HI +Y V  ++  ++ ++ G+A   Y ++   +  
Sbjct: 197 FRFKDYQAANIPVLPVVKGISVAKNHITLYIVAFAVATLMLSLGGYAGYKYLVVAAAVSV 256

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            +   A R +   +DK     +KLF+ SI  +  L  ++ VD ++ 
Sbjct: 257 WWLGMALRGYKVADDK--VWARKLFVFSIVAITALSVMMSVDFMVP 300


>gi|297539454|ref|YP_003675223.1| protoheme IX farnesyltransferase [Methylotenera sp. 301]
 gi|297258801|gb|ADI30646.1| protoheme IX farnesyltransferase [Methylotenera sp. 301]
          Length = 313

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 163/286 (56%), Gaps = 6/286 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPG---HISVLKSVISIFAIAMGAGASGALNMYY 64
              F  L KPRV SL ++TA +G+ LA      +     + +   IA  +GA+ A N   
Sbjct: 28  FKSFFSLCKPRVTSLIVFTAIIGMYLAKPAELPMYWPLLIATTIGIAFASGAAAAFNCLI 87

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           +  ID +MART +R +P GQ+S  +  +    L  + + I+   +N ++  L F +   Y
Sbjct: 88  EHKIDAIMARTRARALPTGQVSSTQTTIFATILGSTGLAILYFYVNPLTMWLTFATFVGY 147

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            VIYT++LK  TP NIVIGG +GA+PP++GWA+V  +VS  SL+MFLIIF WTPPHFW+L
Sbjct: 148 AVIYTVFLKPATPMNIVIGGASGAMPPILGWAAVNNNVSPESLIMFLIIFAWTPPHFWAL 207

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           AL  +++Y K  +PMLP    +  T +HIL+YT++   V ++P  LG + + Y +    L
Sbjct: 208 ALYRREEYAKVGMPMLPVTHGEAFTLLHILLYTIILVAVSLMPYGLGMSGLFYLVSAIIL 267

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
              F  +    +    D    + K+ F  SI YL +LF  L++DH 
Sbjct: 268 NVIFMAYVIGLYRHYSDD---LAKRTFKYSIIYLTLLFAALLIDHY 310


>gi|294658821|ref|XP_461155.2| DEHA2F18634p [Debaryomyces hansenii CBS767]
 gi|218511985|sp|Q6BKW6|COX10_DEBHA RecName: Full=Protoheme IX farnesyltransferase, mitochondrial;
           AltName: Full=Heme O synthase; Flags: Precursor
 gi|202953411|emb|CAG89538.2| DEHA2F18634p [Debaryomyces hansenii]
          Length = 462

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 69/302 (22%), Positives = 127/302 (42%), Gaps = 15/302 (4%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KP +  L   ++     ++P  +S+ + +      A+ +GA+ A+NM  + +
Sbjct: 141 IQPYVKLTKPNLTILVTLSSICSYAISPYTVSLPELLFLTMGTALCSGAANAINMGREPE 200

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            DK M RT  RP+  G ISP +A+            ++ L +N   + L F++I  Y  I
Sbjct: 201 FDKKMPRTVGRPVVRGLISPKQAYQFAGITGSLGCTMLFLGVNPTVSFLGFLNIVLYSWI 260

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  LKR +  N  +G I GAIPP++GWA+ +      +  +  +++ W  PHF +L+  
Sbjct: 261 YTS-LKRKSIINTWVGAIVGAIPPLMGWAASSPLDHPGAWCLAGLLYAWQFPHFNALSHN 319

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             D Y+ A   M       +      L Y++L   +    +  G     +          
Sbjct: 320 IADQYKGAGYVMTA-AENPKLNARVALRYSLLMFPLCFGLSYFGITDWVFQFDSAIANSW 378

Query: 248 FTLWAWRTFLCKEDK-------------DIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
            T  A++ ++  +                    KKLF  S+ +L  +  + M+       
Sbjct: 379 LTYLAYKFWMQIKQNYTGQKPTANGIAMANIHAKKLFWGSVWHLPAVLILAMLHKKGQWD 438

Query: 295 TV 296
            +
Sbjct: 439 RL 440


>gi|260883272|ref|ZP_05894886.1| protoheme IX farnesyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260872800|gb|EEX79869.1| protoheme IX farnesyltransferase [Brucella abortus bv. 9 str. C68]
          Length = 285

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 143/277 (51%), Positives = 196/277 (70%), Gaps = 4/277 (1%)

Query: 15  LKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMMAR 74
           +KPRVMSL ++T  VG+VLAPGH++ + +VISI  IA+GAGA   LNM+YDADID +M R
Sbjct: 1   MKPRVMSLVVFTGLVGLVLAPGHMNPVLAVISILCIAVGAGA---LNMWYDADIDAVMKR 57

Query: 75  TASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWLKR 134
           T  RPIP G I+P +    G++L+  S++ +GL +NW++A LL  +IF Y VIYT+WLKR
Sbjct: 58  TRKRPIPAGIIAPNQVLAFGLTLSAFSVMTLGLMVNWLAAALLAFTIFFYAVIYTMWLKR 117

Query: 135 FTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDYQK 194
            TPQNIVIGG AGA PPMIGWA+ TG+++  SLV+F+IIFLWTPPHFW+L+L   +DY+ 
Sbjct: 118 STPQNIVIGGAAGAFPPMIGWAAATGEITWDSLVLFMIIFLWTPPHFWALSLFTTNDYEA 177

Query: 195 ASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWAWR 254
           A IPM+PNV  + +T+   L Y VL + VGVLP ++GFA + YG++   LG  F  +AWR
Sbjct: 178 ARIPMMPNVKGELSTRRQALFYAVLMAPVGVLPWVMGFAGMFYGVVSTLLGLAFVYYAWR 237

Query: 255 TFLCKEDKDI-RVTKKLFLESITYLFVLFTILMVDHL 290
            +       +    +KLF  S+ YL  +F +L+ + L
Sbjct: 238 LWAADSQPQMLAAARKLFRFSLLYLAGIFAVLLFEAL 274


>gi|258510913|ref|YP_003184347.1| protoheme IX farnesyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477639|gb|ACV57958.1| protoheme IX farnesyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 308

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 90/282 (31%), Positives = 153/282 (54%), Gaps = 2/282 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ ++K  +    +   F G+ +A G    +   ++++           ALN +YD 
Sbjct: 22  LRDYLSIMKWGITVANLMATFAGLWVASGGHPPLNIMLLTLIGTMFVVAGGAALNNFYDR 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  R +  G++SP  A  +G++++   + ++ + +NW SA   F+ +F Y  
Sbjct: 82  DIDQRMPRTKMRAVARGKVSPGAALGIGLAMSAIGLAVLLVGVNWQSAVCAFVGLFVYSY 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTG-DVSIASLVMFLIIFLWTPPHFWSLA 185
           +YT+W KR T  N V+GG++GA+PP+IGW + +G  +S+A+  +F   FLW PPHF  LA
Sbjct: 142 LYTVWFKRHTTLNTVLGGVSGAMPPLIGWVAGSGGTLSLAAWCLFFTFFLWQPPHFLPLA 201

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PMLP V   R TK  I+ YT     V ++ T+LG     Y +++  LG
Sbjct: 202 MKKTEDYRAAGVPMLPVVRGFRETKRQIVFYTAAMVPVSLMLTVLGAEGWLYFVVMGALG 261

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMV 287
             F   A +      +KD+    ++F  S+ YL  L  + ++
Sbjct: 262 LWFLYLAVKGLFIPPEKDMEWANQVFRFSLIYLTALCIVSVL 303


>gi|184200866|ref|YP_001855073.1| protoheme IX farnesyltransferase [Kocuria rhizophila DC2201]
 gi|183581096|dbj|BAG29567.1| putative protoheme IX farnesyltransferase [Kocuria rhizophila
           DC2201]
          Length = 304

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 97/293 (33%), Positives = 153/293 (52%), Gaps = 3/293 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +L  ++ L KPR++ L +      +  A  G  +    + ++    + AGA+GA N Y D
Sbjct: 12  KLKAYVALTKPRIIELLLVATVPTMFFAQQGVPNFWLVLNTLIGGTLAAGAAGAFNCYID 71

