RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780360|ref|YP_003064773.1| protoheme IX
farnesyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (305 letters)



>gnl|CDD|30458 COG0109, CyoE, Polyprenyltransferase (cytochrome oxidase assembly
           factor) [Posttranslational modification, protein
           turnover, chaperones].
          Length = 304

 Score =  273 bits (699), Expect = 5e-74
 Identities = 136/282 (48%), Positives = 188/282 (66%), Gaps = 4/282 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAP-GHISVLKSVISIFAIAMGAGASGALNMYYDADID 69
           ++ L KPRV+SL + TAF G++LAP G I+ L  ++++   A+GAG +GA NMY D DID
Sbjct: 21  YLQLTKPRVISLLLITAFAGMLLAPRGSINPLLLLLTLLGGALGAGGAGAFNMYIDRDID 80

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
            +M RT  RP+  G ISP EA   G+ L V+   ++   +N ++A L    IF YVV+YT
Sbjct: 81  ALMERTRKRPLVTGLISPREALAFGLVLGVAGFSLLWFLVNLLAAVLGLFGIFFYVVVYT 140

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
           +WLKR TPQNIVIGG AGA+PP+IGWA+VTG +S+ ++++F IIFLWTPPHFW+LAL  K
Sbjct: 141 LWLKRRTPQNIVIGGFAGAMPPLIGWAAVTGSISLGAILLFAIIFLWTPPHFWALALKYK 200

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           DDY+ A IPMLP V  +R TK  IL+YT+  + V +L  +LG+    Y ++   LG  F 
Sbjct: 201 DDYKAAGIPMLPVVKGERRTKRQILLYTLALAPVSLLLALLGYVGYLYLVVATLLGAWFL 260

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
             AW+ +      D +  +KLF  SI YL +LF  L++D L+
Sbjct: 261 ALAWKLYR---KDDRKWARKLFKYSIIYLALLFVALLIDSLL 299


>gnl|CDD|36594 KOG1380, KOG1380, KOG1380, Heme A farnesyltransferase [Coenzyme
           transport and metabolism].
          Length = 409

 Score =  140 bits (353), Expect = 6e-34
 Identities = 72/281 (25%), Positives = 134/281 (47%), Gaps = 5/281 (1%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDK 70
           ++ L KPR+  L + T   G  LAPG  S    + +     + + ++ A+N  ++   D 
Sbjct: 97  YLELSKPRLTMLVVLTTMTGYALAPGPFSFPTLLYTTVGTGLCSASANAINQIFEPPFDS 156

Query: 71  MMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTI 130
            M RT +RP+  G+ISP  A         + + ++   +N ++A L   +IF Y  +YT 
Sbjct: 157 QMKRTQNRPLVRGRISPLHAVTFATLTGTAGVSLLAFGVNPLAAALGAGNIFLYAGVYTP 216

Query: 131 WLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKD 190
            LKR    N  +G + GAIPP++GWA+ +G +   ++++  I++ W  PHF +L+   ++
Sbjct: 217 -LKRIHIINTWVGAVVGAIPPLMGWAAASGLLDPGAMILAGILYAWQFPHFNALSWNLRN 275

Query: 191 DYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTL 250
           DY KA   M+  V      +   L Y++    +          +  + I    L  +   
Sbjct: 276 DYSKAGYRMM-AVTNPGLCRRVALRYSLAFLPLSYAAPSTDLTTWWFAIESLPLNAYLAY 334

Query: 251 WAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHLI 291
            A++ +    D+D    +KLF  S+ +L +L  ++++    
Sbjct: 335 LAFKFY---RDRDYHNARKLFFASLLHLPLLMLLMLIHKKG 372


>gnl|CDD|144580 pfam01040, UbiA, UbiA prenyltransferase family. 
          Length = 258

 Score = 82.5 bits (204), Expect = 1e-16
 Identities = 53/253 (20%), Positives = 105/253 (41%), Gaps = 3/253 (1%)

Query: 21  SLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASG-ALNMYYDADIDKMMARTASRP 79
            LA+     G+ LA G    L  ++ +    +   A+G  LN Y+D +ID       SRP
Sbjct: 2   PLALLPVLAGLALAAGGALDLLLLLLLLLALLLLQAAGNVLNDYFDREIDADNPNKPSRP 61

Query: 80  IPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYTIWLKRFTPQN 139
           +P G+ISP EA +L ++L +   +++ L +  +   L  + +   ++     LKR     
Sbjct: 62  LPSGRISPREALLLALALLLLG-LLLALLLGPLLLLLGLLGLLLGLLYSLPRLKRRPLLG 120

Query: 140 IVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPM 199
            ++ G+A  +  ++G  +V GD+    L++ L +FL       +  +   +  +KA    
Sbjct: 121 ELVVGLAFGLLILLGAYAVGGDIPSPLLLLALPLFLLGLAILLANDIRDVEGDRKAGRRT 180

Query: 200 LPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWAWRTFLCK 259
           LP  + ++     + +      ++  L  +L  A +   + V                  
Sbjct: 181 LPVRLGEKRALALLALLLAAALLLLAL-LLLLLAPLLLLLAVLLAALALLRALRLLRRRN 239

