HHsearch results for GI: 254780361 and protein with PDBid: 2f9i_B

>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus}
Probab=93.62  E-value=0.026  Score=31.69  Aligned_cols=31  Identities=13%  Similarity=0.034  Sum_probs=22.2

Q ss_pred             HHCCCCCC--EEECCCCCCEEE------EEEEECCCCCC
Q ss_conf             31026883--788789978244------04642577867
Q gi|254780361|r   19 ADALTPPA--YVEDKKSGELRR------PHHVDMKTGLY   49 (61)
Q Consensus        19 h~~l~~p~--l~~c~~cG~~~~------~H~vc~~cG~Y   49 (61)
                      ..+...|.  -++||+||+...      -..|||+|||+
T Consensus        20 ~~k~~~p~~lW~kCp~C~~~i~~~dl~~n~~VCp~C~~H   58 (285)
T 2f9i_B           20 SKNNDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHH   58 (285)
T ss_dssp             ------CCSSEEECTTTCCEEEHHHHHHTTTBCTTTCCB
T ss_pred             CCCCCCCCCCEECCCCCCCHHHHHHHHHHCCCCCCCCCC
T ss_conf             344789998630288887313299999848889099799