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            + D++M RTA RP+  G++   EA V   +L+  ++  + L ++ +   L  ++I  Y 
Sbjct: 72  RNEDRLMRRTAKRPLVTGEVGDREALVFAWALSAVAVAWLTLGVSVLCGVLGVVAIALYA 131

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           V Y+I LKR T QNIV GGIAG +P +IGWA+V G +   + V+F  IFLWTPPH+W L+
Sbjct: 132 VFYSIILKRRTAQNIVWGGIAGCMPVLIGWAAVRGTLEWPAFVLFAFIFLWTPPHYWPLS 191

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY +A +PML  V T RT    +++Y   T I  +L   +G A   YGII    G
Sbjct: 192 MKYAEDYSRAGVPMLGAVDTARTVGAQVVLYAWATVICSLLLIPVGGAGWVYGIIALLSG 251

Query: 246 YHFTLWAWRTFLCKED--KDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTV 296
             FT    +      D    ++    +F  SI Y+  +F  + +D  +     
Sbjct: 252 AWFTYHCHKLHGLARDGRPTLKQAMYVFHGSIAYITFVFVGVALDPFLGGPIF 304


>gi|67458942|ref|YP_246566.1| protoheme IX farnesyltransferase [Rickettsia felis URRWXCal2]
 gi|75536620|sp|Q4UM22|COXX_RICFE RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|67004475|gb|AAY61401.1| Protoheme IX farnesyltransferase [Rickettsia felis URRWXCal2]
          Length = 305

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 121/267 (45%), Positives = 175/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL I+T FVGI LAP  +    + I++  IA+GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMSLVIFTGFVGIWLAPYSVHPFIAGIAVVCIALGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I P EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPIVRGAIEPDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V  +  TK  ILIY++L  IV ++P  +G  +  Y I    LG  
Sbjct: 200 CNDDYKNCKVPMMPAVKGNLYTKKQILIYSILLFIVSLMPFFIGMNNFIYLITSGILGLV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  ++   F   +  D +  K+ F  S
Sbjct: 260 FLYYSGSLF--YDTPDNKQAKRFFAYS 284


>gi|114570782|ref|YP_757462.1| protoheme IX farnesyltransferase [Maricaulis maris MCS10]
 gi|122315478|sp|Q0AMG9|COXX_MARMM RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|114341244|gb|ABI66524.1| protoheme IX farnesyltransferase [Maricaulis maris MCS10]
          Length = 330

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 131/295 (44%), Positives = 182/295 (61%), Gaps = 14/295 (4%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             +  L+KPRVM+L ++TAF G++ AP       + +SI  +A+GAGA+GALNM YDADI
Sbjct: 23  RDYFDLMKPRVMTLVVFTAFAGLIAAPVDADPFLAFMSILCLAVGAGAAGALNMAYDADI 82

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M RT  RPIP G +S   A+  GV  ++ S+++M LA N+++A LL  SIF Y VIY
Sbjct: 83  DATMQRTRKRPIPRGVVSVSNAYGFGVVASILSVLLMALASNYLAAGLLAFSIFFYAVIY 142

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LKR TPQNIVIGG AGA PPMIGW + TG++S+ ++++F+IIFLWTPPH W+LAL  
Sbjct: 143 TMILKRSTPQNIVIGGAAGAFPPMIGWVAATGEISLDAVILFMIIFLWTPPHSWALALYK 202

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
             DY  A++PM+P     ++T++ IL+Y+++  I    P + G     YG      G  F
Sbjct: 203 SGDYAAANVPMMPVAKGAKSTRLQILLYSIVLVIFAGAPVLTGLGGAVYGATSLGGGALF 262

Query: 249 TLWAWRTFLCKEDK--------------DIRVTKKLFLESITYLFVLFTILMVDH 289
            L AWR F  +  +                +  + LF  SI YL VLF  L+V+H
Sbjct: 263 LLLAWRIFRSRAGEAGSAEEGALYAVRAGDKAARDLFAYSIGYLTVLFAALIVEH 317


>gi|254796971|ref|YP_003081808.1| protoheme IX farnesyltransferase [Neorickettsia risticii str.
           Illinois]
 gi|254590217|gb|ACT69579.1| protoheme IX farnesyltransferase [Neorickettsia risticii str.
           Illinois]
          Length = 290

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 147/286 (51%), Positives = 190/286 (66%), Gaps = 8/286 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYYD 65
             +  LLKPRV+SL  +TA  G VLA     H        +IF IA+G+GA+GALNMYYD
Sbjct: 2   RAYFALLKPRVVSLVTFTAVTGAVLAYFSGYHAPFFSVFTAIFCIAVGSGAAGALNMYYD 61

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
            DID +M+RT+ RPIP G+ISP  A V G+ L   S+++M LA+N +SA LL +++F Y 
Sbjct: 62  RDIDAIMSRTSKRPIPQGKISPEAALVFGLVLFALSVLLMELAVNHLSAVLLSVAVFYYS 121

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYTI LKR TPQNIV+GG AGA PPMIGWA+V   + + SLV+FLIIFLWTPPHFW+LA
Sbjct: 122 VIYTICLKRSTPQNIVVGGGAGAFPPMIGWAAVANHIGVESLVLFLIIFLWTPPHFWALA 181

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           L    +Y+ A IPMLP     + TKM IL Y+VL  I  +LP +L F+ VTY I+ F LG
Sbjct: 182 LKNSGEYEAAGIPMLPVTSGVKATKMQILCYSVLLFITSILPYLLRFSGVTYMIVAFILG 241

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           + F  +A   +L     D +   KLF  S+ YLF+LF  L++D  +
Sbjct: 242 FVFLYYAINVYL-----DEKKCMKLFYYSVLYLFLLFGTLILDAAL 282


>gi|320582761|gb|EFW96978.1| Heme A:farnesyltransferase [Pichia angusta DL-1]
          Length = 437

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 74/312 (23%), Positives = 135/312 (43%), Gaps = 24/312 (7%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
            ++ L KP++  L + ++     LAP   S+ + V       M +G++ A+NM  + + D
Sbjct: 125 PYLALTKPQLTFLIMLSSICSYALAPNSTSLSEFVCLTLGTLMASGSANAINMGREPEFD 184

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           ++M RT +RP+  G ++P EA++      +    I+   +N + A L   +I  Y  IYT
Sbjct: 185 RLMIRTQARPVVNGSVTPNEAFIFASMTGLLGCTILYYGVNPIVAALGLTNIVLYSWIYT 244

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
             LKR +  N  +G + GAIPP++GWA+ +      +  + L+++ W  PHF SL+   +
Sbjct: 245 S-LKRVSILNTWVGAVVGAIPPLMGWAACSSLSDPGAWCLALLLYAWQFPHFNSLSHNIR 303

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           D+Y++A   ++      +      L Y++L  ++             + +    L     
Sbjct: 304 DEYKRAGY-VMAAYENPKLNARVSLRYSILMFLICFGLCYYNVTDPLFMLDSSVLNGWMA 362

Query: 250 LWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDHLI 291
             ++R +  +     R                    KK F  SI  L V+  + M+    
Sbjct: 363 YMSFRFWWQQRLNYSRKVQESGGPSQKAIDLANYYAKKTFWSSIWQLPVVLVLAMLHK-- 420

Query: 292 DMKTVERYFFSS 303
             K     FF S
Sbjct: 421 --KGQWDRFFQS 430


>gi|34580605|ref|ZP_00142085.1| cytochrome c oxidase assembly factor [Rickettsia sibirica 246]
 gi|28261990|gb|EAA25494.1| cytochrome c oxidase assembly factor [Rickettsia sibirica 246]
          Length = 305

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 173/267 (64%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVM L I+T FVG+ LAP  +    + I++  IA+GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMLLVIFTGFVGMWLAPYSVHPFIAGIAVVCIALGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I   EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPIVRGVIESDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V     TK  ILIY++L  IV ++P  +G  +  Y II   LG  
Sbjct: 200 CNDDYKNCKVPMMPAVKGTLYTKKQILIYSILLFIVSLMPFFIGMNNFIYLIISGILGVV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  +A   F   +  D +  K+ F  S
Sbjct: 260 FLYYAGSLF--YDTPDNKQAKRFFAYS 284