Query: 260 EDKDIRVTKKLFL 272
            ++  R+   L L
Sbjct: 240 PEEPARLALFLAL 252


>gnl|CDD|30731 COG0382, UbiA, 4-hydroxybenzoate polyprenyltransferase and related
           prenyltransferases [Coenzyme metabolism].
          Length = 289

 Score = 72.6 bits (178), Expect = 1e-13
 Identities = 62/281 (22%), Positives = 130/281 (46%), Gaps = 8/281 (2%)

Query: 11  FIVLLKPRVMSLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASG-ALNMYYDADID 69
            + L +P    L +  A +G++LA   +  LK ++  F     A ++G  +N   D +ID
Sbjct: 16  LLRLDRPIFNLLLLLPALLGLLLAASGLPSLKLLLLAFLAFFLARSAGYVINDLADREID 75

Query: 70  KMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVVIYT 129
           ++  RT +RP+P G++S  EA +L + L +  + +  L +N ++  L   ++   + +  
Sbjct: 76  RINPRTKNRPLPSGRVSVKEALLLAILLLLLGLALA-LLLNPLAFLLSLAALV--LALAY 132

Query: 130 IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCK 189
            +LKRFT    ++ G+A  +  + G A+V G + + + ++ L   LWT  +    A+   
Sbjct: 133 PFLKRFTFLPQLVLGLAFGLGALAGAAAVGGSLPLLAWLLLLAAILWTLGYDIIYAIQDI 192

Query: 190 DDYQKASIPMLPNVVTDRTTKMHILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT 249
           +  +KA +  LP +   +      L+  + ++++ +L  + G   + Y + +        
Sbjct: 193 EGDRKAGLKSLPVLFGIKKALALALLLLLASALLVLLGLLAGLLGLIYLLGLLVAALLL- 251

Query: 250 LWAWRTFLCKEDKDIRVTKKLFLESITYLFVLFTILMVDHL 290
                  L  + +D      LF  ++    +LF  L++  L
Sbjct: 252 ---LYQILIVDVRDPPACFALFDVNLLLGLLLFIGLILAVL 289


>gnl|CDD|36595 KOG1381, KOG1381, KOG1381, Para-hydroxybenzoate-polyprenyl
           transferase [Coenzyme transport and metabolism].
          Length = 353

 Score = 51.1 bits (122), Expect = 3e-07
 Identities = 37/125 (29%), Positives = 66/125 (52%), Gaps = 6/125 (4%)

Query: 55  GASGALNMYYDADIDKMMARTASRPIPLGQISPWEAWV-LGVSLAVSSIVIMGLAINWVS 113
           GA   +N  +D D+D  + RT  RP+  G +SP +A   LG  L++   ++  L +NW S
Sbjct: 117 GAGCTINDLWDKDLDAKVERTKLRPLASGSLSPRQAIGFLGAQLSLGLGIL--LQLNWYS 174

Query: 114 ATLLFMSIFCYVVIYTIWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLV-MFLI 172
             L   S    V+ Y + +KRFT    ++ G+      ++GW ++ G +S ++++ ++L 
Sbjct: 175 IALGASS-LALVITYPL-MKRFTYWPQLVLGLTFNWGALLGWCALKGSLSPSAVLPLYLS 232

Query: 173 IFLWT 177
              WT
Sbjct: 233 GVCWT 237


>gnl|CDD|31763 COG1575, MenA, 1,4-dihydroxy-2-naphthoate octaprenyltransferase
           [Coenzyme metabolism].
          Length = 303

 Score = 39.8 bits (93), Expect = 0.001
 Identities = 32/187 (17%), Positives = 64/187 (34%), Gaps = 12/187 (6%)

Query: 1   MYFQVFRLNFFIVLLKPRVMSLAIYTAFVGIVLA---PGHISVLKSVISIFAIAMGAGAS 57
           M  +  +   ++ L +P+ +  AI    VG  LA       ++L +++++ A  +     
Sbjct: 1   MSQKTSKTQLWLELARPKTLPAAIAPVIVGTALAFWYGKSFNLLVALLALIAAILLQILV 60

Query: 58  GALNMYYDA----DIDKMMARTASRPIPLGQISPWEAWVLGVSLAVSSIVIMGLAINWVS 113
              N Y+D     D         S  I    + P     L + L     ++  +      
Sbjct: 61  NLANDYFDYKKGTDTHGPDRLKQSGLIVRQSMKPALILSLALFLLAGLALLGVILAALSD 120

Query: 114 ATLLFMSIFCYVVIYT-----IWLKRFTPQNIVIGGIAGAIPPMIGWASVTGDVSIASLV 168
             +L + + C             L       I +G   G +  +  +   TG +S A L+
Sbjct: 121 WLVLLLGLLCIAAGILYTGGPFPLGYMGLGEIFVGVFFGPLIVLGAYYIQTGRLSWAILL 180

Query: 169 MFLIIFL 175
             L + +
Sbjct: 181 PSLPVGI 187


>gnl|CDD|38403 KOG3193, KOG3193, KOG3193, K+ channel subunit [Inorganic ion
           transport and metabolism].
          Length = 1087

