RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780360|ref|YP_003064773.1| protoheme IX
farnesyltransferase [Candidatus Liberibacter asiaticus str. psy62]
         (305 letters)



>1sva_1 Simian virus 40; virus coat protein, icosahedral virus; 3.10A
           {Simian virus 40} SCOP: b.121.6.1
          Length = 361

 Score = 29.1 bits (65), Expect = 1.3
 Identities = 18/99 (18%), Positives = 29/99 (29%), Gaps = 26/99 (26%)

Query: 177 TPPHFW--SLALLCKDD-------------YQKASI--PMLPNVVTDRTTKMHILIYTVL 219
              H    S +L  +               Y  A I  P +   +T     M     TV 
Sbjct: 58  PDEHQKGLSKSLAAEKQFTDDSPDKEQLPCYSVARIPLPNINEDLTCGNILMWEA-VTVK 116

Query: 220 TSIVGV--LPTMLGFASVTYGIIVFF----LGYHFTLWA 252
           T ++GV  +  +      T+            +HF  +A
Sbjct: 117 TEVIGVTAMLNLHSGTQKTHENGAGKPIQGSNFHF--FA 153


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 28.8 bits (64), Expect = 1.5
 Identities = 36/190 (18%), Positives = 51/190 (26%), Gaps = 92/190 (48%)

Query: 136 TPQNIVIGGIAGAIPPMIGWASVTGDVSIASLVMFLIIFLWTPPHFWSLAL-LCKDDYQK 194
             +N+V+ G     PP              SL                L L L K    K
Sbjct: 373 GAKNLVVSG-----PPQ-------------SLY--------------GLNLTLRK---AK 397

Query: 195 AS-------IPMLPNVVTDRTTKMH--ILIYTV------LTSIVGVLPTMLGFASVTY-- 237
           A        IP      ++R  K     L          L     ++   L   +V++  
Sbjct: 398 APSGLDQSRIPF-----SERKLKFSNRFLPVASPFHSHLLVPASDLINKDLVKNNVSFNA 452

Query: 238 ---GIIVFFLGYHFTLWAWRTFLCKED-KDIRVTKKLFLESIT-YLFVLFTILMVD---- 288
               I V    Y        TF    D  D+RV       SI+  +      L V     
Sbjct: 453 KDIQIPV----YD-------TF----DGSDLRVLS----GSISERIVDCIIRLPVKWETT 493

Query: 289 ------HLID 292
                 H++D
Sbjct: 494 TQFKATHILD 503



 Score = 28.8 bits (64), Expect = 1.7
 Identities = 25/156 (16%), Positives = 45/156 (28%), Gaps = 51/156 (32%)

Query: 163 SIASLVM--------FLIIFLWTPPHFWSLALLCKDDYQKASIPMLPNVVTDRTTKMHIL 214
           S   L +         L+     P   + +A   ++ + K  +P      T+        
Sbjct: 5   STRPLTLSHGSLEHVLLV-----PTASFFIASQLQEQFNK-ILP----EPTEGFA----- 49

Query: 215 IYTVLTSIVGVLPTMLGF---------ASVTYGIIVFFLGYHFTLWAWRTFLCKEDKDIR 265
                T+   ++   LG+               ++   L   F       +L     DI 
Sbjct: 50  ADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCLT-EFE----NCYLE--GNDIH 102

Query: 266 -VTKKLFLESITYLFVLFTILMVDHLIDMKTVERYF 300
            +  KL  E+ T      T++    LI  K    Y 
Sbjct: 103 ALAAKLLQENDT------TLVKTKELI--KN---YI 127


>3bwr_A Capsid protein VP1; SV40, GM1, viral receptor, viral attachment,
           ganglioside, polyomaviruses, late protein, nucleus,
           virion, viral protein; HET: SIA GAL NGA BGC; 2.25A
           {Simian virus 40} PDB: 3bwq_A*
          Length = 272

 Score = 28.7 bits (64), Expect = 1.6
 Identities = 13/63 (20%), Positives = 23/63 (36%), Gaps = 5/63 (7%)

Query: 194 KASIPMLPNVVTDRTTKMHILIYTVLTSIVGV--LPTMLGFASVT--YGIIVFFLGYHFT 249
           +  +P +   +T     M     TV T ++GV  +  +      T   G      G +F 
Sbjct: 67  RIPLPNINEDLTCGNILMWEA-VTVKTEVIGVTAMLNLHSGTQKTHENGAGKPIQGSNFH 125

Query: 250 LWA 252
            +A
Sbjct: 126 FFA 128


>3khp_A MAOC family protein; ssgcid, NIH, niaid, decode, university of
          washington, emerald biostructures, SBRI, dehydrogenase;
          HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV}
          Length = 311

 Score = 26.7 bits (58), Expect = 6.1
 Identities = 15/78 (19%), Positives = 24/78 (30%), Gaps = 1/78 (1%)

Query: 21 SLAIYTAFVGIVLAPGHISVLKSVISIFAIAMGAGASGALNMYYDADIDKMMARTASRPI 80
          S+AI    +G V  P           ++AI +GAG    L    +           +  +
Sbjct: 21 SMAIDPNSIGAVTEPMLFEWTDRDTLLYAIGVGAGTG-DLAFTTENSHGIDQQVLPTYAV 79

Query: 81 PLGQISPWEAWVLGVSLA 98
                   A V   + A
Sbjct: 80 ICCPAFGAAAKVGTFNPA 97


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.332    0.143    0.453 

Gapped
Lambda     K      H
   0.267   0.0497    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,687,887
Number of extensions: 119947
Number of successful extensions: 380
Number of sequences better than 10.0: 1
Number of HSP's gapped: 378
Number of HSP's successfully gapped: 33
Length of query: 305
Length of database: 5,693,230
Length adjustment: 92
Effective length of query: 213
Effective length of database: 3,462,782
Effective search space: 737572566
Effective search space used: 737572566
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 56 (25.9 bits)