>gi|157826888|ref|YP_001495952.1| protoheme IX farnesyltransferase [Rickettsia bellii OSU 85-389]
 gi|166218148|sp|A8GVN8|COXX_RICB8 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|157802192|gb|ABV78915.1| protoheme IX farnesyltransferase [Rickettsia bellii OSU 85-389]
          Length = 300

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 124/272 (45%), Positives = 180/272 (66%), Gaps = 2/272 (0%)

Query: 3   FQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNM 62
           +    +  +I+L+KPRVMSL ++T F G+ LAP  +    SVI++  IA+GAG++GA+NM
Sbjct: 15  YPQSTVKDYILLMKPRVMSLVVFTGFSGMWLAPNSLHPFISVIALICIAIGAGSAGAINM 74

Query: 63  YYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIF 122
           +YD DID +M RT  RPI  G I   EA   G+ +A  S+  M L +N++SA LL  +IF
Sbjct: 75  WYDRDIDALMKRTQKRPIVRGAIEADEALSFGLIMAFFSVFFMALCVNFLSALLLLFTIF 134

Query: 123 CYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFW 182
            Y+ IYT+WLKR + QNIVIGG AGA+PP+IG+ASV+G VS+ S+++FLIIF+WTPPH W
Sbjct: 135 YYICIYTMWLKRSSIQNIVIGGAAGALPPVIGYASVSGSVSLDSVILFLIIFIWTPPHSW 194

Query: 183 SLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVF 242
           +LAL C DDY+   +PM+P +     TK  ILIY+VL  +  ++P  +G +++ Y +I  
Sbjct: 195 ALALFCNDDYKNCKVPMMPVIKGALYTKKQILIYSVLLFLTSLMPFFVGMSNIIYLVIAA 254

Query: 243 FLGYHFTLWAWRTFLCKEDKDIRVTKKLFLES 274
            LG  F  ++   F   ++ D +  K+ F  S
Sbjct: 255 VLGLVFLYYSISLF--YDNADNKQAKRFFAYS 284


>gi|157825599|ref|YP_001493319.1| protoheme IX farnesyltransferase [Rickettsia akari str. Hartford]
 gi|166218147|sp|A8GN36|COXX_RICAH RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|157799557|gb|ABV74811.1| protoheme IX farnesyltransferase [Rickettsia akari str. Hartford]
          Length = 305

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 119/267 (44%), Positives = 176/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRVMSL ++T FVG+ LAP  +    +VI +  I++GAG++GA+NM+YD D
Sbjct: 20  VKDYILLMKPRVMSLVMFTGFVGMWLAPYSVHPFIAVIVLACISLGAGSAGAINMWYDRD 79

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RP+  G I P EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 80  IDSLMKRTQKRPLVRGAIEPDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 139

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 140 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 199

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V     TK  ILIY++L  +V ++P  +G  +  Y II   LG  
Sbjct: 200 CNDDYKNCKVPMMPTVKGILYTKEQILIYSILLFLVSLMPFFIGMNNFIYLIIAGMLGLV 259

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  ++   F   +  D +  K+LF  S
Sbjct: 260 FLYYSGSLF--YDTPDNKQAKRLFAYS 284


>gi|34496062|ref|NP_900277.1| protoheme IX farnesyltransferase [Chromobacterium violaceum ATCC
           12472]
 gi|81656895|sp|Q7P0G0|COXX1_CHRVO RecName: Full=Protoheme IX farnesyltransferase 1; AltName:
           Full=Heme B farnesyltransferase 1; AltName: Full=Heme O
           synthase 1
 gi|34101916|gb|AAQ58283.1| protoheme IX farnesyltransferase [Chromobacterium violaceum ATCC
           12472]
          Length = 299

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 103/286 (36%), Positives = 155/286 (54%), Gaps = 4/286 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
               L KPRV++L ++ A +G+ LA PG       V +   IA+ AGA+  +N   +  +
Sbjct: 15  ALWQLSKPRVVALIVFCAVIGMFLASPGVPDAAVVVPATLGIALVAGAAAMVNCLVERGV 74

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M RTA R    G++   E  ++ +++    + ++    N ++A L   +   Y ++Y
Sbjct: 75  DVRMRRTAWRATATGEVGARETLLVALAVGGMGLALLLACCNALTAWLTLGTFVGYAIVY 134

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LK  TPQNIVIGG +GA+PP++GW +V G +   +L +FLII+ WTPPHFW+LAL  
Sbjct: 135 TLLLKPNTPQNIVIGGASGAMPPVLGWTAVNGQIDAFALALFLIIYTWTPPHFWALALYR 194

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           +DDY +A +PMLP     R T + I++Y  L + V +LP  LG A   Y   V  L    
Sbjct: 195 RDDYARAGLPMLPVTHGQRYTTLSIVLYGFLLTAVTLLPVALGEAGAIYLGAVLLLDGRL 254

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
              A R      D    + ++LF  SI YL  LF  L++DH   + 
Sbjct: 255 LFLAVRLHRQYAD---ALARRLFAWSIWYLTWLFAALLLDHYYLIP 297


>gi|74211748|dbj|BAE29227.1| unnamed protein product [Mus musculus]
          Length = 431

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 67/262 (25%), Positives = 125/262 (47%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + T   G  LAPG       +++     + + A+ ++N +++   D  M
Sbjct: 158 RLSKIKLTALVVSTTSAGFALAPGPFDWSCFLLTSLGTGLASCAANSINQFFEVPFDSNM 217

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A       AV  + ++   +N ++  L   +IF Y   YT  L
Sbjct: 218 NRTKNRPLVRGQISPLLAVSFATCCAVPGVALLTWGVNPLTGALGVFNIFLYTCCYTP-L 276

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GAIPP++GW + TG +   +L++  I++ W  PHF +L+   ++DY
Sbjct: 277 KRVSITNTWVGAVVGAIPPVMGWTAATGSLDAGALLLGGILYSWQFPHFNALSWGLREDY 336

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    +     +L   +  + +I   +  + +   
Sbjct: 337 SRGGYCMMSVT-HPALCRRVALRHCLALIALSTAAPVLDITTWVFPVISLPINLYISYLG 395

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R ++   D D R ++KLF  S
Sbjct: 396 FRFYV---DADRRSSRKLFFCS 414


>gi|240850087|ref|YP_002971480.1| protoheme IX farnesyltransferase [Bartonella grahamii as4aup]
 gi|240267210|gb|ACS50798.1| protoheme IX farnesyltransferase [Bartonella grahamii as4aup]
          Length = 311

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 142/285 (49%), Positives = 196/285 (68%), Gaps = 1/285 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I LLKPRVMSL ++TA VG++++P  I+ L   ++I  IA+G G +GALNM+YDAD
Sbjct: 21  IGDYITLLKPRVMSLVVFTALVGLLVSPVPINPLYGFLAILCIAIGGGGAGALNMWYDAD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPIP+G+IS  +A++ G+ L++ S+++MG  INW +A  L  +IF YVVI
Sbjct: 81  IDAVMERTKKRPIPMGKISSRKAFIFGMVLSMLSVLVMGSFINWFAAFFLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR TPQNIVIGG +GA PPMIGWA  TG VSI S ++FLIIF+WTPPHFWSL+L 
Sbjct: 141 YTIWLKRITPQNIVIGGASGAFPPMIGWAVTTGSVSIDSFLLFLIIFMWTPPHFWSLSLF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY+ A IPM+PNV  + +TK  IL YT+L ++    P   G   + YGI    L   
Sbjct: 201 SSLDYEAAGIPMMPNVRGEHSTKKQILFYTILMALCAAAPCFTGLGGIFYGIFSTILSII 260

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F  +A+R +     ++ I + KKLF  S+ YL  +F +L+++ L+
Sbjct: 261 FVYFAYRLWKADTHNETILMAKKLFFFSLLYLAAIFGVLLIESLV 305


>gi|253998917|ref|YP_003050980.1| protoheme IX farnesyltransferase [Methylovorus sp. SIP3-4]
 gi|253985596|gb|ACT50453.1| protoheme IX farnesyltransferase [Methylovorus sp. SIP3-4]
          Length = 301