 Score = 34.4 bits (78), Expect = 0.043
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 3/70 (4%)

Query: 214 LIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT---LWAWRTFLCKEDKDIRVTKKL 270
           L++      +  L TM    S+ Y I+VF+L Y  +   L     FL +          +
Sbjct: 83  LLWVDFDFKIWFLQTMFACISMVYTILVFYLSYSGSVVRLLINIHFLLELITSFPFIISI 142

Query: 271 FLESITYLFV 280
           F+ S+TYL+V
Sbjct: 143 FIPSLTYLYV 152


>gnl|CDD|35153 COG5594, COG5594, Uncharacterized integral membrane protein
           [Function unknown].
          Length = 827

 Score = 30.3 bits (68), Expect = 0.75
 Identities = 25/133 (18%), Positives = 49/133 (36%), Gaps = 16/133 (12%)

Query: 153 IGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMH 212
           +           A+++  L+I LW  P    +  +   +   +  P L  ++ D      
Sbjct: 404 LSRKERLFKRISANILFILLIILWAFP-VAFVGTISNLNTLSSLWPFLKFILKDPPFLAG 462

Query: 213 ILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFT-LWAWRTFLCKEDKDIRVTKKLF 271
           IL         G+LPT      V   +++  + Y    L   +  +   +++I V  K F
Sbjct: 463 IL--------TGLLPT------VALSLLMSIVPYFIRWLSYMQGLVSYSEEEIYVQNKYF 508

Query: 272 LESITYLFVLFTI 284
                 LF++ T+
Sbjct: 509 AFLFVNLFLVVTL 521


>gnl|CDD|34807 COG5210, COG5210, GTPase-activating protein [General function
           prediction only].
          Length = 496

 Score = 29.3 bits (65), Expect = 1.4
 Identities = 29/156 (18%), Positives = 55/156 (35%), Gaps = 21/156 (13%)

Query: 158 VTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHILIYT 217
           V G   +A+    L++       FW L  L K+         LP       + +H  +  
Sbjct: 302 VQGMNFLAAP--LLLVLESEEQAFWCLVKLLKNYG-------LPGYFLKNLSGLHRDLKV 352

Query: 218 VLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWAWRTFLCKEDKDI--RVTKKLFLESI 275
           +   +  + P +         +++ F    F       F+ +   +   R+   LFLE  
Sbjct: 353 LDDLVEELDPELYEHLLREGVVLLMFAFRWFLTL----FVREFPLEYALRIWDCLFLEGS 408

Query: 276 TYLFVLFT---ILMVDHLIDMKT---VERYFFSSFL 305
           + LF L      L+ D L+ + +   ++      FL
Sbjct: 409 SMLFQLALAILKLLRDKLLKLDSDELLDLLLKQLFL 444


>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde
           dehydrogenase 2 (YMR170c)-like.  NAD(P)+-dependent
           Saccharomyces cerevisiae aldehyde dehydrogenase 2
           (YMR170c, ALD5, EC=1.2.1.5) and other similar sequences,
           are present in this CD.
          Length = 484

 Score = 27.8 bits (62), Expect = 3.5
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 10/50 (20%)

Query: 83  GQISPWE------AWVLGVSLAVSSIVIMGLAINWVSATLLFMSIFCYVV 126
           GQI PW       AW L  +LA  + V++  A N    T L +  F  +V
Sbjct: 149 GQIIPWNYPLAMAAWKLAPALAAGNTVVIKPAEN----TPLSLLYFANLV 194


>gnl|CDD|36349 KOG1134, KOG1134, KOG1134, Uncharacterized conserved protein
           [General function prediction only].
          Length = 728

 Score = 27.2 bits (60), Expect = 5.5
 Identities = 19/133 (14%), Positives = 48/133 (36%), Gaps = 17/133 (12%)

Query: 153 IGWASVTGDVSIASLVMFLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMH 212
           I +        + ++ +FL++F W  P    +  L   +      P L  ++  +     
Sbjct: 351 ISYVERYLRRFLVNVALFLLLFFWIIP-VAFVQALTNLEGLSKVFPFLKPILEMK----- 404

Query: 213 ILIYTVLTSIVGVLPTMLGFASVTYGIIVFFLGYHFTLWA-WRTFLCKEDKDIRVTKKLF 271
                + + I G LPT      +   I +  L       +     + + +++     K +
Sbjct: 405 ----FISSVITGFLPT------LALVIFLALLPPFLRYLSKLEGLISRSEEERSALNKYY 454

Query: 272 LESITYLFVLFTI 284
           +  +  +F++ T+
Sbjct: 455 IFLLVNVFLVVTL 467


>gnl|CDD|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport
           system, ATPase component [Carbohydrate transport and
           metabolism / Cell envelope biogenesis, outer membrane].
          Length = 249

 Score = 27.1 bits (60), Expect = 5.5
 Identities = 9/19 (47%), Positives = 10/19 (52%)

Query: 145 IAGAIPPMIGWASVTGDVS 163
           IAG   P  G   VTG V+
Sbjct: 7