RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780361|ref|YP_003064774.1| ribosomal protein L32 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) >gnl|CDD|145114 pfam01783, Ribosomal_L32p, Ribosomal L32p protein family. Length = 56 Score = 68.0 bits (167), Expect = 5e-13 Identities = 27/54 (50%), Positives = 32/54 (59%) Query: 2 AVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVF 55 AVPKRKTS S++ RR+ L P VE GEL+ PH V G Y+GRQV Sbjct: 1 AVPKRKTSKSRKRKRRAHWKLKAPNLVECPNCGELKLPHRVCPSCGYYKGRQVI 54 >gnl|CDD|30681 COG0333, RpmF, Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]. Length = 57 Score = 64.9 bits (158), Expect = 5e-12 Identities = 31/54 (57%), Positives = 35/54 (64%) Query: 1 MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54 MAVPKRKTS S+R MRRS DAL P GE + PH V +K G Y+GRQV Sbjct: 1 MAVPKRKTSKSRRRMRRSHDALKAPTLSVCPNCGEYKLPHRVCLKCGYYKGRQV 54 >gnl|CDD|177070 CHL00152, rpl32, ribosomal protein L32; Validated. Length = 53 Score = 29.6 bits (67), Expect = 0.18 Identities = 10/18 (55%), Positives = 16/18 (88%) Query: 1 MAVPKRKTSPSKRGMRRS 18 MAVPK++TS SK+ +R++ Sbjct: 1 MAVPKKRTSKSKKRIRKN 18 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0764 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 712,140 Number of extensions: 25969 Number of successful extensions: 49 Number of sequences better than 10.0: 1 Number of HSP's gapped: 49 Number of HSP's successfully gapped: 4 Length of query: 61 Length of database: 6,263,737 Length adjustment: 33 Effective length of query: 28 Effective length of database: 5,550,640 Effective search space: 155417920 Effective search space used: 155417920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.4 bits)