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 170/288 (59%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  F ++ KPRV +L ++TA +G+ ++ P    +   + +   IAM +GA+ A N   + 
Sbjct: 16  LRSFFMMCKPRVSALIVFTAMIGMFMSTPHLPPLDILIAATLGIAMTSGAAAAFNCIIEQ 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID  MART  RP+P GQ+S  +  VL   L  + + ++   +N ++  L F ++  Y V
Sbjct: 76  KIDARMARTRHRPLPTGQVSTRQTLVLATLLGFAGLSLLYAMVNPLTMWLTFGTLLGYAV 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LK  TP NIVIGG +GA+PP++GWA++   VS  +L+MFLIIF WTPPHFW+LAL
Sbjct: 136 IYTVFLKPATPLNIVIGGASGAMPPILGWAAINNVVSHEALIMFLIIFAWTPPHFWALAL 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +++Y K  IPMLP     + T +HI++YT++   +  +P  +G + + Y I    L  
Sbjct: 196 YRREEYAKVGIPMLPVTHGVQFTLLHIVLYTIILVTITFIPYSMGMSHLIYLISALVLNL 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMK 294
            F ++    +    D    + K+ F  SITYL +LF  LM+DH   ++
Sbjct: 256 VFMVYVVALY---ADYSDALAKRTFRYSITYLTLLFAALMLDHYWMLE 300


>gi|323302689|gb|EGA56495.1| Cox10p [Saccharomyces cerevisiae FostersB]
          Length = 453

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 64/300 (21%), Positives = 126/300 (42%), Gaps = 20/300 (6%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ L KPR+  L + +A     L+P   SV + +       + +G++ A+NM  + +
Sbjct: 146 IMPYLQLTKPRLTILVMLSAICSYALSPYPASVSELLCLTVGTTLCSGSANAINMGREPE 205

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
            D+ M RT +RP+  G ++P +A+     +    + I+   +N   A L   +I  Y   
Sbjct: 206 FDRQMVRTQARPVVRGDVTPTQAFEFAALIGTLGVSILYFGVNPTVAILGASNIALYGWA 265

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT  +KR    N  +G + G +PP++GWA+ +      S  +  ++F W  PHF +L+  
Sbjct: 266 YTS-MKRKHIINTWLGALVGMVPPLMGWAAASPLSHPGSWCLAGLLFAWQFPHFNTLSHN 324

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            +++Y+ A   M              L Y++L   +    +        Y I   F+   
Sbjct: 325 IRNEYKNAGYVMTAWKN-PLLNARVSLRYSILMFPLCFGLSYFNITDWYYQIDSGFINAW 383

Query: 248 FTLWAWRTFLCKEDKDIRV------------------TKKLFLESITYLFVLFTILMVDH 289
            T WA++ +  +                          +K F+ S+ +L  +  + ++  
Sbjct: 384 LTFWAFKFYWQQRINYSAKTLKDNVKFNKGLSVANIYARKTFMASVLHLPAILILAIIHK 443


>gi|187608296|ref|NP_001120053.1| COX10 homolog, cytochrome c oxidase assembly protein, heme A:
           farnesyltransferase [Xenopus (Silurana) tropicalis]
 gi|165971163|gb|AAI58429.1| LOC100145039 protein [Xenopus (Silurana) tropicalis]
          Length = 418

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 69/262 (26%), Positives = 127/262 (48%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K R+ +L + TA  G  +AP        +++     + + A+ ++N +++   D  M
Sbjct: 131 RLSKIRLTALVVITASAGYAMAPVPFDPTCFLLASVGTGLASCAANSINQFFEVPFDSNM 190

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT SRP+  GQISP  A     + A+  + ++ LA+N ++  L   +IF Y   YT  +
Sbjct: 191 NRTKSRPLVRGQISPLMATSFAAACAMPGVSLLTLAVNPLTGALGAFNIFLYTCCYTP-M 249

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GA+PP++GW + TG +   +L++  I++ W  PHF +L+   ++DY
Sbjct: 250 KRLSIANTWVGAVVGALPPVMGWTAATGSLDAGALLLGAILYSWQFPHFNALSWNLREDY 309

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + +    +  L   L   + T+ II   +  + +   
Sbjct: 310 SRGGYRMMSVT-HPLMCRRVALRHCLALIGLSTLAPALDVTTWTFPIISLPINLYISYLG 368

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R +    D D   ++KLF  S
Sbjct: 369 YRFYK---DADRSSSRKLFFCS 387


>gi|282899313|ref|ZP_06307282.1| Protoheme IX farnesyltransferase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195770|gb|EFA70698.1| Protoheme IX farnesyltransferase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 317

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 111/299 (37%), Positives = 173/299 (57%), Gaps = 4/299 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
           ++ +  L KPR++ L + T    + +A  G +     ++++    + A ++  +N  YD 
Sbjct: 17  IHSYYQLTKPRIIPLLLITTSGSMWIAAKGQVDPWLLLVTLLGGTLAAASAQTINCIYDR 76

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RT  RP+P G++   +A +  ++LA++S  ++ +  N ++A L F  I  YV+
Sbjct: 77  DIDYEMERTRHRPMPSGKVQSRDALIFAIALAIASFTLLTVFANLLAALLAFSGIVFYVL 136

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT WLKR + QNIVIGG AGAIP ++GWA+VT  +S A+ ++F I+FLWTPPHFW+LA+
Sbjct: 137 VYTHWLKRHSTQNIVIGGAAGAIPALVGWAAVTDTLSWAAWLLFAIVFLWTPPHFWALAM 196

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML-GFASVTYGIIVFFLG 245
           + +DDY K  IPMLP V  ++ T   I  YTV+T    VL       + + Y +I   LG
Sbjct: 197 MIRDDYAKVGIPMLPVVAGNQATVRQIWFYTVITVTSTVLLFYPLHASGIVYVVIAMTLG 256

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLIDMKTVERYFFSSF 304
             F   +WR     EDK I   K+LFL SI+Y+ +L   +++D L     +      +F
Sbjct: 257 GIFLHKSWRLLQNPEDKTI--AKELFLYSISYMMLLCLGMVIDSLPFTHYLVSTILHTF 313


>gi|87121367|ref|ZP_01077256.1| hypothetical protein MED121_21085 [Marinomonas sp. MED121]
 gi|86163210|gb|EAQ64486.1| hypothetical protein MED121_21085 [Marinomonas sp. MED121]
          Length = 298

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 108/285 (37%), Positives = 162/285 (56%), Gaps = 5/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L K RV+++ + TA VG+ LA P   +++  V +   I + A ++ A N   D 
Sbjct: 16  WRDYYNLCKARVVAVLLLTAVVGMFLATPEVPNLILVVTATIGIGLCASSAAAFNHVLDR 75

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
             D +M RT +RP+P G++   +A +  + +      I+ L +N +SA L   S+  Y +
Sbjct: 76  RFDAIMYRTRNRPLPSGKVGTQQAVLFAIIIGALGFSILYLLVNPLSAYLTLASLIGYAL 135

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT +LKR TPQNI IGG+AGA+PP++GW S+TG +   SL++ LIIF WTPPHFW+LA+
Sbjct: 136 IYTAFLKRATPQNITIGGLAGAMPPLLGWVSITGTLEPNSLLLVLIIFAWTPPHFWALAI 195

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             ++DY KA IPMLP       T++ IL+YT L  I   LP +   + + Y   V  L  
Sbjct: 196 HKREDYAKAGIPMLPVTHGVAFTRLQILLYTCLLMITTALPFVTAMSGLIYLFGVVLLNM 255

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  +A + F      D  V  ++F  SI Y+  LF  L++DH +
Sbjct: 256 RFMYFALQLF----GNDESVPLRMFWYSIRYIMWLFAWLLLDHYL 296


>gi|218288361|ref|ZP_03492651.1| protoheme IX farnesyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241334|gb|EED08508.1| protoheme IX farnesyltransferase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 308

