RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780361|ref|YP_003064774.1| ribosomal protein L32
[Candidatus Liberibacter asiaticus str. psy62]
         (61 letters)



>gnl|CDD|179224 PRK01110, rpmF, 50S ribosomal protein L32; Validated.
          Length = 60

 Score = 71.2 bits (175), Expect = 6e-14
 Identities = 34/61 (55%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQVFVLKTK 60
          MAVPKRKTS SKR MRRS   LT P    DK +GE   PHHV    G Y+GR+V   K +
Sbjct: 1  MAVPKRKTSKSKRRMRRSHWKLTAPTLSVDKTTGEYHLPHHVS-PKGYYKGRKVLKKKEE 59

Query: 61 E 61
          E
Sbjct: 60 E 60


>gnl|CDD|183404 PRK12286, rpmF, 50S ribosomal protein L32; Reviewed.
          Length = 57

 Score = 68.7 bits (169), Expect = 3e-13
 Identities = 26/54 (48%), Positives = 32/54 (59%)

Query: 1  MAVPKRKTSPSKRGMRRSADALTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54
          MAVPKRKTS S++  RR+   L  P  VE    GE + PH V    G Y+GR+V
Sbjct: 1  MAVPKRKTSKSRKRKRRAHFKLKAPGLVECPNCGEPKLPHRVCPSCGYYKGREV 54


>gnl|CDD|162165 TIGR01031, rpmF_bact, ribosomal protein L32.  This protein
          describes bacterial ribosomal protein L32. The noise
          cutoff is set low enough to include the equivalent
          protein from mitochondria and chloroplasts. No related
          proteins from the Archaea nor from the eukaryotic
          cytosol are detected by this model. This model is a
          fragment model; the putative L32 of some species shows
          similarity only toward the N-terminus.
          Length = 55

 Score = 60.0 bits (146), Expect = 1e-10
 Identities = 28/53 (52%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 3  VPKRKTSPSKRGMRRSADA-LTPPAYVEDKKSGELRRPHHVDMKTGLYRGRQV 54
          VPKRKTS S++  RRS DA LT P  V     GE + PH V    G Y+GRQV
Sbjct: 1  VPKRKTSKSRKRKRRSHDAKLTAPTLVVCPNCGEFKLPHRVCPSCGYYKGRQV 53


>gnl|CDD|165783 PLN00218, PLN00218, predicted protein; Provisional.
          Length = 151

 Score = 25.3 bits (55), Expect = 3.7
 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%)

Query: 5   KRKTSPSKRGMRR-SADALTPP 25
           KRK  PS RG RR S+ +L+ P
Sbjct: 113 KRKACPSLRGERRDSSSSLSRP 134


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.316    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0689    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 988,183
Number of extensions: 44724
Number of successful extensions: 63
Number of sequences better than 10.0: 1
Number of HSP's gapped: 61
Number of HSP's successfully gapped: 9
Length of query: 61
Length of database: 5,994,473
Length adjustment: 33
Effective length of query: 28
Effective length of database: 5,281,409
Effective search space: 147879452
Effective search space used: 147879452
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.1 bits)