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 90/279 (32%), Positives = 150/279 (53%), Gaps = 2/279 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
           L  ++ ++K  +    +   F G+ +A G    +   ++++           ALN +YD 
Sbjct: 22  LRDYLSIMKWGITVANLMATFAGLWVASGGHPPLSVMMLTLLGTMFVVAGGAALNNFYDR 81

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID+ M RT  R +  G++SP  A  +G++++   + ++ + +NW SA   F+ +F Y  
Sbjct: 82  DIDQRMPRTKMRAVARGKVSPGAALGIGLTMSAIGLAVLLVGVNWQSALCAFVGLFVYSY 141

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV-SIASLVMFLIIFLWTPPHFWSLA 185
           +YT+W KR T  N V+GG++GA+PP+IGW + +G   S+A+  +F   FLW PPHF  LA
Sbjct: 142 LYTVWFKRHTTLNTVLGGVSGAMPPLIGWVAGSGGKLSLAAWCLFFTFFLWQPPHFLPLA 201

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +   +DY+ A +PMLP V   R TK  I+ YT     V ++ T+LG     Y +++  LG
Sbjct: 202 MKKTEDYRAAGLPMLPVVRGFRETKRQIVFYTAAMVPVSLMLTVLGAEGWLYFVVMGALG 261

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTI 284
             F   A +      +KD+    ++F  S+ YL  L  +
Sbjct: 262 LWFLYLAVKGLFIPPEKDMDWANQVFRFSLIYLTALCIV 300


>gi|71897129|ref|NP_001025871.1| protoheme IX farnesyltransferase, mitochondrial [Gallus gallus]
 gi|53133015|emb|CAG31955.1| hypothetical protein RCJMB04_14f19 [Gallus gallus]
          Length = 448

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 69/262 (26%), Positives = 127/262 (48%), Gaps = 5/262 (1%)

Query: 13  VLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMM 72
            L K ++ +L + TA  G  +AP    +   +++     + + A+ ++N +++   D  M
Sbjct: 151 RLSKIKLTALVVSTASAGFAMAPVPFDLPCFLLASLGTGLASCAANSINQFFEVPFDSNM 210

Query: 73  ARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWL 132
            RT +RP+  GQISP  A     S  V  I ++ + +N ++  L   +IF Y   YT  +
Sbjct: 211 NRTKNRPLVRGQISPLLAVCFAASCGVPGIALLTMGVNPLTGALGAFNIFLYTCCYTP-M 269

Query: 133 KRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDY 192
           KR +  N  +G + GAIPP++GW + TG +   +L++  I++ W  PHF +L+   ++DY
Sbjct: 270 KRMSIANTWVGAVVGAIPPVMGWTAATGSLDAGALLLGGILYSWQFPHFNALSWGLREDY 329

Query: 193 QKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA 252
            +    M+         +   L + V    +  +  +L   + T+ II   L  + +   
Sbjct: 330 SRGGYCMMSVT-HPELCRRVALRHCVALIGLCTVAPILDITTWTFPIISLPLNLYISYLG 388

Query: 253 WRTFLCKEDKDIRVTKKLFLES 274
           +R +    D D   ++KLF  S
Sbjct: 389 FRFY---RDADRSSSRKLFFCS 407


>gi|91762736|ref|ZP_01264701.1| cytochrome c oxidase assembly factor [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718538|gb|EAS85188.1| cytochrome c oxidase assembly factor [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 303

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 122/289 (42%), Positives = 188/289 (65%), Gaps = 1/289 (0%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMY 63
            VF  +    L+KPRVMSL I+T  VG+++AP  +S   ++I+I  +++GAGA+GALNM+
Sbjct: 15  NVFNFSELFKLMKPRVMSLVIFTCAVGLLMAPSTVSTKDAMIAILLVSIGAGAAGALNMW 74

Query: 64  YDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFC 123
           Y++D+D +M RT  RPIP+G+++  +A + G SL+  S++ +    N +SA LL  +I  
Sbjct: 75  YESDLDALMTRTCLRPIPMGKVNKNQALIFGTSLSFFSVIALDYFANTISAVLLLFTILF 134

Query: 124 YVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWS 183
           YV +YTIWLKR TPQNIVIGG AGA+PP+IGW   T  +S+  +  FLIIF WTP HFW+
Sbjct: 135 YVFVYTIWLKRKTPQNIVIGGAAGALPPVIGWTIATNSLSLEPITFFLIIFFWTPSHFWA 194

Query: 184 LALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFF 243
           L+L   DDY+KA IPMLP      +TK++IL+Y++L   + +LP  + F  + + +    
Sbjct: 195 LSLYKSDDYKKAKIPMLPLTNGIESTKINILVYSLLMLPMVILPYAIDFVGLVFLVPALM 254

Query: 244 LGYHFTLWAWRTF-LCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           L  ++ +  +  +   K   + +  K +F  SI YLF++F I ++D ++
Sbjct: 255 LTLYYNILCFELYKFKKNKFNPKKAKTIFGYSILYLFLIFVIFLIDKIL 303


>gi|226314566|ref|YP_002774462.1| protoheme IX farnesyltransferase [Brevibacillus brevis NBRC 100599]
 gi|226097516|dbj|BAH45958.1| protoheme IX farnesyltransferase [Brevibacillus brevis NBRC 100599]
          Length = 311

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 89/286 (31%), Positives = 158/286 (55%), Gaps = 4/286 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP +    + T F  + LA  G+ +   +  ++   A+   +  ALN +YD 
Sbjct: 27  FRDYVQLTKPGITLSNLMTTFAALWLASYGYPNWKLAFFTMLGTALVIMSGAALNNFYDR 86

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           D+DK M RT  R +  G+IS   A +LG+ L ++ + ++ +  N ++A    +    YV+
Sbjct: 87  DLDKKMKRTQHRGVATGRISARNAILLGIGLLLAGVTVLAVYANPLAAVWGLIGHIFYVL 146

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT  LKR T  N VIGGI+GA PP+IGW +VT  + + + ++FL++FLW PPHF +LA+
Sbjct: 147 IYTP-LKRVTTLNTVIGGISGAAPPVIGWVAVTETMDMTAWLLFLVLFLWQPPHFLALAM 205

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           L  ++Y+  ++PMLP V     TK  ++++  +     +L  + G     Y +++  +G 
Sbjct: 206 LKTEEYRAGNLPMLPVVKGFAETKRQMVLWGSVLFPASLLLFIHGSLGFVYLLVMGVMGI 265

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLID 292
            + +  ++ F  K+  D+   +KLF  SI YL V    +++  +++
Sbjct: 266 VYMVLLFQGFKTKD--DLAWARKLFGYSILYLTVFCAAIVISTMVN 309


>gi|149911816|ref|ZP_01900419.1| protoheme IX farnesyltransferase [Moritella sp. PE36]
 gi|149805116|gb|EDM65139.1| protoheme IX farnesyltransferase [Moritella sp. PE36]
          Length = 298

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 170/286 (59%), Gaps = 4/286 (1%)

Query: 7   RLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVI-SIFAIAMGAGASGALNMYYD 65
               +  L KP+V++L + TA VG+VLA   +  L  ++ ++  I + + A+ A N   D
Sbjct: 13  NWRAYYQLTKPKVVALLLLTALVGMVLALPTLPSLSLLVPALVGIGLLSAAAAAYNHILD 72

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
             ID +M RT  RP+    IS  +A +   S+A+  +V + + +N ++A L F S+  Y 
Sbjct: 73  QRIDAIMTRTHQRPLVQNTISTPKALLFATSMAIIGMVTLFVFVNALTAWLTFASLIGYA 132

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLA 185
           VIYT++LKR TPQNI IGG+AGA PP++GW ++TG+V+  +L++ +IIF+WTPPHFW+LA
Sbjct: 133 VIYTMYLKRATPQNIAIGGLAGATPPLLGWTAMTGEVTGQALLLVMIIFIWTPPHFWALA 192

Query: 186 LLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLG 245
           +  + +Y KA IPMLP       TK  IL+YT+L   V  LP +   + + Y I    LG
Sbjct: 193 IHKEKEYAKAKIPMLPVTHGAEYTKTLILLYTLLLLPVTWLPWLTQLSGLLYLIGSTVLG 252

Query: 246 YHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             F  +A+R    K     +   + F  SI +L VLF +L+VDH +
Sbjct: 253 ISFIYYAYRL---KFKPTRKTAFQTFKFSIIHLMVLFILLLVDHWL 295


>gi|182639258|sp|Q1J1C3|COXX_DEIGD RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
          Length = 307

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 108/288 (37%), Positives = 162/288 (56%), Gaps = 4/288 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KP+V+SL ++T    + +A  G   +   V+   A  M AG++G  NM  D 
Sbjct: 18  WRDYLALTKPKVISLLLWTTLTAMFMAARGWPGLGLLVVVSLAGYMSAGSAGVFNMIIDR 77

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RTA+RP   G IS  +A + G +L V S  ++ +    ++A +       YVV
Sbjct: 78  DIDLRMKRTATRPTSSGLISTRDAAIFGGALQVLSFGMLWVWATPLAAWMSLAGFLTYVV 137

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT+WLKR T  NIV+GG AG  PP++GWA+VTGD+++ +  +F IIF WTP HFW+LAL
Sbjct: 138 VYTLWLKRNTWHNIVLGGAAGCFPPLVGWAAVTGDLNLFAWFLFAIIFFWTPVHFWALAL 197

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + KD+Y++  IPMLP V  DR T   I +Y + T ++ V+P  LG     Y +    LG+
Sbjct: 198 MIKDEYREVGIPMLPVVHGDRLTVAQIGLYAIYTVVLSVMPVFLGEVGWLYFLSALVLGW 257

Query: 247 HFTLWAWRTFLCK---EDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
                +W  +         + +V   L+L S+ YL +LF    VD ++
Sbjct: 258 LLLQRSWVLYRHVMAGNKVERKVAVPLYLYSMLYLALLFVAGAVDRVL 305


>gi|119503601|ref|ZP_01625684.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2080]
 gi|119460663|gb|EAW41755.1| protoheme IX farnesyltransferase [marine gamma proteobacterium
           HTCC2080]
          Length = 299

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 112/285 (39%), Positives = 172/285 (60%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV++L I TA +G+ +A PG +     V+    IA+ AGA+ A+N   D 
Sbjct: 13  WQDYLELTKPRVVALMIVTALIGMCMAVPGWVPWQPLVLGNLGIALCAGAAAAINHIVDE 72

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
            ID+ MART +RP+  G+I+  +A +   +LA+  + ++ + +N ++A L   S+  Y  
Sbjct: 73  RIDQQMARTQARPVATGRITQRDAILFAAALALLGVWVLVVWVNVLTAVLTVASLIGYAF 132

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           IYT++LKR TPQNIVIGG+AGA PP++GW +VTG++    L++ LIIF WTPPHFW+LA+
Sbjct: 133 IYTMFLKRATPQNIVIGGLAGAAPPLLGWTAVTGEIHGHGLLLVLIIFAWTPPHFWALAI 192

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
             +++Y    IPMLP       T +HIL+YT+L  ++ ++P     +   Y +    LG 
Sbjct: 193 HRREEYASVGIPMLPVTHGVGFTALHILLYTILMFLITLMPFATHMSGAIYLVGAVVLGV 252

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            F  W+      +   ++    K F  SITYL VLF I++VDH +
Sbjct: 253 IFLYWSIEIMRGQ---NVNAPMKTFKYSITYLLVLFIIMLVDHWL 294


>gi|332974255|gb|EGK11187.1| protoheme IX farnesyltransferase [Desmospora sp. 8437]
          Length = 311

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/285 (32%), Positives = 155/285 (54%), Gaps = 3/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDA 66
              +  L KP + +      F G  LA  H       + ++   A+    +  +N Y D 
Sbjct: 27  WRDYWELTKPGINASNQMAVFTGFWLAGHHLFHFGLLLATLLGTALVTAGACTINNYIDR 86

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID +M RT +RP+  G+I P  A+ +G  LA++ + ++ + +N +SA L     F YV+
Sbjct: 87  DIDPLMDRTRNRPVAAGRIRPQSAFWMGCLLALAGVAVLLVLVNPLSAILAATGFFAYVL 146

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +Y++W KR T  N V+G I+GA+PP+IGWA+V G + + + ++FL +F+W PPHF++LA+
Sbjct: 147 LYSVWAKRTTIWNTVVGCISGAVPPLIGWAAVEGTLELPAWMLFLFMFVWQPPHFYALAM 206

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           +  +DY+ A IPM P V     TK  IL Y +L   V +L    G  S  Y +    +G 
Sbjct: 207 MKTEDYRAAGIPMWPVVKGLADTKRQILFYIILMLPVSLLLVGTGVVSWLYLVTAIIIGG 266

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +   A   +  + ++D    +++FL S+ YL V+   + VD ++
Sbjct: 267 VWIYLAVAGWSSQNNED--WARRMFLYSLLYLTVMQVAMFVDPIL 309


>gi|322369151|ref|ZP_08043716.1| protoheme IX farnesyltransferase [Haladaptatus paucihalophilus
           DX253]
 gi|320550883|gb|EFW92532.1| protoheme IX farnesyltransferase [Haladaptatus paucihalophilus
           DX253]
          Length = 460

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/283 (34%), Positives = 146/283 (51%), Gaps = 5/283 (1%)

Query: 10  FFIVLLKPRVMSLAIYTAFVGIVLAPGH-ISVLKSVISIFAIAMGAGASGALNMYYDADI 68
            +  L+KPR+M L    A  G+ LA G  + V   V ++    +  GASG  N   + D+
Sbjct: 181 AYFRLMKPRLMWLLCLVASAGMALAAGPNLEVGTVVATLTGGVLSIGASGTFNHVLERDV 240

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D+ M RTA RP    QI    A      L  ++ + + L++N + A     +I  Y VIY
Sbjct: 241 DQRMNRTADRPAATAQIPVRNAIA-FGLLLAAASLAVFLSVNLLVAVFGLTAIVFYSVIY 299

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+ LK  T QN VIGG+AG++P +IGWA+VT DV + +LV+  +IFLWTP HF++LAL  
Sbjct: 300 TLILKPNTVQNTVIGGLAGSLPALIGWAAVTDDVGLPALVLAGVIFLWTPAHFYNLALAY 359

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
           KDDY +   PM+P V  +  T+ HIL++   T +   +   +      Y +     G  F
Sbjct: 360 KDDYARGGFPMMPVVRGEAETRKHILLWLGATLLASGVLATVTTLGWLYAVTTVVFGAIF 419

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            +   +    ++D       + F  S  YL  L   ++VD L+
Sbjct: 420 LITVVQLHHKRDDT---AAFRSFHASNAYLGALLLAIVVDALV 459


>gi|296117942|ref|ZP_06836525.1| protoheme IX farnesyltransferase [Corynebacterium ammoniagenes DSM
           20306]
 gi|295969173|gb|EFG82415.1| protoheme IX farnesyltransferase [Corynebacterium ammoniagenes DSM
           20306]
          Length = 319

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/310 (31%), Positives = 157/310 (50%), Gaps = 15/310 (4%)

Query: 4   QVFRLNFFIVLLKPRVMSLAIYTAFVGIVLAPGHI-----SVLKSVISIFAIAMGAGASG 58
            +  +  +I L KPR++ L +  A   ++ A   +     ++   + +IF   MGA A+ 
Sbjct: 5   SLDTIKAYIALTKPRIIELLLVAAIPAMLQAQRGVEAAADNIWLIISTIFGGWMGAAAAH 64

Query: 59  ALNMYYDADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIM-GLAINWVSATLL 117
             N   + ++D+ M RT +RP+  G+IS   A +    +   S+  +  +A +W++A  +
Sbjct: 65  TFNNVVEYELDQKMQRTRARPLVRGKISRKNAAIFAFIMLALSVFWLGVVANSWLAAFFV 124

Query: 118 FMSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGW-------ASVTGDVSIASLVMF 170
            ++ F YV +YT WLK    Q IV GG+AG +P ++GW            D    ++V+F
Sbjct: 125 LLTNFFYVFVYTKWLKMKNEQGIVWGGLAGCMPALVGWAVIRDNAMDGQPDRWWQAVVLF 184

Query: 171 LIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTML 230
           LIIF WTPPH W+LA+  K+DY++A +PMLP V  +      I+ YT+ T +V +L  +L
Sbjct: 185 LIIFFWTPPHTWALAMKYKEDYRRAGVPMLPVVAKESEVTRQIVWYTIATVVVTLL--LL 242

Query: 231 GFASVTYGIIVFFLGYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
             AS  Y I     G  F   A R     +        +LF+ S  YL VLF  L +D +
Sbjct: 243 PAASWIYLIAAIASGIGFLWMAIRLHDGVKKGAKVKPMRLFIYSNNYLSVLFIGLTIDAI 302

Query: 291 IDMKTVERYF 300
           +  + + R  
Sbjct: 303 VGWEPIGRML 312


>gi|46199975|ref|YP_005642.1| protoheme IX farnesyltransferase [Thermus thermophilus HB27]
 gi|81405371|sp|Q72H22|COXX_THET2 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|46197602|gb|AAS82015.1| protoheme IX farnesyltransferase [Thermus thermophilus HB27]
          Length = 608

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 165/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+SL ++TA  G ++A  G   +   +       M AGA+ A+NM  D 
Sbjct: 327 WRDYLALTKPRVISLLLFTALFGALIAAKGWPGLGVFLAVALGGYMMAGAANAINMVVDR 386

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RTA RP    ++S  +A +   +LAV    ++    N ++ATL  M +  YV+
Sbjct: 387 DIDARMKRTAKRPTVTQRVSSRDALLFAFALAVLGFAVLWWGANLLAATLALMGLIWYVL 446

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR T  NIVIGG AGA PP++GWA+VTG++S+ +  +F +IF WTP HFW+LAL
Sbjct: 447 VYTLYLKRRTWHNIVIGGAAGAFPPLVGWAAVTGELSLFAWYLFALIFFWTPVHFWALAL 506

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + +DDY+   +PMLP V+ +R T + I +Y +LT+++ ++P +LG   + Y      L  
Sbjct: 507 MIQDDYRAVGVPMLPVVLGERATVIQIALYALLTALISLMPLLLGELGLLYLAASLLLNA 566

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              L +   +      + R    L+  S+ YL +LF  + VD  +
Sbjct: 567 LLLLKSLALYRR---PERRTAVSLYKYSMLYLALLFAAMAVDRAV 608


>gi|76802778|ref|YP_330873.1| heme O oxidase N-terminal domain-containing protein [Natronomonas
           pharaonis DSM 2160]
 gi|121695401|sp|Q3INR7|COXX2_NATPD RecName: Full=Protoheme IX farnesyltransferase 2; AltName:
           Full=Heme B farnesyltransferase 2; AltName: Full=Heme O
           synthase 2
 gi|76558643|emb|CAI50235.1| heme O oxidase N-terminal domain homolog / protoheme IX
           farnesyltransferase [Natronomonas pharaonis DSM 2160]
          Length = 433

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 145/287 (50%), Gaps = 6/287 (2%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGASGALNMYY 64
           L  ++ L KPR+M L    A  G+ LA      +  +    ++F   +  GA+G  N  Y
Sbjct: 149 LRRYVELTKPRLMWLLCLLALSGMALATVTGAALDGVTIAATLFGGVLAVGAAGTFNHVY 208

Query: 65  DADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCY 124
           + D D+ M RTA RP+    +    A   GV L V S+ ++   +N ++A L  +++  Y
Sbjct: 209 ERDRDRRMNRTADRPVATDAVGVGRATAFGVGLLVVSMAVLVWLVNPLAAALTAVAVVYY 268

Query: 125 VVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSL 184
            V+YT+ LK  T  N VIGG AGA+P +IGWA+V G + + +L++  ++F WTP HF++L
Sbjct: 269 AVVYTVVLKPTTTWNTVIGGGAGALPAVIGWAAVAGSIGLPALLLAAVVFCWTPAHFYNL 328

Query: 185 ALLCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFL 244
           A+  +DDY +   PMLP V     T+  IL +   T +V      +      Y +    +
Sbjct: 329 AIAYRDDYARGDYPMLPVVAGVAATRRRILYWLGATLLVAGALGAVAGFGPVYALTSAVV 388

Query: 245 GYHFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           G+ F       F  + D+D     + F  S  YL  L   ++V+ ++
Sbjct: 389 GFGFLWTVVVQFRTESDRD---AYRSFHASNAYLGALLVAILVETMV 432


>gi|256372476|ref|YP_003110300.1| protoheme IX farnesyltransferase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256009060|gb|ACU54627.1| protoheme IX farnesyltransferase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 297

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 103/284 (36%), Positives = 165/284 (58%), Gaps = 4/284 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLA-PGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
             +++L KPR++ L + T    +++A  G  S+    I++    + AG + A NM++D D
Sbjct: 14  RGYVMLTKPRIIELLLITTVPAMIVAKRGLPSLSLIAITVVGGTLAAGGANAANMWFDRD 73

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RP+  G +SP  A +  V+L V++  I+ +  N ++A++   +   Y  +
Sbjct: 74  IDAVMRRTKGRPLVTGDVSPRGALIFSVTLEVAAFAILSVGANVLAASIALAAALFYFGV 133

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YT+WLKR T QNIVIGG AGA P ++GWA+V  ++S+A+ +MFLIIF+WTPPHFW LA  
Sbjct: 134 YTMWLKRSTSQNIVIGGAAGAAPVLVGWAAVRDELSLAAWLMFLIIFVWTPPHFWGLAFR 193

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
             DDY  A +PMLP+V + R +   I+ Y+V+  ++ ++   +    + Y      LG  
Sbjct: 194 YADDYSAAGVPMLPSVASRRASAWQIVAYSVVLVLLALVLGPVAGLGLVYDAAAVLLGAG 253

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
           F  +A R          +   ++F  SITYL +LF  + VD ++
Sbjct: 254 FVWYAVRLLRSL---SPKAAMRVFSYSITYLSLLFVGMAVDVIV 294


>gi|157964425|ref|YP_001499249.1| protoheme IX farnesyltransferase [Rickettsia massiliae MTU5]
 gi|157844201|gb|ABV84702.1| Protoheme IX farnesyltransferase [Rickettsia massiliae MTU5]
          Length = 308

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 120/267 (44%), Positives = 174/267 (65%), Gaps = 2/267 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  +I+L+KPRV+SL I+T FVG+ LAP  +    + I++  IA+GAG++GA+NM+YD D
Sbjct: 23  VKDYILLMKPRVISLVIFTGFVGMWLAPYSVHPFIAGIAVVCIALGAGSAGAINMWYDRD 82

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID +M RT  RPI  G I   EA   G+     ++  M L +N +++ LL  +IF Y+ I
Sbjct: 83  IDSLMKRTQKRPIVRGVIESDEALSFGLITGFFAVFFMALCVNLLASFLLLFTIFYYICI 142

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR + QNIVIGG++GA+PP+IG+A+V+  +S+ S+++FLIIF+WTPPH W+LAL 
Sbjct: 143 YTIWLKRRSIQNIVIGGVSGALPPVIGYAAVSNTISLESIILFLIIFIWTPPHSWALALF 202

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
           C DDY+   +PM+P V     TK  ILIY++L  IV ++P  +G  +  Y II   LG  
Sbjct: 203 CNDDYKNCKVPMMPAVKGTLYTKKQILIYSILLFIVSLMPFFIGMNNFIYLIIAGILGVV 262

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F  +A   F   +  D +  K+ F  S
Sbjct: 263 FLYYAGSLF--YDTSDNKQAKRFFAYS 287


>gi|115526741|ref|YP_783652.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|122294496|sp|Q07HB2|COXX_RHOP5 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|115520688|gb|ABJ08672.1| protoheme IX farnesyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 313

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 134/271 (49%), Positives = 180/271 (66%), Gaps = 1/271 (0%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDAD 67
           +  ++ LLKPRVMSL I+TA VG++LAPG    + ++ SI  I +GAGA+GALNM+Y+ D
Sbjct: 21  VADYVALLKPRVMSLVIFTALVGLLLAPGSFHPVLAITSILCIGVGAGAAGALNMWYEDD 80

Query: 68  IDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVI 127
           ID  M RTA+RPIP G+I+  EA   G++LA  S+V +G+ +NW++A LL  +IF YVVI
Sbjct: 81  IDAKMTRTANRPIPRGKITRPEALTFGMTLAFFSVVTLGILVNWIAAALLAFTIFFYVVI 140

Query: 128 YTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALL 187
           YTIWLKR T QNIVIGG AGA+PP++ WA+VTG VS+  +++F IIF WTPPHFW+LAL 
Sbjct: 141 YTIWLKRVTAQNIVIGGAAGALPPVVAWAAVTGSVSVEPMLLFAIIFFWTPPHFWALALF 200

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
              DY  A +PMLP       T++ IL+YT+    V + P  LG+ S  YGI    LG  
Sbjct: 201 RAGDYANAGVPMLPVTAGPDATRLQILLYTIALVAVALAPWPLGYFSAVYGITSLALGGG 260

Query: 248 FTLWAWRTFLCKE-DKDIRVTKKLFLESITY 277
               A R +  +     +R ++ LF  SI Y
Sbjct: 261 MLACALRVYRHRTGSAALRASRNLFRFSILY 291


>gi|148284978|ref|YP_001249068.1| protoheme IX farnesyltransferase [Orientia tsutsugamushi str.
           Boryong]
 gi|182639213|sp|A5CF31|COXX_ORITB RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|146740417|emb|CAM80894.1| protoheme IX farnesyltransferase [Orientia tsutsugamushi str.
           Boryong]
          Length = 313

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 130/283 (45%), Positives = 187/283 (66%), Gaps = 3/283 (1%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             F++L+KP VM LAI+TA  G+ +AP  I  L S+I+I  I+ GAGA+GA+NM+YDADI
Sbjct: 27  KDFLLLMKPSVMLLAIFTAITGLFIAPNKIRPLLSLIAILCISTGAGAAGAINMWYDADI 86

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D++M RT +RP   G+ISP  A   G+ LA  S+++M + +N++S+ LL +SI  Y+++Y
Sbjct: 87  DRIMKRTRNRPTVTGKISPSTALTFGIILAFFSVLVMAICVNYISSILLLISISFYIIVY 146

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLC 188
           T+WLKR T QNIVIGG AGA+PP+IG+++VT  +    L++FLIIFLWTP HFW+L+L  
Sbjct: 147 TMWLKRRTAQNIVIGGAAGALPPVIGYSAVTNSIDTTCLMLFLIIFLWTPAHFWTLSLYY 206

Query: 189 KDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHF 248
            +DY+ A++P+LP V     TK  IL YT LT I   LP     A + Y I     G  F
Sbjct: 207 TNDYKLANVPILPLVKGINYTKYSILAYTFLTVISASLPYFTDIAGLLYLICSTISGIIF 266

Query: 249 TLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             +A   F    D++  + +K+F  SI YLF +F  L++++ I
Sbjct: 267 LCYASMLF---NDRNNILARKMFKYSIIYLFNIFLYLIIEYCI 306


>gi|307206651|gb|EFN84623.1| Protoheme IX farnesyltransferase, mitochondrial [Harpegnathos
           saltator]
          Length = 372

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 69/267 (25%), Positives = 126/267 (47%), Gaps = 6/267 (2%)

Query: 9   NFFIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADI 68
             ++ L K R+ SL + T   G  LAP    +    +      + + A+ A+N +++   
Sbjct: 59  KHYLKLSKIRLTSLVVATTMAGYALAPAPFDIYTFAMCSLGTGLVSAAANAINQFFEVPF 118

Query: 69  DKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIY 128
           D  M+RT +R +  G ++  +A       ++  + ++   +N V+A L   ++  Y +IY
Sbjct: 119 DAQMSRTKNRVLVRGHLTSAQAVAFAAVSSIIGLSMLYYEVNSVTAALGATNLVLYTLIY 178

Query: 129 TIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGD-VSIASLVMFLIIFLWTPPHFWSLALL 187
           T  +KR +  N  +G + GAIPP++GWA  TG  +   +L++  I++ W  PHF +L+  
Sbjct: 179 TP-MKRVSIVNTWVGSVVGAIPPLMGWAGCTGSIMMPGALIISGILYAWQFPHFNALSWN 237

Query: 188 CKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYH 247
            + DY +A   M+     D   +   + YTV  + +  L  +L   +  + +    L   
Sbjct: 238 LRPDYSRAGYRMMAVTNPD-LCRKTTMRYTVALTGLCYLAPVLDVTNWWFALATTPLNVS 296

Query: 248 FTLWAWRTFLCKEDKDIRVTKKLFLES 274
           F   AW+     E  D   ++KLF  S
Sbjct: 297 FLYLAWKF---SEHSDSANSRKLFRFS 320


>gi|55980279|ref|YP_143576.1| bifunctional cytochrome c oxidase assembly factor CtaA/protoheme IX
           farnesyltransferase CtaB [Thermus thermophilus HB8]
 gi|81364603|sp|Q5SLI3|COXX_THET8 RecName: Full=Protoheme IX farnesyltransferase; AltName: Full=Heme
           B farnesyltransferase; AltName: Full=Heme O synthase
 gi|55771692|dbj|BAD70133.1| cytochrome c oxidase assembly factor (CtaA) + protoheme IX
           farnesyltransferase (CtaB) [Thermus thermophilus HB8]
          Length = 608

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 106/285 (37%), Positives = 165/285 (57%), Gaps = 4/285 (1%)

Query: 8   LNFFIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDA 66
              ++ L KPRV+SL ++TA  G ++A  G   +   +       M AGA+ A+NM  D 
Sbjct: 327 WRDYLALTKPRVISLLLFTALFGALIAAKGWPGLGVFLAVALGGYMMAGAANAINMVVDR 386

Query: 67  DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           DID  M RTA RP    ++S  +A +   +LAV    ++    N ++ATL  M +  YV+
Sbjct: 387 DIDARMKRTAKRPTVTQRVSSRDALLFAFALAVLGFAVLWWGANLLAATLALMGLIWYVL 446

Query: 127 IYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL 186
           +YT++LKR T  NIVIGG AGA PP++GWA+VTG++S+ +  +F +IF WTP HFW+LAL
Sbjct: 447 VYTLYLKRRTWHNIVIGGAAGAFPPLVGWAAVTGELSLFAWYLFALIFFWTPVHFWALAL 506

Query: 187 LCKDDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGY 246
           + +DDY+   +PMLP V+ +R T + I +Y +LT+++ ++P +LG   + Y      L  
Sbjct: 507 MIQDDYRAVGVPMLPVVLGERATVIQIALYALLTALISLMPLLLGELGLLYLAASLLLNA 566

Query: 247 HFTLWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
              L +   +      + R    L+  S+ YL +LF  + VD  +
Sbjct: 567 LLLLKSLALYRR---PERRTAVSLYKYSMLYLALLFAAMAVDRAV 608


>gi|328789230|ref|XP_392628.4| PREDICTED: protoheme IX farnesyltransferase, mitochondrial [Apis
           mellifera]
          Length = 411

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 129/270 (47%), Gaps = 7/270 (2%)

Query: 7   RLNFF-IVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYD 65
           +L  +  +L K R+ SL + T   G VLAPG       +       + +  + A+N +++
Sbjct: 95  KLQKYCFMLSKIRLTSLVVITTMAGYVLAPGVFDAHTFIACSMGTGLLSATANAINQFFE 154

Query: 66  ADIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYV 125
              D  M+RT +R +  G ++P +A +       S ++++   +N ++A L   ++  Y 
Sbjct: 155 VPFDAQMSRTKNRVLVRGHLTPGQAIIFATVSGFSGLLLLYSQVNELTAILGASNLILYT 214

Query: 126 VIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDV-SIASLVMFLIIFLWTPPHFWSL 184
           +IYT  +KR +  N  IG I GAIPP++GWAS   D+ S  + +M  I++ W  PHF +L
Sbjct: 215 LIYTP-MKRISILNTWIGSIVGAIPPLMGWASCVNDIVSPGAWIMSGIL